F459801

General Info

Members Datasets Scaffolds Average Seq Length
529 247 1058 347

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10150684|Ga0111539_101506843
Length 364
Sequence VKRGVNPRVEEKQGMSTPTQPAPAPGKRLNRIGLEPIAYRGSKTTLCAGCGHNAITERIIDSFWELGISPEQVLKLSGIGCSSKSPAYFLSQSHGFNSVHGRMPSVATGAVVANRKMIAIGVSGDGDTGAIGIGQFVHLMRRNLPMVYIIEDNGCYGLTKGQFSPTADLGSKLKTGVINDLPPIDTCALAIELGASFVARSFSGDPKQLKAILKAALSHRGTAMIDVLSPCVTFNDHDGSTKSYSYAKDHEEPLSDVSFVPFFEDITIDYDPGTSTTVSLHDGSRIVLTKMTEDYNPTDRIRSLTLLRETARRNEFATGILYVEPDKPDFIDMLGLVDEPLAHLDESRTRPGKAALDEIMESFR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
161 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
162 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
241 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
244 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 6.43
Rhizosphere 90.74
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10150684 3300009094 Bacteria 2722
2 LJNas_1000423 3300000546 Bacteria 7491
3 LJNas_1000739 3300000546 Bacteria 5456
4 JGI25406J46586_10000120 3300003203 Bacteria 34396
5 Ga0065704_10105622 3300005289 Bacteria 2090
6 Ga0065712_10001052 3300005290 Bacteria 13561
7 Ga0065712_10004968 3300005290 Bacteria 5409
8 Ga0065712_10078549 3300005290 Bacteria 3331
9 Ga0065715_10000269 3300005293 Bacteria 20304
10 Ga0065715_10094426 3300005293 Bacteria 4344
11 Ga0065715_10135686 3300005293 Bacteria 1934
12 Ga0065707_10120897 3300005295 Bacteria 2112
13 Ga0070658_10159524 3300005327 Bacteria 1892
14 Ga0070676_10007368 3300005328 Bacteria 5903
15 Ga0070676_10176049 3300005328 Bacteria 1387
16 Ga0070683_100000500 3300005329 Bacteria 27695
17 Ga0070683_100193003 3300005329 Bacteria 1934
18 Ga0070690_100023258 3300005330 Bacteria 3800
19 Ga0070670_100009228 3300005331 Bacteria 8427
20 Ga0070670_100035799 3300005331 Bacteria 4274
21 Ga0070670_100063835 3300005331 Bacteria 3160
22 Ga0070670_100096963 3300005331 Bacteria 2536
23 Ga0070670_100242154 3300005331 Bacteria 1570
24 Ga0070677_10001312 3300005333 Bacteria 7947
25 Ga0068869_100030640 3300005334 Bacteria 3778
26 Ga0068869_100059568 3300005334 Bacteria 2796
27 Ga0070666_10001844 3300005335 Bacteria 12917
28 Ga0070666_10028715 3300005335 Bacteria 3652
29 Ga0070666_10073997 3300005335 Bacteria 2321
30 Ga0070680_100115296 3300005336 Bacteria 2239
31 Ga0070682_100296611 3300005337 Bacteria 1184
32 Ga0070660_100187722 3300005339 Bacteria 1674
33 Ga0070689_100011278 3300005340 Bacteria 6398
34 Ga0070689_100030013 3300005340 Bacteria 4123
35 Ga0070689_100101741 3300005340 Bacteria 2275
36 Ga0070687_100015200 3300005343 Bacteria 3473
37 Ga0070668_100070586 3300005347 Bacteria 2720
38 Ga0070668_100165941 3300005347 Bacteria 1794
39 Ga0070669_100016441 3300005353 Bacteria 5278
40 Ga0070669_100027792 3300005353 Bacteria 4071
41 Ga0070669_100057480 3300005353 Bacteria 2854
42 Ga0070669_100170841 3300005353 Bacteria 1695
43 Ga0070675_100017971 3300005354 Bacteria 5627
44 Ga0070675_100041501 3300005354 Bacteria 3758
45 Ga0070675_100143650 3300005354 Bacteria 2041
46 Ga0070675_100179372 3300005354 Bacteria 1831
47 Ga0070671_100014366 3300005355 Bacteria 6396
48 Ga0070671_100331668 3300005355 Bacteria 1297
49 Ga0070674_100003802 3300005356 Bacteria 8533
50 Ga0070674_100070771 3300005356 Bacteria 2465
51 Ga0070673_100005375 3300005364 Bacteria 8187
52 Ga0070673_100021855 3300005364 Bacteria 4648
53 Ga0070673_100031830 3300005364 Bacteria 3963
54 Ga0070673_100331249 3300005364 Bacteria 1347
55 Ga0070688_100020051 3300005365 Bacteria 3882
56 Ga0070688_100072787 3300005365 Bacteria 2203
57 Ga0070688_100188019 3300005365 Bacteria 1437
58 Ga0070659_100123168 3300005366 Bacteria 2102
59 Ga0070667_100000989 3300005367 Bacteria 26078
60 Ga0070667_100021437 3300005367 Bacteria 5365
61 Ga0070667_100119736 3300005367 Bacteria 2289
62 Ga0070667_100399131 3300005367 Bacteria 1251
63 Ga0070713_100008567 3300005436 Bacteria 7260
64 Ga0070710_10008097 3300005437 Bacteria 5111
65 Ga0070701_10021316 3300005438 Bacteria 3090
66 Ga0070700_100070430 3300005441 Bacteria 2230
67 Ga0070694_100011589 3300005444 Bacteria 5460
68 Ga0070663_100061488 3300005455 Bacteria 2705
69 Ga0070663_100088734 3300005455 Bacteria 2287
70 Ga0070678_100144994 3300005456 Bacteria 1905
71 Ga0070662_100006443 3300005457 Bacteria 7565
72 Ga0070681_10073144 3300005458 Bacteria 3390
73 Ga0070685_10012465 3300005466 Bacteria 4467
74 Ga0070685_10082546 3300005466 Bacteria 1929
75 Ga0070699_100008025 3300005518 Bacteria 9167
76 Ga0070699_100444028 3300005518 Bacteria 1176
77 Ga0070679_100005990 3300005530 Bacteria 11304
78 Ga0070679_100280651 3300005530 Bacteria 1618
79 Ga0070684_100001365 3300005535 Bacteria 17516
80 Ga0068853_100228297 3300005539 Bacteria 1702
81 Ga0068853_100397880 3300005539 Bacteria 1289
82 Ga0070672_100002598 3300005543 Bacteria 11535
83 Ga0070672_100014063 3300005543 Bacteria 5663
84 Ga0070672_100023539 3300005543 Bacteria 4542
85 Ga0070672_100032696 3300005543 Bacteria 3929
86 Ga0070672_100048247 3300005543 Bacteria 3308
87 Ga0070672_100139502 3300005543 Bacteria 1998
88 Ga0070672_100190193 3300005543 Bacteria 1713
89 Ga0070686_100015561 3300005544 Bacteria 4409
90 Ga0070695_100188016 3300005545 Bacteria 1468
91 Ga0070696_100081432 3300005546 Bacteria 2294
92 Ga0070665_100030190 3300005548 Bacteria 5455
93 Ga0070665_100054864 3300005548 Bacteria 3996
94 Ga0070665_100059083 3300005548 Bacteria 3844
95 Ga0070665_100539407 3300005548 Bacteria 1178
96 Ga0068855_100209254 3300005563 Bacteria 2193
97 Ga0070664_100008009 3300005564 Bacteria 8537
98 Ga0070664_100015875 3300005564 Bacteria 6166
99 Ga0070664_100016791 3300005564 Bacteria 6008
100 Ga0070664_100055676 3300005564 Bacteria 3359
101 Ga0068857_100037884 3300005577 Bacteria 4272
102 Ga0068857_100132802 3300005577 Bacteria 2246
103 Ga0068856_100006029 3300005614 Bacteria 11923
104 Ga0068859_100000645 3300005617 Bacteria 34867
105 Ga0068859_100084288 3300005617 Bacteria 3223
106 Ga0068859_100179315 3300005617 Bacteria 2201
107 Ga0068859_100206957 3300005617 Bacteria 2047
108 Ga0068864_100005866 3300005618 Bacteria 10062
109 Ga0068864_100016681 3300005618 Bacteria 6120
110 Ga0068864_100023937 3300005618 Bacteria 5132
111 Ga0068864_100227617 3300005618 Bacteria 1723
112 Ga0068864_100231356 3300005618 Bacteria 1709
113 Ga0068861_100011509 3300005719 Bacteria 6154
114 Ga0068861_100011576 3300005719 Bacteria 6137
115 Ga0068861_100028741 3300005719 Bacteria 4059
116 Ga0068861_100298921 3300005719 Bacteria 1393
117 Ga0068870_10027107 3300005840 Bacteria 2863
118 Ga0068863_100002061 3300005841 Bacteria 19922
119 Ga0068863_100002762 3300005841 Bacteria 17386
120 Ga0068863_100145040 3300005841 Bacteria 2270
121 Ga0068863_100276342 3300005841 Bacteria 1627
122 Ga0068863_100492124 3300005841 Bacteria 1207
123 Ga0068858_100021235 3300005842 Bacteria 6064
124 Ga0068858_100118421 3300005842 Bacteria 2476
125 Ga0068860_100010562 3300005843 Bacteria 9123
126 Ga0068860_100035124 3300005843 Bacteria 4810
127 Ga0068862_100013690 3300005844 Bacteria 6718
128 Ga0068862_100186042 3300005844 Bacteria 1866
129 Ga0068862_100205979 3300005844 Bacteria 1775
130 Ga0081539_10000024 3300005985 Bacteria 354702
131 Ga0081539_10000096 3300005985 Bacteria 204059
132 Ga0081539_10002353 3300005985 Bacteria 27164
133 Ga0075368_10041328 3300006042 Bacteria 1811
134 Ga0075366_10008607 3300006195 Bacteria 5682
135 Ga0097621_100005339 3300006237 Bacteria 9047
136 Ga0097621_100031081 3300006237 Bacteria 4234
137 Ga0097621_100045464 3300006237 Bacteria 3547
138 Ga0097621_100052224 3300006237 Bacteria 3330
139 Ga0097621_100077347 3300006237 Bacteria 2762
140 Ga0068871_100014012 3300006358 Bacteria 5966
141 Ga0068871_100059193 3300006358 Bacteria 3120
142 Ga0068871_100086372 3300006358 Bacteria 2606
143 Ga0068871_100133883 3300006358 Bacteria 2103
144 Ga0075428_100000108 3300006844 Bacteria 70319
145 Ga0075428_100004648 3300006844 Bacteria 15196
146 Ga0075428_100098297 3300006844 Bacteria 3191
147 Ga0075428_100178684 3300006844 Bacteria 2298
148 Ga0075430_100019579 3300006846 Bacteria 5758
149 Ga0075430_100043749 3300006846 Bacteria 3786
150 Ga0075431_100001687 3300006847 Bacteria 20728
151 Ga0075431_100020699 3300006847 Bacteria 6722
152 Ga0075431_100356979 3300006847 Bacteria 1469
153 Ga0075433_10000839 3300006852 Bacteria 21522
154 Ga0075433_10020584 3300006852 Bacteria 5521
155 Ga0075433_10130467 3300006852 Bacteria 2233
156 Ga0075433_10169105 3300006852 Bacteria 1945
157 Ga0075433_10189122 3300006852 Bacteria 1832
158 Ga0075433_10236375 3300006852 Bacteria 1622
159 Ga0075434_100001347 3300006871 Bacteria 20612
160 Ga0075434_100071301 3300006871 Unclassified 3466
161 Ga0075434_100125622 3300006871 Bacteria 2582
162 Ga0075434_100173984 3300006871 Bacteria 2173
163 Ga0075434_100178425 3300006871 Bacteria 2144
164 Ga0075429_100014281 3300006880 Bacteria 6888
165 Ga0075429_100143545 3300006880 Bacteria 2090
166 Ga0068865_100158037 3300006881 Bacteria 1726
167 Ga0068865_100186468 3300006881 Bacteria 1601
168 Ga0075436_100000671 3300006914 Bacteria 22502
169 Ga0075436_100244931 3300006914 Bacteria 1275
170 Ga0097620_100000645 3300006931 Bacteria 34867
171 Ga0097620_100053081 3300006931 Bacteria 4076
172 Ga0097620_100084282 3300006931 Bacteria 3223
173 Ga0097620_100179304 3300006931 Bacteria 2201
174 Ga0097620_100206945 3300006931 Bacteria 2047
175 Ga0075435_100006980 3300007076 Bacteria 8018
176 Ga0075435_100051099 3300007076 Bacteria 3329
177 Ga0105240_10120425 3300009093 Bacteria 3160
178 Ga0111539_10000001 3300009094 Bacteria 1035431
179 Ga0111539_10001789 3300009094 Bacteria 28570
180 Ga0111539_10002263 3300009094 Bacteria 25652
181 Ga0111539_10002439 3300009094 Bacteria 24735
182 Ga0111539_10010482 3300009094 Bacteria 11661
183 Ga0111539_10015398 3300009094 Bacteria 9516
184 Ga0111539_10028916 3300009094 Bacteria 6758
185 Ga0111539_10106604 3300009094 Bacteria 3287
186 Ga0111539_10183879 3300009094 Bacteria 2441
187 Ga0111539_10258764 3300009094 Bacteria 2026
188 Ga0111539_10559582 3300009094 Bacteria 1332
189 Ga0105245_10153449 3300009098 Bacteria 2180
190 Ga0105245_10336731 3300009098 Bacteria 1491
191 Ga0114129_10000174 3300009147 Bacteria 70648
192 Ga0114129_10003221 3300009147 Bacteria 22900
193 Ga0114129_10007540 3300009147 Bacteria 15491
194 Ga0114129_10025369 3300009147 Bacteria 8400
195 Ga0114129_10030336 3300009147 Bacteria 7652
196 Ga0114129_10320019 3300009147 Bacteria 2062
197 Ga0105242_10194146 3300009176 Bacteria 1799
198 Ga0105248_10021539 3300009177 Bacteria 7139
199 Ga0105248_10026112 3300009177 Bacteria 6498
200 Ga0105248_10061095 3300009177 Bacteria 4230
201 Ga0105248_10078331 3300009177 Bacteria 3715
202 Ga0105248_10082480 3300009177 Bacteria 3616
203 Ga0105248_10779426 3300009177 Bacteria 1079
204 Ga0105237_10426864 3300009545 Bacteria 1331
205 Ga0105249_10001517 3300009553 Bacteria 20379
206 Ga0105249_10107994 3300009553 Bacteria 2626
207 Ga0105249_10199642 3300009553 Bacteria 1957
208 Ga0105246_10025235 3300011119 Bacteria 3873
209 Ga0157371_10145906 3300013102 Bacteria 1686
210 Ga0157370_10137425 3300013104 Bacteria 2277
211 Ga0157369_10190988 3300013105 Bacteria 2152
212 Ga0157374_10043570 3300013296 Bacteria 4146
213 Ga0157374_10083973 3300013296 Bacteria 3026
214 Ga0157374_10100314 3300013296 Bacteria 2775
215 Ga0157374_10295934 3300013296 Bacteria 1601
216 Ga0157378_10025354 3300013297 Bacteria 5222
217 Ga0157378_10265204 3300013297 Bacteria 1649
218 Ga0163162_10031787 3300013306 Bacteria 5238
219 Ga0163162_10068321 3300013306 Bacteria 3605
220 Ga0163162_10298596 3300013306 Bacteria 1743
221 Ga0157375_10001332 3300013308 Bacteria 21293
222 Ga0157375_10024925 3300013308 Bacteria 5546
223 Ga0157375_10046551 3300013308 Bacteria 4231
224 Ga0157375_10072570 3300013308 Bacteria 3459
225 Ga0157375_10112204 3300013308 Bacteria 2826
226 Ga0157375_10241713 3300013308 Bacteria 1965
227 Ga0163163_10000017 3300014325 Bacteria 208781
228 Ga0163163_10128873 3300014325 Bacteria 2569
229 Ga0163163_10378098 3300014325 Bacteria 1474
230 Ga0157380_10017590 3300014326 Bacteria 5290
231 Ga0157380_10076073 3300014326 Bacteria 2730
232 Ga0157380_10417945 3300014326 Bacteria 1278
233 Ga0157377_10125469 3300014745 Bacteria 1561
234 Ga0157379_10034512 3300014968 Bacteria 4510
235 Ga0157376_10010121 3300014969 Bacteria 6887
236 Ga0157376_10037777 3300014969 Bacteria 3924
237 Ga0163161_10029497 3300017792 Bacteria 3900
238 Ga0224712_10040484 3300022467 Bacteria 1754
239 Ga0207697_10010226 3300025315 Bacteria 4019
240 Ga0207697_10100831 3300025315 Bacteria 1230
241 Ga0207682_10003116 3300025893 Bacteria 7262
242 Ga0207682_10003998 3300025893 Bacteria 6275
243 Ga0207692_10015489 3300025898 Bacteria 3356
244 Ga0207688_10006597 3300025901 Bacteria 6313
245 Ga0207688_10010284 3300025901 Bacteria 5092
246 Ga0207647_10002036 3300025904 Bacteria 15455
247 Ga0207645_10013270 3300025907 Bacteria 5558
248 Ga0207645_10020774 3300025907 Bacteria 4292
249 Ga0207645_10106312 3300025907 Bacteria 1814
250 Ga0207643_10000719 3300025908 Bacteria 20342
251 Ga0207643_10006147 3300025908 Bacteria 6423
252 Ga0207643_10063566 3300025908 Bacteria 2111
253 Ga0207707_10158044 3300025912 Bacteria 1982
254 Ga0207695_10389317 3300025913 Bacteria 1279
255 Ga0207660_10143056 3300025917 Bacteria 1830
256 Ga0207662_10013224 3300025918 Bacteria 4613
257 Ga0207657_10160399 3300025919 Bacteria 1827
258 Ga0207652_10042033 3300025921 Bacteria 3889
259 Ga0207681_10329861 3300025923 Bacteria 1216
260 Ga0207650_10011577 3300025925 Bacteria 6074
261 Ga0207650_10019377 3300025925 Bacteria 4780
262 Ga0207650_10027932 3300025925 Bacteria 4042
263 Ga0207650_10069414 3300025925 Bacteria 2648
264 Ga0207650_10311843 3300025925 Bacteria 1287
265 Ga0207659_10004886 3300025926 Bacteria 8120
266 Ga0207659_10023305 3300025926 Bacteria 4130
267 Ga0207659_10033346 3300025926 Bacteria 3543
268 Ga0207700_10220589 3300025928 Bacteria 1607
269 Ga0207664_10025948 3300025929 Bacteria 4422
270 Ga0207706_10054786 3300025933 Bacteria 3519
271 Ga0207706_10225391 3300025933 Bacteria 1641
272 Ga0207670_10043647 3300025936 Bacteria 2963
273 Ga0207669_10005017 3300025937 Bacteria 5887
274 Ga0207669_10143478 3300025937 Bacteria 1661
275 Ga0207704_10019970 3300025938 Bacteria 3533
276 Ga0207691_10002949 3300025940 Bacteria 16607
277 Ga0207691_10038899 3300025940 Bacteria 4401
278 Ga0207691_10042995 3300025940 Bacteria 4165
279 Ga0207691_10042996 3300025940 Bacteria 4165
280 Ga0207691_10046064 3300025940 Bacteria 4010
281 Ga0207691_10059785 3300025940 Bacteria 3464
282 Ga0207691_10125234 3300025940 Bacteria 2274
283 Ga0207711_10000511 3300025941 Bacteria 39835
284 Ga0207689_10011973 3300025942 Bacteria 7435
285 Ga0207689_10034173 3300025942 Bacteria 4223
286 Ga0207689_10055184 3300025942 Bacteria 3271
287 Ga0207689_10075399 3300025942 Bacteria 2772
288 Ga0207661_10005594 3300025944 Bacteria 8861
289 Ga0207679_10007747 3300025945 Bacteria 6824
290 Ga0207667_10195119 3300025949 Bacteria 2077
291 Ga0207651_10007460 3300025960 Bacteria 5828
292 Ga0207651_10034440 3300025960 Bacteria 3280
293 Ga0207712_10022729 3300025961 Bacteria 4134
294 Ga0207712_10301351 3300025961 Bacteria 1315
295 Ga0207668_10145049 3300025972 Bacteria 1831
296 Ga0207668_10197196 3300025972 Bacteria 1600
297 Ga0207668_10278611 3300025972 Bacteria 1370
298 Ga0207658_10028612 3300025986 Bacteria 3926
299 Ga0207658_10049176 3300025986 Bacteria 3097
300 Ga0207658_10073613 3300025986 Bacteria 2593
301 Ga0207678_10087667 3300026067 Bacteria 2660
302 Ga0207678_10181110 3300026067 Bacteria 1799
303 Ga0207678_10194996 3300026067 Bacteria 1731
304 Ga0207708_10023376 3300026075 Bacteria 4671
305 Ga0207708_10097167 3300026075 Bacteria 2276
306 Ga0207641_10110284 3300026088 Bacteria 2438
307 Ga0207641_10285838 3300026088 Bacteria 1553
308 Ga0207648_10017784 3300026089 Bacteria 6454
309 Ga0207648_10081129 3300026089 Bacteria 2830
310 Ga0207648_10266495 3300026089 Bacteria 1529
311 Ga0207676_10016426 3300026095 Bacteria 5361
312 Ga0207676_10045247 3300026095 Bacteria 3400
313 Ga0207676_10045901 3300026095 Bacteria 3378
314 Ga0207674_10017928 3300026116 Bacteria 7716
315 Ga0207674_10423926 3300026116 Bacteria 1286
316 Ga0207675_100012281 3300026118 Bacteria 8002
317 Ga0207675_100084735 3300026118 Bacteria 2974
318 Ga0207675_100311116 3300026118 Bacteria 1536
319 Ga0207683_10012400 3300026121 Bacteria 7274
320 Ga0207683_10230455 3300026121 Bacteria 1689
321 Ga0207698_10136072 3300026142 Bacteria 2108
322 Ga0207428_10000002 3300027907 Bacteria 854851
323 Ga0207428_10000849 3300027907 Bacteria 34443
324 Ga0207428_10004387 3300027907 Bacteria 13451
325 Ga0207428_10010923 3300027907 Bacteria 8082
326 Ga0207428_10011180 3300027907 Bacteria 7961
327 Ga0207428_10025773 3300027907 Bacteria 4916
328 Ga0207428_10209042 3300027907 Bacteria 1467
329 Ga0268266_10035802 3300028379 Bacteria 4222
330 Ga0268266_10140740 3300028379 Bacteria 2165
331 Ga0268266_10143107 3300028379 Bacteria 2147
332 Ga0268265_10011891 3300028380 Bacteria 5886
333 Ga0268265_10062247 3300028380 Bacteria 2866
334 Ga0268265_10306804 3300028380 Bacteria 1431
335 Ga0268264_10039306 3300028381 Bacteria 3908
336 Ga0268264_10175418 3300028381 Bacteria 1942
337 Ga0265336_10001878 3300028666 Bacteria 9085
338 Ga0265760_10014625 3300031090 Bacteria 2249
339 Ga0265316_10001007 3300031344 Bacteria 30605
340 Ga0307408_100270180 3300031548 Bacteria 1411
341 Ga0307405_10204809 3300031731 Bacteria 1436
342 Ga0307410_10158330 3300031852 Bacteria 1694
343 Ga0307410_10191713 3300031852 Bacteria 1555
344 Ga0307411_10276059 3300032005 Bacteria 1335
345 Ga0373934_0007068 3300035086 Bacteria 4165
346 Ga0373932_0050832 3300035112 Bacteria 1229
347 Ga0373927_0010876 3300035695 Bacteria 6060
348 Ga0373933_0023125 3300035724 Bacteria 3548
349 Ga0373933_0253838 3300035724 Bacteria 1133
350 Ga0373947_0000399 3300035725 Bacteria 24491
351 Ga0373937_0000499 3300036401 Bacteria 35871
352 Ga0373937_0001949 3300036401 Bacteria 17281
353 Ga0373937_0087881 3300036401 Bacteria 2877
354 Ga0373925_0001209 3300037068 Bacteria 22767
355 Ga0395905_0068804 3300037471 Bacteria 3316
356 Ga0395905_0093407 3300037471 Bacteria 2822
357 Ga0436364_0347559 3300037853 Bacteria 1247
358 Ga0436363_0210429 3300039450 Bacteria 1639
359 Ga0436363_0622237 3300039450 Bacteria 2167
360 Ga0436363_0869569 3300039450 Bacteria 2081
361 Ga0436363_1537631 3300039450 Bacteria 1981
362 Ga0450894_001200 3300042131 Bacteria 3841
363 Ga0450908_010797 3300042184 Bacteria 1681
364 Ga0439435_0030075 3300042436 Bacteria 1470
365 Ga0439464_0036666 3300042439 Bacteria 1388
366 Ga0439464_0043567 3300042439 Bacteria 1284
367 Ga0453683_0135390 3300044673 Bacteria 1554
368 Ga0466963_0067333 3300044694 Bacteria 2403
369 Ga0453684_0084396 3300044712 Bacteria 3950
370 Ga0453684_0723447 3300044712 Bacteria 1080
371 Ga0451576_0008042 3300045051 Bacteria 12447
372 Ga0451576_0022914 3300045051 Bacteria 6767
373 Ga0451576_0025872 3300045051 Bacteria 6319
374 Ga0451576_0123792 3300045051 Bacteria 2693
375 Ga0451576_0298918 3300045051 Bacteria 1683
376 Ga0495629_0105033 3300046459 Bacteria 1970
377 Ga0495638_0007866 3300046460 Bacteria 7605
378 Ga0495651_0026908 3300046462 Bacteria 4479
379 Ga0495653_0019761 3300046463 Bacteria 5462
380 Ga0495665_0035412 3300046531 Bacteria 2667
381 Ga0495645_0100539 3300046543 Bacteria 2056
382 Ga0495599_0038251 3300046678 Bacteria 3015
383 Ga0495599_0096900 3300046678 Bacteria 1839
384 Ga0495647_0003002 3300046681 Bacteria 5369
385 Ga0495658_0023673 3300046683 Bacteria 3263
386 Ga0495613_0099408 3300046689 Bacteria 2102
387 Ga0495613_0166662 3300046689 Bacteria 1565
388 Ga0495680_0130878 3300047322 Bacteria 1844
389 Ga0495684_0032654 3300047471 Bacteria 3997
390 Ga0495684_0035673 3300047471 Bacteria 3813
391 Ga0495684_0057472 3300047471 Bacteria 2965
392 Ga0495684_0105529 3300047471 Bacteria 2129
393 Ga0496100_0006282 3300048903 Bacteria 6471
394 Ga0496100_0045682 3300048903 Bacteria 2812
395 Ga0496100_0188772 3300048903 Bacteria 1495
396 Ga0496101_0000222 3300048904 Bacteria 42490
397 Ga0496102_0017609 3300048905 Bacteria 6260
398 Ga0496102_0106816 3300048905 Bacteria 2606
399 Ga0496103_0039199 3300048906 Bacteria 2911
400 Ga0496104_0001478 3300048907 Bacteria 20272
401 Ga0496104_0016812 3300048907 Bacteria 6648
402 Ga0496104_0044478 3300048907 Bacteria 4172
403 Ga0496105_0016285 3300048908 Bacteria 5934
404 Ga0496105_0246966 3300048908 Bacteria 1447
405 Ga0496106_0000977 3300048909 Bacteria 20836
406 Ga0496107_0218165 3300048910 Bacteria 1419
407 Ga0496108_0119269 3300048911 Bacteria 2262
408 Ga0496109_0001591 3300048912 Bacteria 18936
409 Ga0496109_0002883 3300048912 Bacteria 14395
410 Ga0496109_0006323 3300048912 Bacteria 9976
411 Ga0496110_0003223 3300048913 Bacteria 12429
412 Ga0496110_0189705 3300048913 Bacteria 1867
413 Ga0496110_0246176 3300048913 Bacteria 1627
414 Ga0496111_0089134 3300048914 Bacteria 2259
415 Ga0496111_0118267 3300048914 Bacteria 1956
416 Ga0496111_0324024 3300048914 Bacteria 1141
417 Ga0496112_0000913 3300048915 Bacteria 21318
418 Ga0496112_0001633 3300048915 Bacteria 17370
419 Ga0496112_0090896 3300048915 Bacteria 3022
420 Ga0496112_0155496 3300048915 Bacteria 2253
421 Ga0496113_0167260 3300048916 Bacteria 1740
422 Ga0496113_0480121 3300048916 Bacteria 998
423 Ga0496114_0000416 3300048917 Bacteria 31603
424 Ga0496114_0001016 3300048917 Bacteria 21060
425 Ga0496114_0039519 3300048917 Bacteria 3904
426 Ga0496115_0020221 3300048918 Bacteria 5133
427 Ga0501031_0010042 3300049568 Bacteria 6166
428 Ga0501032_0038195 3300049569 Bacteria 3271
429 Ga0501033_0072609 3300049570 Bacteria 2526
430 Ga0501033_0119413 3300049570 Bacteria 1914
431 Ga0501034_0009195 3300049571 Bacteria 10366
432 Ga0501036_0002069 3300049572 Bacteria 15647
433 Ga0501036_0047506 3300049572 Bacteria 3634
434 Ga0501037_0006174 3300049573 Bacteria 8757
435 Ga0501038_0015045 3300049574 Bacteria 7047
436 Ga0501039_0011230 3300049575 Bacteria 6825
437 Ga0501039_0082901 3300049575 Bacteria 2497
438 Ga0501040_0041322 3300049576 Bacteria 3141
439 Ga0501040_0052315 3300049576 Bacteria 2795
440 Ga0501041_0030537 3300049577 Bacteria 3253
441 Ga0501042_0009454 3300049578 Bacteria 6496
442 Ga0501042_0183726 3300049578 Bacteria 1508
443 Ga0501043_0003896 3300049579 Bacteria 12248
444 Ga0501046_0060979 3300049580 Bacteria 2951
445 Ga0501046_0068737 3300049580 Bacteria 2756
446 Ga0501047_0003720 3300049581 Bacteria 14361
447 Ga0501048_0148192 3300049582 Bacteria 1659
448 Ga0501067_0004090 3300049583 Bacteria 8044
449 Ga0501068_0014774 3300049584 Bacteria 4468
450 Ga0501069_0009417 3300049585 Bacteria 5153
451 Ga0501069_0029616 3300049585 Bacteria 3004
452 Ga0501070_0180591 3300049586 Bacteria 1737
453 Ga0501070_0222497 3300049586 Bacteria 1547
454 Ga0501071_0074314 3300049587 Bacteria 2480
455 Ga0501071_0159208 3300049587 Bacteria 1687
456 Ga0501073_0002590 3300049589 Bacteria 13524
457 Ga0501073_0101130 3300049589 Bacteria 2001
458 Ga0501074_0020019 3300049590 Bacteria 4863
459 Ga0501074_0027557 3300049590 Bacteria 4119
460 Ga0501074_0299895 3300049590 Bacteria 1141
461 Ga0501075_0037535 3300049591 Bacteria 3620
462 Ga0501075_0068544 3300049591 Bacteria 2680
463 Ga0501075_0179191 3300049591 Bacteria 1617
464 Ga0501079_0038052 3300049741 Bacteria 3710
465 Ga0501080_0060984 3300049742 Bacteria 3512
466 Ga0501080_0156288 3300049742 Bacteria 2106
467 Ga0501083_0011332 3300049744 Bacteria 6253
468 Ga0501273_006719 3300049770 Bacteria 1339
469 Ga0501035_0057778 3300049822 Bacteria 3458
470 Ga0501035_0137770 3300049822 Bacteria 2123
471 Ga0501044_0099869 3300049823 Bacteria 2920
472 Ga0501045_0127805 3300049824 Bacteria 1888
473 nmdc:mga00v17_134312_c1 3300050491 Bacteria 1583
474 nmdc:mga06z11_77406_c1 3300050494 Bacteria 1776
475 nmdc:mga07m45_89282_c1 3300050496 Bacteria 1765
476 nmdc:mga05p37_124034_c1 3300050507 Bacteria 3173
477 nmdc:mga05p37_204_c1 3300050507 Bacteria 59503
478 nmdc:mga05p37_21801_c1 3300050507 Bacteria 7760
479 nmdc:mga05p37_31808_c1 3300050507 Bacteria 6447
480 nmdc:mga05p37_7226_c1 3300050507 Bacteria 13099
481 nmdc:mga09592_117816_c1 3300050508 Bacteria 2279
482 nmdc:mga09592_14652_c1 3300050508 Bacteria 6397
483 nmdc:mga0qj67_1031_c1 3300050509 Bacteria 19266
484 nmdc:mga0qj67_126273_c1 3300050509 Bacteria 2070
485 nmdc:mga0qj67_16036_c1 3300050509 Bacteria 5675
486 nmdc:mga0qj67_31718_c1 3300050509 Bacteria 4118
487 nmdc:mga0qj67_3991_c1 3300050509 Bacteria 10683
488 nmdc:mga06r32_133540_c1 3300050510 Bacteria 2456
489 nmdc:mga06r32_2396_c1 3300050510 Bacteria 16781
490 nmdc:mga06r32_38284_c1 3300050510 Bacteria 4542
491 nmdc:mga06r32_74634_c1 3300050510 Bacteria 3288
492 nmdc:mga06r32_95014_c1 3300050510 Bacteria 2917
493 nmdc:mga08y16_15221_c1 3300050511 Bacteria 8091
494 nmdc:mga08y16_175386_c1 3300050511 Bacteria 2226
495 nmdc:mga08y16_257149_c1 3300050511 Bacteria 1804
496 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
497 nmdc:mga08y16_49622_c1 3300050511 Bacteria 4392
498 nmdc:mga08y16_66229_c1 3300050511 Bacteria 3770
499 nmdc:mga08y16_8329_c1 3300050511 Bacteria 10851
500 nmdc:mga0n895_265611_c1 3300050512 Bacteria 1741
501 nmdc:mga0n895_28663_c1 3300050512 Bacteria 5300
502 nmdc:mga0n895_47349_c1 3300050512 Bacteria 4203
503 nmdc:mga0n895_477_c1 3300050512 Bacteria 26935
504 nmdc:mga0n895_75379_c1 3300050512 Bacteria 3353
505 nmdc:mga0rr50_152554_c1 3300050513 Bacteria 1868
506 nmdc:mga0rr50_89900_c1 3300050513 Bacteria 2388
507 nmdc:mga08x19_31958_c1 3300050514 Bacteria 3316
508 nmdc:mga08x19_8005_c1 3300050514 Bacteria 6281
509 nmdc:mga0a205_103159_c1 3300050515 Bacteria 2750
510 nmdc:mga0a205_1627_c1 3300050515 Bacteria 19317
511 nmdc:mga0a205_172_c1 3300050515 Bacteria 43386
512 nmdc:mga0a205_255771_c1 3300050515 Bacteria 1630
513 nmdc:mga0a205_43164_c1 3300050515 Bacteria 4348
514 nmdc:mga0a205_53455_c1 3300050515 Bacteria 3898
515 nmdc:mga0a205_646_c1 3300050515 Bacteria 27674
516 nmdc:mga0a205_81371_c1 3300050515 Bacteria 3129
517 Ga0495601_0014121 3300053077 Bacteria 4812
518 Ga0495601_0109654 3300053077 Bacteria 1787
519 Ga0495619_0005774 3300053085 Bacteria 7843
520 Ga0500555_000738 3300053103 Bacteria 12099
521 Ga0500592_012087 3300053116 Bacteria 1380
522 Ga0500616_0000167 3300053153 Bacteria 109823
523 Ga0500645_000021 3300053730 Bacteria 133415
524 Ga0500599_008481 3300053736 Bacteria 1336
525 Ga0501084_0008305 3300054114 Bacteria 8569
526 Ga0501084_0029452 3300054114 Bacteria 4592
527 Ga0501082_0003223 3300060353 Bacteria 14224
528 Ga0501082_0109866 3300060353 Bacteria 2387
529 Ga0530510_0011389 3300061734 Bacteria 6239
530 Ga0111539_10150684
531 LJNas_1000423
532 LJNas_1000739
533 JGI25406J46586_10000120
534 Ga0065704_10105622
535 Ga0065712_10001052
536 Ga0065712_10004968
537 Ga0065712_10078549
538 Ga0065715_10000269
539 Ga0065715_10094426
540 Ga0065715_10135686
541 Ga0065707_10120897
542 Ga0070658_10159524
543 Ga0070676_10007368
544 Ga0070676_10176049
545 Ga0070683_100000500
546 Ga0070683_100193003
547 Ga0070690_100023258
548 Ga0070670_100009228
549 Ga0070670_100035799
550 Ga0070670_100063835
551 Ga0070670_100096963
552 Ga0070670_100242154
553 Ga0070677_10001312
554 Ga0068869_100030640
555 Ga0068869_100059568
556 Ga0070666_10001844
557 Ga0070666_10028715
558 Ga0070666_10073997
559 Ga0070680_100115296
560 Ga0070682_100296611
561 Ga0070660_100187722
562 Ga0070689_100011278
563 Ga0070689_100030013
564 Ga0070689_100101741
565 Ga0070687_100015200
566 Ga0070668_100070586
567 Ga0070668_100165941
568 Ga0070669_100016441
569 Ga0070669_100027792
570 Ga0070669_100057480
571 Ga0070669_100170841
572 Ga0070675_100017971
573 Ga0070675_100041501
574 Ga0070675_100143650
575 Ga0070675_100179372
576 Ga0070671_100014366
577 Ga0070671_100331668
578 Ga0070674_100003802
579 Ga0070674_100070771
580 Ga0070673_100005375
581 Ga0070673_100021855
582 Ga0070673_100031830
583 Ga0070673_100331249
584 Ga0070688_100020051
585 Ga0070688_100072787
586 Ga0070688_100188019
587 Ga0070659_100123168
588 Ga0070667_100000989
589 Ga0070667_100021437
590 Ga0070667_100119736
591 Ga0070667_100399131
592 Ga0070713_100008567
593 Ga0070710_10008097
594 Ga0070701_10021316
595 Ga0070700_100070430
596 Ga0070694_100011589
597 Ga0070663_100061488
598 Ga0070663_100088734
599 Ga0070678_100144994
600 Ga0070662_100006443
601 Ga0070681_10073144
602 Ga0070685_10012465
603 Ga0070685_10082546
604 Ga0070699_100008025
605 Ga0070699_100444028
606 Ga0070679_100005990
607 Ga0070679_100280651
608 Ga0070684_100001365
609 Ga0068853_100228297
610 Ga0068853_100397880
611 Ga0070672_100002598
612 Ga0070672_100014063
613 Ga0070672_100023539
614 Ga0070672_100032696
615 Ga0070672_100048247
616 Ga0070672_100139502
617 Ga0070672_100190193
618 Ga0070686_100015561
619 Ga0070695_100188016
620 Ga0070696_100081432
621 Ga0070665_100030190
622 Ga0070665_100054864
623 Ga0070665_100059083
624 Ga0070665_100539407
625 Ga0068855_100209254
626 Ga0070664_100008009
627 Ga0070664_100015875
628 Ga0070664_100016791
629 Ga0070664_100055676
630 Ga0068857_100037884
631 Ga0068857_100132802
632 Ga0068856_100006029
633 Ga0068859_100000645
634 Ga0068859_100084288
635 Ga0068859_100179315
636 Ga0068859_100206957
637 Ga0068864_100005866
638 Ga0068864_100016681
639 Ga0068864_100023937
640 Ga0068864_100227617
641 Ga0068864_100231356
642 Ga0068861_100011509
643 Ga0068861_100011576
644 Ga0068861_100028741
645 Ga0068861_100298921
646 Ga0068870_10027107
647 Ga0068863_100002061
648 Ga0068863_100002762
649 Ga0068863_100145040
650 Ga0068863_100276342
651 Ga0068863_100492124
652 Ga0068858_100021235
653 Ga0068858_100118421
654 Ga0068860_100010562
655 Ga0068860_100035124
656 Ga0068862_100013690
657 Ga0068862_100186042
658 Ga0068862_100205979
659 Ga0081539_10000024
660 Ga0081539_10000096
661 Ga0081539_10002353
662 Ga0075368_10041328
663 Ga0075366_10008607
664 Ga0097621_100005339
665 Ga0097621_100031081
666 Ga0097621_100045464
667 Ga0097621_100052224
668 Ga0097621_100077347
669 Ga0068871_100014012
670 Ga0068871_100059193
671 Ga0068871_100086372
672 Ga0068871_100133883
673 Ga0075428_100000108
674 Ga0075428_100004648
675 Ga0075428_100098297
676 Ga0075428_100178684
677 Ga0075430_100019579
678 Ga0075430_100043749
679 Ga0075431_100001687
680 Ga0075431_100020699
681 Ga0075431_100356979
682 Ga0075433_10000839
683 Ga0075433_10020584
684 Ga0075433_10130467
685 Ga0075433_10169105
686 Ga0075433_10189122
687 Ga0075433_10236375
688 Ga0075434_100001347
689 Ga0075434_100071301
690 Ga0075434_100125622
691 Ga0075434_100173984
692 Ga0075434_100178425
693 Ga0075429_100014281
694 Ga0075429_100143545
695 Ga0068865_100158037
696 Ga0068865_100186468
697 Ga0075436_100000671
698 Ga0075436_100244931
699 Ga0097620_100000645
700 Ga0097620_100053081
701 Ga0097620_100084282
702 Ga0097620_100179304
703 Ga0097620_100206945
704 Ga0075435_100006980
705 Ga0075435_100051099
706 Ga0105240_10120425
707 Ga0111539_10000001
708 Ga0111539_10001789
709 Ga0111539_10002263
710 Ga0111539_10002439
711 Ga0111539_10010482
712 Ga0111539_10015398
713 Ga0111539_10028916
714 Ga0111539_10106604
715 Ga0111539_10183879
716 Ga0111539_10258764
717 Ga0111539_10559582
718 Ga0105245_10153449
719 Ga0105245_10336731
720 Ga0114129_10000174
721 Ga0114129_10003221
722 Ga0114129_10007540
723 Ga0114129_10025369
724 Ga0114129_10030336
725 Ga0114129_10320019
726 Ga0105242_10194146
727 Ga0105248_10021539
728 Ga0105248_10026112
729 Ga0105248_10061095
730 Ga0105248_10078331
731 Ga0105248_10082480
732 Ga0105248_10779426
733 Ga0105237_10426864
734 Ga0105249_10001517
735 Ga0105249_10107994
736 Ga0105249_10199642
737 Ga0105246_10025235
738 Ga0157371_10145906
739 Ga0157370_10137425
740 Ga0157369_10190988
741 Ga0157374_10043570
742 Ga0157374_10083973
743 Ga0157374_10100314
744 Ga0157374_10295934
745 Ga0157378_10025354
746 Ga0157378_10265204
747 Ga0163162_10031787
748 Ga0163162_10068321
749 Ga0163162_10298596
750 Ga0157375_10001332
751 Ga0157375_10024925
752 Ga0157375_10046551
753 Ga0157375_10072570
754 Ga0157375_10112204
755 Ga0157375_10241713
756 Ga0163163_10000017
757 Ga0163163_10128873
758 Ga0163163_10378098
759 Ga0157380_10017590
760 Ga0157380_10076073
761 Ga0157380_10417945
762 Ga0157377_10125469
763 Ga0157379_10034512
764 Ga0157376_10010121
765 Ga0157376_10037777
766 Ga0163161_10029497
767 Ga0224712_10040484
768 Ga0207697_10010226
769 Ga0207697_10100831
770 Ga0207682_10003116
771 Ga0207682_10003998
772 Ga0207692_10015489
773 Ga0207688_10006597
774 Ga0207688_10010284
775 Ga0207647_10002036
776 Ga0207645_10013270
777 Ga0207645_10020774
778 Ga0207645_10106312
779 Ga0207643_10000719
780 Ga0207643_10006147
781 Ga0207643_10063566
782 Ga0207707_10158044
783 Ga0207695_10389317
784 Ga0207660_10143056
785 Ga0207662_10013224
786 Ga0207657_10160399
787 Ga0207652_10042033
788 Ga0207681_10329861
789 Ga0207650_10011577
790 Ga0207650_10019377
791 Ga0207650_10027932
792 Ga0207650_10069414
793 Ga0207650_10311843
794 Ga0207659_10004886
795 Ga0207659_10023305
796 Ga0207659_10033346
797 Ga0207700_10220589
798 Ga0207664_10025948
799 Ga0207706_10054786
800 Ga0207706_10225391
801 Ga0207670_10043647
802 Ga0207669_10005017
803 Ga0207669_10143478
804 Ga0207704_10019970
805 Ga0207691_10002949
806 Ga0207691_10038899
807 Ga0207691_10042995
808 Ga0207691_10042996
809 Ga0207691_10046064
810 Ga0207691_10059785
811 Ga0207691_10125234
812 Ga0207711_10000511
813 Ga0207689_10011973
814 Ga0207689_10034173
815 Ga0207689_10055184
816 Ga0207689_10075399
817 Ga0207661_10005594
818 Ga0207679_10007747
819 Ga0207667_10195119
820 Ga0207651_10007460
821 Ga0207651_10034440
822 Ga0207712_10022729
823 Ga0207712_10301351
824 Ga0207668_10145049
825 Ga0207668_10197196
826 Ga0207668_10278611
827 Ga0207658_10028612
828 Ga0207658_10049176
829 Ga0207658_10073613
830 Ga0207678_10087667
831 Ga0207678_10181110
832 Ga0207678_10194996
833 Ga0207708_10023376
834 Ga0207708_10097167
835 Ga0207641_10110284
836 Ga0207641_10285838
837 Ga0207648_10017784
838 Ga0207648_10081129
839 Ga0207648_10266495
840 Ga0207676_10016426
841 Ga0207676_10045247
842 Ga0207676_10045901
843 Ga0207674_10017928
844 Ga0207674_10423926
845 Ga0207675_100012281
846 Ga0207675_100084735
847 Ga0207675_100311116
848 Ga0207683_10012400
849 Ga0207683_10230455
850 Ga0207698_10136072
851 Ga0207428_10000002
852 Ga0207428_10000849
853 Ga0207428_10004387
854 Ga0207428_10010923
855 Ga0207428_10011180
856 Ga0207428_10025773
857 Ga0207428_10209042
858 Ga0268266_10035802
859 Ga0268266_10140740
860 Ga0268266_10143107
861 Ga0268265_10011891
862 Ga0268265_10062247
863 Ga0268265_10306804
864 Ga0268264_10039306
865 Ga0268264_10175418
866 Ga0265336_10001878
867 Ga0265760_10014625
868 Ga0265316_10001007
869 Ga0307408_100270180
870 Ga0307405_10204809
871 Ga0307410_10158330
872 Ga0307410_10191713
873 Ga0307411_10276059
874 Ga0373934_0007068
875 Ga0373932_0050832
876 Ga0373927_0010876
877 Ga0373933_0023125
878 Ga0373933_0253838
879 Ga0373947_0000399
880 Ga0373937_0000499
881 Ga0373937_0001949
882 Ga0373937_0087881
883 Ga0373925_0001209
884 Ga0395905_0068804
885 Ga0395905_0093407
886 Ga0436364_0347559
887 Ga0436363_0210429
888 Ga0436363_0622237
889 Ga0436363_0869569
890 Ga0436363_1537631
891 Ga0450894_001200
892 Ga0450908_010797
893 Ga0439435_0030075
894 Ga0439464_0036666
895 Ga0439464_0043567
896 Ga0453683_0135390
897 Ga0466963_0067333
898 Ga0453684_0084396
899 Ga0453684_0723447
900 Ga0451576_0008042
901 Ga0451576_0022914
902 Ga0451576_0025872
903 Ga0451576_0123792
904 Ga0451576_0298918
905 Ga0495629_0105033
906 Ga0495638_0007866
907 Ga0495651_0026908
908 Ga0495653_0019761
909 Ga0495665_0035412
910 Ga0495645_0100539
911 Ga0495599_0038251
912 Ga0495599_0096900
913 Ga0495647_0003002
914 Ga0495658_0023673
915 Ga0495613_0099408
916 Ga0495613_0166662
917 Ga0495680_0130878
918 Ga0495684_0032654
919 Ga0495684_0035673
920 Ga0495684_0057472
921 Ga0495684_0105529
922 Ga0496100_0006282
923 Ga0496100_0045682
924 Ga0496100_0188772
925 Ga0496101_0000222
926 Ga0496102_0017609
927 Ga0496102_0106816
928 Ga0496103_0039199
929 Ga0496104_0001478
930 Ga0496104_0016812
931 Ga0496104_0044478
932 Ga0496105_0016285
933 Ga0496105_0246966
934 Ga0496106_0000977
935 Ga0496107_0218165
936 Ga0496108_0119269
937 Ga0496109_0001591
938 Ga0496109_0002883
939 Ga0496109_0006323
940 Ga0496110_0003223
941 Ga0496110_0189705
942 Ga0496110_0246176
943 Ga0496111_0089134
944 Ga0496111_0118267
945 Ga0496111_0324024
946 Ga0496112_0000913
947 Ga0496112_0001633
948 Ga0496112_0090896
949 Ga0496112_0155496
950 Ga0496113_0167260
951 Ga0496113_0480121
952 Ga0496114_0000416
953 Ga0496114_0001016
954 Ga0496114_0039519
955 Ga0496115_0020221
956 Ga0501031_0010042
957 Ga0501032_0038195
958 Ga0501033_0072609
959 Ga0501033_0119413
960 Ga0501034_0009195
961 Ga0501036_0002069
962 Ga0501036_0047506
963 Ga0501037_0006174
964 Ga0501038_0015045
965 Ga0501039_0011230
966 Ga0501039_0082901
967 Ga0501040_0041322
968 Ga0501040_0052315
969 Ga0501041_0030537
970 Ga0501042_0009454
971 Ga0501042_0183726
972 Ga0501043_0003896
973 Ga0501046_0060979
974 Ga0501046_0068737
975 Ga0501047_0003720
976 Ga0501048_0148192
977 Ga0501067_0004090
978 Ga0501068_0014774
979 Ga0501069_0009417
980 Ga0501069_0029616
981 Ga0501070_0180591
982 Ga0501070_0222497
983 Ga0501071_0074314
984 Ga0501071_0159208
985 Ga0501073_0002590
986 Ga0501073_0101130
987 Ga0501074_0020019
988 Ga0501074_0027557
989 Ga0501074_0299895
990 Ga0501075_0037535
991 Ga0501075_0068544
992 Ga0501075_0179191
993 Ga0501079_0038052
994 Ga0501080_0060984
995 Ga0501080_0156288
996 Ga0501083_0011332
997 Ga0501273_006719
998 Ga0501035_0057778
999 Ga0501035_0137770
1000 Ga0501044_0099869
1001 Ga0501045_0127805
1002 nmdc:mga00v17_134312_c1
1003 nmdc:mga06z11_77406_c1
1004 nmdc:mga07m45_89282_c1
1005 nmdc:mga05p37_124034_c1
1006 nmdc:mga05p37_204_c1
1007 nmdc:mga05p37_21801_c1
1008 nmdc:mga05p37_31808_c1
1009 nmdc:mga05p37_7226_c1
1010 nmdc:mga09592_117816_c1
1011 nmdc:mga09592_14652_c1
1012 nmdc:mga0qj67_1031_c1
1013 nmdc:mga0qj67_126273_c1
1014 nmdc:mga0qj67_16036_c1
1015 nmdc:mga0qj67_31718_c1
1016 nmdc:mga0qj67_3991_c1
1017 nmdc:mga06r32_133540_c1
1018 nmdc:mga06r32_2396_c1
1019 nmdc:mga06r32_38284_c1
1020 nmdc:mga06r32_74634_c1
1021 nmdc:mga06r32_95014_c1
1022 nmdc:mga08y16_15221_c1
1023 nmdc:mga08y16_175386_c1
1024 nmdc:mga08y16_257149_c1
1025 nmdc:mga08y16_3_c1
1026 nmdc:mga08y16_49622_c1
1027 nmdc:mga08y16_66229_c1
1028 nmdc:mga08y16_8329_c1
1029 nmdc:mga0n895_265611_c1
1030 nmdc:mga0n895_28663_c1
1031 nmdc:mga0n895_47349_c1
1032 nmdc:mga0n895_477_c1
1033 nmdc:mga0n895_75379_c1
1034 nmdc:mga0rr50_152554_c1
1035 nmdc:mga0rr50_89900_c1
1036 nmdc:mga08x19_31958_c1
1037 nmdc:mga08x19_8005_c1
1038 nmdc:mga0a205_103159_c1
1039 nmdc:mga0a205_1627_c1
1040 nmdc:mga0a205_172_c1
1041 nmdc:mga0a205_255771_c1
1042 nmdc:mga0a205_43164_c1
1043 nmdc:mga0a205_53455_c1
1044 nmdc:mga0a205_646_c1
1045 nmdc:mga0a205_81371_c1
1046 Ga0495601_0014121
1047 Ga0495601_0109654
1048 Ga0495619_0005774
1049 Ga0500555_000738
1050 Ga0500592_012087
1051 Ga0500616_0000167
1052 Ga0500645_000021
1053 Ga0500599_008481
1054 Ga0501084_0008305
1055 Ga0501084_0029452
1056 Ga0501082_0003223
1057 Ga0501082_0109866
1058 Ga0530510_0011389

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

78

227

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cin-assembly3.cif.gz_F crystal structure of pyruvate:ferredoxin oxidoreductase from moorella thermoacetica 0.8236 53 210
6cio-assembly3.cif.gz_E pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with lactyl-tpp bound 0.822 53 210
6cip-assembly2.cif.gz_C pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with acetyl-tpp bound 0.8201 53 210
6n2o-assembly1.cif.gz_D 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.813 18 341
6cio-assembly3.cif.gz_F pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with lactyl-tpp bound 0.8005 53 210
ID Description Score Start End Superfamily
af_O53181_117_260_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8872 94 218 3.40.50.970
af_Q57714_86_295_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8327 99 210 3.40.50.970
af_Q57957_74_243_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8277 88 231 3.40.50.970
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8184 87 236 3.40.50.970
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.7977 87 236 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A3D0UTH0-F1-model_v4 Thiamine pyrophosphate enzyme TPP-binding domain-containing protein 0.9302 80 211 GO:0016625
GO:0030976
AF-A0A0F8Y5H2-F1-model_v4 Thiamine pyrophosphate enzyme TPP-binding domain-containing protein 0.9193 7 199 GO:0016625
GO:0030976
AF-A0A7C3GBX4-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9163 7 209 GO:0016625
GO:0030976
GO:0044281
AF-A0A535RG64-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9121 10 193 GO:0016625
GO:0030976
AF-A0A1Z8VLM2-F1-model_v4 2-oxoglutarate ferredoxin oxidoreductase subunit beta 0.9046 7 181 GO:0016625
GO:0030976
GO:0044281

Map