F459797
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 529 | 247 | 519 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300009011|Ga0105251_10014149|Ga0105251_100141496 |
| Length | 174 |
| Sequence | VSWKRSGDLEHRCKDGGVLMAMSGPPSSRRGRHRAPMADINVTPLVDVMLVLLIIFMVTAPLLVTGVPVNLPETRAKGLDQDQKPTVVSIDRDGGVFIDDAQISDAELPGRLAEIMSANAGKADPPQIFLRADKGLDYGRVMLVMGELNRAGLNKVALVSTGTEQGSAVSSGSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 2 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 3 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 4 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 5 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 6 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 7 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 8 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 9 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 10 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 11 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 18 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 69 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 88 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 143 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 144 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 145 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 146 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 147 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 163 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 164 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 165 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 166 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 168 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 169 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 170 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 171 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 172 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 185 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 186 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 190 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 191 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 192 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 193 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 194 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 195 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 196 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 197 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 198 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 199 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 200 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 201 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 202 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 203 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 208 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 209 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 210 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 211 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 212 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 214 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 215 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 216 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 218 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 219 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 220 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 222 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 223 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 224 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 225 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 226 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 227 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 228 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 230 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 233 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 234 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 235 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 236 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 237 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 238 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 239 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 240 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 241 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 242 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 243 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 244 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 245 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 246 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 247 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.11 |
| Metatranscriptomes | 0 |
| Isolates | 1.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 7.37 |
| Nodule | 0.19 |
| Rhizoplane | 2.46 |
| Rhizosphere | 83.93 |
| Stem | 0 |
| Stem Tuber | 0.19 |
| Unclassified | 5.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1010400 | 3300001976 | Bacteria | 1214 |
| 2 | JGI24740J21852_10131538 | 3300001979 | Bacteria | 624 |
| 3 | JGI24739J22299_10001913 | 3300001989 | Bacteria | 7966 |
| 4 | JGI24739J22299_10052324 | 3300001989 | Bacteria | 1314 |
| 5 | JGI24737J22298_10039902 | 3300001990 | Bacteria | 1442 |
| 6 | JGI24737J22298_10100943 | 3300001990 | Bacteria | 855 |
| 7 | JGI24735J21928_10002676 | 3300002067 | Bacteria | 6157 |
| 8 | JGI24735J21928_10040869 | 3300002067 | Bacteria | 1353 |
| 9 | JGI24738J21930_10001021 | 3300002075 | Bacteria | 7993 |
| 10 | JGI24034J26672_10024749 | 3300002239 | Bacteria | 958 |
| 11 | JGI24034J26672_10099075 | 3300002239 | Bacteria | 548 |
| 12 | JGI24751J29686_10028971 | 3300002459 | Bacteria | 1150 |
| 13 | Ga0055537_1001791 | 3300003773 | Bacteria | 7833 |
| 14 | Ga0055524_1000118 | 3300003775 | Bacteria | 93202 |
| 15 | Ga0055530_10017528 | 3300003791 | Bacteria | 2242 |
| 16 | Ga0055531_10000073 | 3300003794 | Bacteria | 109510 |
| 17 | Ga0055531_10008805 | 3300003794 | Bacteria | 5257 |
| 18 | Ga0055543_1033865 | 3300004625 | Bacteria | 882 |
| 19 | Ga0065165_1030331 | 3300005262 | Bacteria | 1721 |
| 20 | Ga0065165_1074914 | 3300005262 | Bacteria | 891 |
| 21 | Ga0065704_10244845 | 3300005289 | Bacteria | 1005 |
| 22 | Ga0065715_10115198 | 3300005293 | Bacteria | 2423 |
| 23 | Ga0065715_10546941 | 3300005293 | Bacteria | 744 |
| 24 | Ga0065707_10044766 | 3300005295 | Bacteria | 869 |
| 25 | Ga0065707_10081805 | 3300005295 | Bacteria | 38502 |
| 26 | Ga0070658_10019979 | 3300005327 | Bacteria | 5364 |
| 27 | Ga0070683_100234171 | 3300005329 | Bacteria | 1746 |
| 28 | Ga0070670_100000030 | 3300005331 | Bacteria | 164211 |
| 29 | Ga0070670_100004155 | 3300005331 | Bacteria | 12108 |
| 30 | Ga0070670_100036936 | 3300005331 | Bacteria | 4203 |
| 31 | Ga0070670_100091031 | 3300005331 | Bacteria | 2622 |
| 32 | Ga0070666_10000171 | 3300005335 | Bacteria | 44565 |
| 33 | Ga0070680_100000487 | 3300005336 | Bacteria | 27255 |
| 34 | Ga0070680_100107653 | 3300005336 | Bacteria | 2319 |
| 35 | Ga0070660_100044177 | 3300005339 | Bacteria | 3407 |
| 36 | Ga0070661_100000113 | 3300005344 | Bacteria | 67566 |
| 37 | Ga0070661_100313629 | 3300005344 | Bacteria | 1223 |
| 38 | Ga0070668_100000021 | 3300005347 | Bacteria | 96397 |
| 39 | Ga0070668_100010996 | 3300005347 | Bacteria | 6737 |
| 40 | Ga0070668_100064809 | 3300005347 | Bacteria | 2833 |
| 41 | Ga0070668_100079005 | 3300005347 | Bacteria | 2575 |
| 42 | Ga0070668_100087160 | 3300005347 | Bacteria | 2456 |
| 43 | Ga0070668_100698168 | 3300005347 | Bacteria | 895 |
| 44 | Ga0070669_100000001 | 3300005353 | Bacteria | 537589 |
| 45 | Ga0070669_100012326 | 3300005353 | Bacteria | 6064 |
| 46 | Ga0070669_100040711 | 3300005353 | Bacteria | 3378 |
| 47 | Ga0070669_100121793 | 3300005353 | Bacteria | 1991 |
| 48 | Ga0070669_100429053 | 3300005353 | Bacteria | 1086 |
| 49 | Ga0070669_100463785 | 3300005353 | Bacteria | 1046 |
| 50 | Ga0070671_100000007 | 3300005355 | Bacteria | 250397 |
| 51 | Ga0070671_100000114 | 3300005355 | Bacteria | 51983 |
| 52 | Ga0070671_100020058 | 3300005355 | Bacteria | 5447 |
| 53 | Ga0070671_100062130 | 3300005355 | Bacteria | 3111 |
| 54 | Ga0070671_100067370 | 3300005355 | Bacteria | 2985 |
| 55 | Ga0070671_100232893 | 3300005355 | Bacteria | 1563 |
| 56 | Ga0070671_100487221 | 3300005355 | Bacteria | 1060 |
| 57 | Ga0070673_101260357 | 3300005364 | Bacteria | 694 |
| 58 | Ga0070659_100036312 | 3300005366 | Bacteria | 3841 |
| 59 | Ga0070667_100001586 | 3300005367 | Bacteria | 20353 |
| 60 | Ga0070667_100075842 | 3300005367 | Bacteria | 2871 |
| 61 | Ga0070667_101023944 | 3300005367 | Bacteria | 771 |
| 62 | Ga0070663_100005719 | 3300005455 | Bacteria | 7413 |
| 63 | Ga0070663_101270522 | 3300005455 | Bacteria | 649 |
| 64 | Ga0070681_10216562 | 3300005458 | Bacteria | 1831 |
| 65 | Ga0068867_100202170 | 3300005459 | Bacteria | 1591 |
| 66 | Ga0070685_10057007 | 3300005466 | Bacteria | 2273 |
| 67 | Ga0070707_101022641 | 3300005468 | Bacteria | 792 |
| 68 | Ga0070679_100051356 | 3300005530 | Bacteria | 4107 |
| 69 | Ga0068853_100005064 | 3300005539 | Bacteria | 10281 |
| 70 | Ga0068853_100051458 | 3300005539 | Bacteria | 3545 |
| 71 | Ga0070665_100026918 | 3300005548 | Bacteria | 5792 |
| 72 | Ga0070665_100064570 | 3300005548 | Bacteria | 3671 |
| 73 | Ga0070665_100169873 | 3300005548 | Bacteria | 2182 |
| 74 | Ga0070665_100371492 | 3300005548 | Bacteria | 1437 |
| 75 | Ga0068855_100009733 | 3300005563 | Bacteria | 11595 |
| 76 | Ga0068855_101084729 | 3300005563 | Bacteria | 838 |
| 77 | Ga0068857_100010280 | 3300005577 | Bacteria | 8132 |
| 78 | Ga0068857_101107390 | 3300005577 | Bacteria | 765 |
| 79 | Ga0068854_100046585 | 3300005578 | Bacteria | 3087 |
| 80 | Ga0068854_100102525 | 3300005578 | Bacteria | 2147 |
| 81 | Ga0068854_100214226 | 3300005578 | Bacteria | 1521 |
| 82 | Ga0068854_100336585 | 3300005578 | Bacteria | 1231 |
| 83 | Ga0068854_101019087 | 3300005578 | Bacteria | 734 |
| 84 | Ga0068856_101684453 | 3300005614 | Bacteria | 647 |
| 85 | Ga0068856_102241729 | 3300005614 | Bacteria | 555 |
| 86 | Ga0068852_100250008 | 3300005616 | Bacteria | 1698 |
| 87 | Ga0068852_100303983 | 3300005616 | Bacteria | 1545 |
| 88 | Ga0068852_102066655 | 3300005616 | Bacteria | 592 |
| 89 | Ga0068859_100000787 | 3300005617 | Bacteria | 32070 |
| 90 | Ga0068859_100010809 | 3300005617 | Bacteria | 9190 |
| 91 | Ga0068859_100041916 | 3300005617 | Bacteria | 4598 |
| 92 | Ga0068859_100804469 | 3300005617 | Bacteria | 1027 |
| 93 | Ga0068864_100000041 | 3300005618 | Bacteria | 165878 |
| 94 | Ga0068864_100000809 | 3300005618 | Bacteria | 26301 |
| 95 | Ga0068864_100576393 | 3300005618 | Bacteria | 1090 |
| 96 | Ga0068864_101114098 | 3300005618 | Bacteria | 786 |
| 97 | Ga0068861_100000094 | 3300005719 | Bacteria | 43101 |
| 98 | Ga0068861_100002527 | 3300005719 | Bacteria | 11948 |
| 99 | Ga0068861_100403221 | 3300005719 | Bacteria | 1214 |
| 100 | Ga0068851_10018450 | 3300005834 | Bacteria | 3360 |
| 101 | Ga0068851_10022324 | 3300005834 | Bacteria | 3081 |
| 102 | Ga0068851_10088195 | 3300005834 | Bacteria | 1630 |
| 103 | Ga0068863_100000035 | 3300005841 | Bacteria | 165877 |
| 104 | Ga0068863_100000043 | 3300005841 | Bacteria | 153935 |
| 105 | Ga0068863_100008510 | 3300005841 | Bacteria | 10020 |
| 106 | Ga0068860_100018882 | 3300005843 | Bacteria | 6699 |
| 107 | Ga0068862_100000042 | 3300005844 | Bacteria | 165084 |
| 108 | Ga0068862_100000468 | 3300005844 | Bacteria | 43578 |
| 109 | Ga0068862_100135638 | 3300005844 | Bacteria | 2181 |
| 110 | Ga0068862_100187415 | 3300005844 | Bacteria | 1860 |
| 111 | Ga0068862_100319331 | 3300005844 | Bacteria | 1433 |
| 112 | Ga0068862_100405747 | 3300005844 | Bacteria | 1276 |
| 113 | Ga0068862_101309562 | 3300005844 | Bacteria | 726 |
| 114 | Ga0081539_10013701 | 3300005985 | Bacteria | 6089 |
| 115 | Ga0075363_100002692 | 3300006048 | Bacteria | 7347 |
| 116 | Ga0075367_10000051 | 3300006178 | Bacteria | 27695 |
| 117 | Ga0097621_100046877 | 3300006237 | Bacteria | 3499 |
| 118 | Ga0068871_100807870 | 3300006358 | Bacteria | 865 |
| 119 | Ga0068871_101018119 | 3300006358 | Bacteria | 772 |
| 120 | Ga0075431_100009771 | 3300006847 | Bacteria | 9634 |
| 121 | Ga0097620_100000787 | 3300006931 | Bacteria | 32070 |
| 122 | Ga0097620_100010809 | 3300006931 | Bacteria | 9190 |
| 123 | Ga0097620_100041917 | 3300006931 | Bacteria | 4598 |
| 124 | Ga0097620_100804447 | 3300006931 | Bacteria | 1027 |
| 125 | Ga0099826_10353641 | 3300006948 | Bacteria | 730 |
| 126 | Ga0105251_10000180 | 3300009011 | Bacteria | 63702 |
| 127 | Ga0105251_10014149 | 3300009011 | Bacteria | 4426 |
| 128 | Ga0105240_10072045 | 3300009093 | Bacteria | 4272 |
| 129 | Ga0105247_10002160 | 3300009101 | Bacteria | 13576 |
| 130 | Ga0105247_10207779 | 3300009101 | Bacteria | 1319 |
| 131 | Ga0105243_10233911 | 3300009148 | Bacteria | 1632 |
| 132 | Ga0105243_10256761 | 3300009148 | Bacteria | 1563 |
| 133 | Ga0105241_10473388 | 3300009174 | Bacteria | 1112 |
| 134 | Ga0105242_10976958 | 3300009176 | Bacteria | 853 |
| 135 | Ga0105248_10000045 | 3300009177 | Bacteria | 165909 |
| 136 | Ga0105248_10000296 | 3300009177 | Bacteria | 59123 |
| 137 | Ga0105248_10108107 | 3300009177 | Bacteria | 3136 |
| 138 | Ga0105248_10246547 | 3300009177 | Bacteria | 2011 |
| 139 | Ga0105248_10479692 | 3300009177 | Bacteria | 1402 |
| 140 | Ga0105237_10024202 | 3300009545 | Bacteria | 6213 |
| 141 | Ga0105238_11751391 | 3300009551 | Bacteria | 653 |
| 142 | Ga0105249_10000055 | 3300009553 | Bacteria | 161674 |
| 143 | Ga0105249_10024855 | 3300009553 | Bacteria | 5388 |
| 144 | Ga0105239_10002689 | 3300010375 | Bacteria | 22375 |
| 145 | Ga0105239_11148465 | 3300010375 | Bacteria | 895 |
| 146 | Ga0163162_10007008 | 3300013306 | Bacteria | 10933 |
| 147 | Ga0163162_10016899 | 3300013306 | Bacteria | 7134 |
| 148 | Ga0163162_10019966 | 3300013306 | Bacteria | 6582 |
| 149 | Ga0157372_11550593 | 3300013307 | Bacteria | 763 |
| 150 | Ga0157375_10002847 | 3300013308 | Bacteria | 14973 |
| 151 | Ga0163163_10608265 | 3300014325 | Bacteria | 1156 |
| 152 | Ga0157380_10000606 | 3300014326 | Bacteria | 22069 |
| 153 | Ga0157380_10932029 | 3300014326 | Bacteria | 897 |
| 154 | Ga0157379_10027204 | 3300014968 | Bacteria | 5092 |
| 155 | Ga0157379_10028314 | 3300014968 | Bacteria | 4986 |
| 156 | Ga0157379_10228446 | 3300014968 | Bacteria | 1687 |
| 157 | Ga0163161_10014669 | 3300017792 | Bacteria | 5456 |
| 158 | Ga0163161_10020336 | 3300017792 | Bacteria | 4658 |
| 159 | Ga0163161_10179163 | 3300017792 | Bacteria | 1624 |
| 160 | Ga0213874_10270176 | 3300021377 | Bacteria | 632 |
| 161 | Ga0209565_1000011 | 3300025263 | Bacteria | 637062 |
| 162 | Ga0209673_1003868 | 3300025273 | Bacteria | 8450 |
| 163 | Ga0207673_1003309 | 3300025290 | Bacteria | 1878 |
| 164 | Ga0209758_1008619 | 3300025297 | Bacteria | 6550 |
| 165 | Ga0209050_1000209 | 3300025298 | Bacteria | 130884 |
| 166 | Ga0209050_1006138 | 3300025298 | Bacteria | 7240 |
| 167 | Ga0209256_1000016 | 3300025299 | Bacteria | 599092 |
| 168 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 169 | Ga0209257_1006974 | 3300025304 | Bacteria | 7035 |
| 170 | Ga0207697_10000442 | 3300025315 | Bacteria | 23401 |
| 171 | Ga0207656_10009065 | 3300025321 | Bacteria | 3687 |
| 172 | Ga0207713_1001001 | 3300025735 | Bacteria | 24726 |
| 173 | Ga0207713_1014992 | 3300025735 | Bacteria | 3996 |
| 174 | Ga0207710_10005275 | 3300025900 | Bacteria | 5584 |
| 175 | Ga0207710_10209148 | 3300025900 | Bacteria | 965 |
| 176 | Ga0207680_10001461 | 3300025903 | Bacteria | 11187 |
| 177 | Ga0207647_10342559 | 3300025904 | Bacteria | 847 |
| 178 | Ga0207705_10376076 | 3300025909 | Bacteria | 1097 |
| 179 | Ga0207654_10163870 | 3300025911 | Bacteria | 1438 |
| 180 | Ga0207707_10327945 | 3300025912 | Bacteria | 1321 |
| 181 | Ga0207695_10017242 | 3300025913 | Bacteria | 8411 |
| 182 | Ga0207695_10202888 | 3300025913 | Bacteria | 1896 |
| 183 | Ga0207671_10001440 | 3300025914 | Bacteria | 27565 |
| 184 | Ga0207657_10054497 | 3300025919 | Bacteria | 3458 |
| 185 | Ga0207657_10331742 | 3300025919 | Bacteria | 1201 |
| 186 | Ga0207649_10000089 | 3300025920 | Bacteria | 76923 |
| 187 | Ga0207652_10115191 | 3300025921 | Bacteria | 2388 |
| 188 | Ga0207646_10931621 | 3300025922 | Bacteria | 770 |
| 189 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 190 | Ga0207681_10268125 | 3300025923 | Bacteria | 1339 |
| 191 | Ga0207681_10408175 | 3300025923 | Bacteria | 1098 |
| 192 | Ga0207694_10549781 | 3300025924 | Bacteria | 969 |
| 193 | Ga0207694_11111459 | 3300025924 | Bacteria | 669 |
| 194 | Ga0207650_10000238 | 3300025925 | Bacteria | 61061 |
| 195 | Ga0207650_10015111 | 3300025925 | Bacteria | 5371 |
| 196 | Ga0207650_10036067 | 3300025925 | Bacteria | 3596 |
| 197 | Ga0207650_10197717 | 3300025925 | Bacteria | 1609 |
| 198 | Ga0207659_10798266 | 3300025926 | Bacteria | 811 |
| 199 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 200 | Ga0207644_10000077 | 3300025931 | Bacteria | 72394 |
| 201 | Ga0207644_10532757 | 3300025931 | Bacteria | 971 |
| 202 | Ga0207644_10666886 | 3300025931 | Bacteria | 866 |
| 203 | Ga0207644_10669787 | 3300025931 | Bacteria | 864 |
| 204 | Ga0207686_10511013 | 3300025934 | Bacteria | 934 |
| 205 | Ga0207709_10224778 | 3300025935 | Bacteria | 1356 |
| 206 | Ga0207691_10125090 | 3300025940 | Bacteria | 2276 |
| 207 | Ga0207691_10883584 | 3300025940 | Bacteria | 749 |
| 208 | Ga0207711_10000027 | 3300025941 | Bacteria | 236548 |
| 209 | Ga0207711_10000251 | 3300025941 | Bacteria | 57860 |
| 210 | Ga0207711_10122361 | 3300025941 | Bacteria | 2324 |
| 211 | Ga0207711_10264875 | 3300025941 | Bacteria | 1580 |
| 212 | Ga0207711_10278727 | 3300025941 | Bacteria | 1539 |
| 213 | Ga0207661_10410439 | 3300025944 | Bacteria | 1229 |
| 214 | Ga0207661_10642839 | 3300025944 | Bacteria | 975 |
| 215 | Ga0207667_10031117 | 3300025949 | Bacteria | 5764 |
| 216 | Ga0207667_10048527 | 3300025949 | Bacteria | 4489 |
| 217 | Ga0207651_10986718 | 3300025960 | Bacteria | 752 |
| 218 | Ga0207712_10000262 | 3300025961 | Bacteria | 51101 |
| 219 | Ga0207712_10039787 | 3300025961 | Bacteria | 3223 |
| 220 | Ga0207712_10092327 | 3300025961 | Bacteria | 2232 |
| 221 | Ga0207712_10429354 | 3300025961 | Bacteria | 1116 |
| 222 | Ga0207668_10000068 | 3300025972 | Bacteria | 81202 |
| 223 | Ga0207668_10001858 | 3300025972 | Bacteria | 12320 |
| 224 | Ga0207668_10003466 | 3300025972 | Bacteria | 9257 |
| 225 | Ga0207668_10077524 | 3300025972 | Bacteria | 2396 |
| 226 | Ga0207640_10040236 | 3300025981 | Bacteria | 2964 |
| 227 | Ga0207640_10194062 | 3300025981 | Bacteria | 1533 |
| 228 | Ga0207640_10247385 | 3300025981 | Bacteria | 1382 |
| 229 | Ga0207658_10000362 | 3300025986 | Bacteria | 44869 |
| 230 | Ga0207658_10024359 | 3300025986 | Bacteria | 4234 |
| 231 | Ga0207658_10435562 | 3300025986 | Bacteria | 1158 |
| 232 | Ga0207703_10040742 | 3300026035 | Bacteria | 3719 |
| 233 | Ga0207639_10014011 | 3300026041 | Bacteria | 5626 |
| 234 | Ga0207639_11208503 | 3300026041 | Bacteria | 709 |
| 235 | Ga0207678_10000068 | 3300026067 | Bacteria | 81610 |
| 236 | Ga0207702_11476383 | 3300026078 | Bacteria | 673 |
| 237 | Ga0207702_11846804 | 3300026078 | Bacteria | 596 |
| 238 | Ga0207641_10000031 | 3300026088 | Bacteria | 224320 |
| 239 | Ga0207641_10000041 | 3300026088 | Bacteria | 191595 |
| 240 | Ga0207641_10048450 | 3300026088 | Bacteria | 3586 |
| 241 | Ga0207648_10682826 | 3300026089 | Bacteria | 951 |
| 242 | Ga0207676_10000039 | 3300026095 | Bacteria | 171142 |
| 243 | Ga0207676_10000383 | 3300026095 | Bacteria | 37759 |
| 244 | Ga0207676_10123464 | 3300026095 | Bacteria | 2188 |
| 245 | Ga0207676_10944673 | 3300026095 | Bacteria | 847 |
| 246 | Ga0207674_10000811 | 3300026116 | Bacteria | 40585 |
| 247 | Ga0207675_100000041 | 3300026118 | Bacteria | 90476 |
| 248 | Ga0207675_100005628 | 3300026118 | Bacteria | 11998 |
| 249 | Ga0207675_100312728 | 3300026118 | Bacteria | 1532 |
| 250 | Ga0207698_10258887 | 3300026142 | Bacteria | 1597 |
| 251 | Ga0207698_10688419 | 3300026142 | Bacteria | 1016 |
| 252 | Ga0209970_1100606 | 3300027614 | Bacteria | 552 |
| 253 | Ga0209813_10000172 | 3300027866 | Bacteria | 21011 |
| 254 | Ga0209974_10008028 | 3300027876 | Bacteria | 3617 |
| 255 | Ga0268266_10019585 | 3300028379 | Bacteria | 5765 |
| 256 | Ga0268266_11132404 | 3300028379 | Bacteria | 757 |
| 257 | Ga0268265_10000061 | 3300028380 | Bacteria | 148625 |
| 258 | Ga0268265_10001875 | 3300028380 | Bacteria | 16712 |
| 259 | Ga0268265_10058781 | 3300028380 | Bacteria | 2938 |
| 260 | Ga0268265_10078398 | 3300028380 | Bacteria | 2598 |
| 261 | Ga0268265_10099240 | 3300028380 | Bacteria | 2347 |
| 262 | Ga0268265_10128782 | 3300028380 | Bacteria | 2099 |
| 263 | Ga0268265_10546329 | 3300028380 | Bacteria | 1099 |
| 264 | Ga0268265_12490559 | 3300028380 | Bacteria | 523 |
| 265 | Ga0268264_10000071 | 3300028381 | Bacteria | 267236 |
| 266 | Ga0268264_10016671 | 3300028381 | Bacteria | 6017 |
| 267 | Ga0307517_10014909 | 3300028786 | Bacteria | 10383 |
| 268 | Ga0316177_1010467 | 3300030731 | Bacteria | 1164 |
| 269 | Ga0316178_1151566 | 3300030735 | Bacteria | 2421 |
| 270 | Ga0316180_1187281 | 3300030736 | Bacteria | 2314 |
| 271 | Ga0316183_1180393 | 3300030742 | Bacteria | 927 |
| 272 | Ga0316182_1153558 | 3300030745 | Bacteria | 966 |
| 273 | Ga0265327_10055612 | 3300031251 | Bacteria | 2043 |
| 274 | Ga0307513_10632148 | 3300031456 | Bacteria | 778 |
| 275 | Ga0307408_100011557 | 3300031548 | Bacteria | 5834 |
| 276 | Ga0307408_100051480 | 3300031548 | Bacteria | 2966 |
| 277 | Ga0307408_100117628 | 3300031548 | Bacteria | 2053 |
| 278 | Ga0307408_100265169 | 3300031548 | Bacteria | 1423 |
| 279 | Ga0307408_100335925 | 3300031548 | Bacteria | 1277 |
| 280 | Ga0307408_100396029 | 3300031548 | Bacteria | 1185 |
| 281 | Ga0307408_101078937 | 3300031548 | Bacteria | 744 |
| 282 | Ga0307408_101238090 | 3300031548 | Bacteria | 697 |
| 283 | Ga0307408_101975026 | 3300031548 | Bacteria | 560 |
| 284 | Ga0307405_10023829 | 3300031731 | Bacteria | 3485 |
| 285 | Ga0307405_10039398 | 3300031731 | Bacteria | 2855 |
| 286 | Ga0307405_10067552 | 3300031731 | Bacteria | 2285 |
| 287 | Ga0307405_10114949 | 3300031731 | Bacteria | 1830 |
| 288 | Ga0307405_10131803 | 3300031731 | Bacteria | 1728 |
| 289 | Ga0307405_10219714 | 3300031731 | Bacteria | 1393 |
| 290 | Ga0307405_10243906 | 3300031731 | Bacteria | 1333 |
| 291 | Ga0307405_10298729 | 3300031731 | Bacteria | 1220 |
| 292 | Ga0307405_10619945 | 3300031731 | Bacteria | 885 |
| 293 | Ga0307405_11323257 | 3300031731 | Bacteria | 627 |
| 294 | Ga0307405_11559296 | 3300031731 | Bacteria | 582 |
| 295 | Ga0307413_10009505 | 3300031824 | Bacteria | 4658 |
| 296 | Ga0307413_10013310 | 3300031824 | Bacteria | 4130 |
| 297 | Ga0307413_10060608 | 3300031824 | Bacteria | 2330 |
| 298 | Ga0307413_10062284 | 3300031824 | Bacteria | 2306 |
| 299 | Ga0307413_10238653 | 3300031824 | Bacteria | 1340 |
| 300 | Ga0307413_10295783 | 3300031824 | Bacteria | 1225 |
| 301 | Ga0307413_10314509 | 3300031824 | Bacteria | 1193 |
| 302 | Ga0307413_10344969 | 3300031824 | Bacteria | 1147 |
| 303 | Ga0307413_10784987 | 3300031824 | Bacteria | 799 |
| 304 | Ga0307413_11350426 | 3300031824 | Bacteria | 625 |
| 305 | Ga0307413_11437520 | 3300031824 | Bacteria | 608 |
| 306 | Ga0307410_10025503 | 3300031852 | Bacteria | 3710 |
| 307 | Ga0307410_10129911 | 3300031852 | Bacteria | 1849 |
| 308 | Ga0307410_10231238 | 3300031852 | Bacteria | 1428 |
| 309 | Ga0307410_10247483 | 3300031852 | Bacteria | 1384 |
| 310 | Ga0307410_10270282 | 3300031852 | Bacteria | 1329 |
| 311 | Ga0307410_10394589 | 3300031852 | Bacteria | 1116 |
| 312 | Ga0307410_10475997 | 3300031852 | Bacteria | 1023 |
| 313 | Ga0307410_10485635 | 3300031852 | Bacteria | 1014 |
| 314 | Ga0307410_11226445 | 3300031852 | Bacteria | 654 |
| 315 | Ga0307406_10006284 | 3300031901 | Bacteria | 6547 |
| 316 | Ga0307406_10036022 | 3300031901 | Bacteria | 3046 |
| 317 | Ga0307406_10061761 | 3300031901 | Bacteria | 2421 |
| 318 | Ga0307406_10132577 | 3300031901 | Bacteria | 1751 |
| 319 | Ga0307406_10181581 | 3300031901 | Bacteria | 1532 |
| 320 | Ga0307406_10311608 | 3300031901 | Bacteria | 1213 |
| 321 | Ga0307406_10397440 | 3300031901 | Bacteria | 1091 |
| 322 | Ga0307406_10441583 | 3300031901 | Bacteria | 1041 |
| 323 | Ga0307406_10543634 | 3300031901 | Bacteria | 949 |
| 324 | Ga0307406_10652952 | 3300031901 | Bacteria | 873 |
| 325 | Ga0307406_11326436 | 3300031901 | Bacteria | 629 |
| 326 | Ga0307407_10003784 | 3300031903 | Bacteria | 6294 |
| 327 | Ga0307407_10024854 | 3300031903 | Bacteria | 3148 |
| 328 | Ga0307407_10111121 | 3300031903 | Bacteria | 1720 |
| 329 | Ga0307407_10118948 | 3300031903 | Bacteria | 1671 |
| 330 | Ga0307407_10194740 | 3300031903 | Bacteria | 1354 |
| 331 | Ga0307407_10278637 | 3300031903 | Bacteria | 1157 |
| 332 | Ga0307407_10781101 | 3300031903 | Bacteria | 725 |
| 333 | Ga0307412_10001563 | 3300031911 | Bacteria | 12598 |
| 334 | Ga0307412_10046826 | 3300031911 | Bacteria | 2836 |
| 335 | Ga0307412_10059289 | 3300031911 | Bacteria | 2564 |
| 336 | Ga0307412_10084975 | 3300031911 | Bacteria | 2198 |
| 337 | Ga0307412_10134960 | 3300031911 | Bacteria | 1799 |
| 338 | Ga0307412_10163373 | 3300031911 | Bacteria | 1657 |
| 339 | Ga0307412_10187660 | 3300031911 | Bacteria | 1560 |
| 340 | Ga0307412_10674097 | 3300031911 | Bacteria | 885 |
| 341 | Ga0307412_10700166 | 3300031911 | Bacteria | 869 |
| 342 | Ga0307412_10842715 | 3300031911 | Bacteria | 799 |
| 343 | Ga0307409_100007148 | 3300031995 | Bacteria | 6650 |
| 344 | Ga0307409_100022526 | 3300031995 | Bacteria | 4346 |
| 345 | Ga0307409_100064682 | 3300031995 | Bacteria | 2874 |
| 346 | Ga0307409_100076623 | 3300031995 | Bacteria | 2682 |
| 347 | Ga0307409_100113522 | 3300031995 | Bacteria | 2277 |
| 348 | Ga0307409_100877530 | 3300031995 | Bacteria | 909 |
| 349 | Ga0307409_100950883 | 3300031995 | Bacteria | 875 |
| 350 | Ga0307409_101039404 | 3300031995 | Bacteria | 838 |
| 351 | Ga0307409_101569545 | 3300031995 | Bacteria | 686 |
| 352 | Ga0307409_101696636 | 3300031995 | Bacteria | 660 |
| 353 | Ga0307416_100036866 | 3300032002 | Bacteria | 3756 |
| 354 | Ga0307416_100037872 | 3300032002 | Bacteria | 3716 |
| 355 | Ga0307416_100045139 | 3300032002 | Bacteria | 3467 |
| 356 | Ga0307416_100049966 | 3300032002 | Bacteria | 3329 |
| 357 | Ga0307416_100541482 | 3300032002 | Bacteria | 1236 |
| 358 | Ga0307416_100721329 | 3300032002 | Bacteria | 1087 |
| 359 | Ga0307416_100810385 | 3300032002 | Bacteria | 1032 |
| 360 | Ga0307416_100904890 | 3300032002 | Bacteria | 982 |
| 361 | Ga0307416_100905187 | 3300032002 | Bacteria | 982 |
| 362 | Ga0307416_100997021 | 3300032002 | Bacteria | 940 |
| 363 | Ga0307416_101560537 | 3300032002 | Bacteria | 766 |
| 364 | Ga0307414_10000308 | 3300032004 | Bacteria | 28338 |
| 365 | Ga0307414_10005443 | 3300032004 | Bacteria | 7010 |
| 366 | Ga0307414_10018974 | 3300032004 | Bacteria | 4251 |
| 367 | Ga0307414_10020384 | 3300032004 | Bacteria | 4132 |
| 368 | Ga0307414_10020899 | 3300032004 | Bacteria | 4090 |
| 369 | Ga0307414_10128427 | 3300032004 | Bacteria | 1963 |
| 370 | Ga0307414_10141905 | 3300032004 | Bacteria | 1882 |
| 371 | Ga0307414_10155110 | 3300032004 | Bacteria | 1811 |
| 372 | Ga0307414_10215528 | 3300032004 | Bacteria | 1572 |
| 373 | Ga0307414_10263575 | 3300032004 | Bacteria | 1439 |
| 374 | Ga0307414_10269538 | 3300032004 | Bacteria | 1425 |
| 375 | Ga0307414_10314894 | 3300032004 | Bacteria | 1329 |
| 376 | Ga0307414_10335293 | 3300032004 | Bacteria | 1293 |
| 377 | Ga0307414_10355085 | 3300032004 | Bacteria | 1259 |
| 378 | Ga0307414_10365094 | 3300032004 | Bacteria | 1243 |
| 379 | Ga0307414_10443906 | 3300032004 | Bacteria | 1136 |
| 380 | Ga0307414_10783788 | 3300032004 | Bacteria | 868 |
| 381 | Ga0307414_10895018 | 3300032004 | Bacteria | 813 |
| 382 | Ga0307414_10899357 | 3300032004 | Bacteria | 811 |
| 383 | Ga0307414_10921993 | 3300032004 | Bacteria | 801 |
| 384 | Ga0307414_11471032 | 3300032004 | Bacteria | 634 |
| 385 | Ga0307414_11553035 | 3300032004 | Bacteria | 616 |
| 386 | Ga0307414_12044263 | 3300032004 | Bacteria | 535 |
| 387 | Ga0307411_10000768 | 3300032005 | Bacteria | 11868 |
| 388 | Ga0307411_10012845 | 3300032005 | Bacteria | 4591 |
| 389 | Ga0307411_10040468 | 3300032005 | Bacteria | 2957 |
| 390 | Ga0307411_10050922 | 3300032005 | Bacteria | 2699 |
| 391 | Ga0307411_10122066 | 3300032005 | Bacteria | 1887 |
| 392 | Ga0307411_10134325 | 3300032005 | Bacteria | 1813 |
| 393 | Ga0307411_10245497 | 3300032005 | Bacteria | 1404 |
| 394 | Ga0307411_11421177 | 3300032005 | Bacteria | 635 |
| 395 | Ga0307411_11568581 | 3300032005 | Bacteria | 607 |
| 396 | Ga0307415_100038354 | 3300032126 | Bacteria | 3157 |
| 397 | Ga0307415_100100707 | 3300032126 | Bacteria | 2118 |
| 398 | Ga0307415_100102552 | 3300032126 | Bacteria | 2102 |
| 399 | Ga0307415_100125483 | 3300032126 | Bacteria | 1933 |
| 400 | Ga0307415_100659027 | 3300032126 | Bacteria | 939 |
| 401 | Ga0307415_102073081 | 3300032126 | Bacteria | 555 |
| 402 | Ga0307510_10197820 | 3300033180 | Bacteria | 1549 |
| 403 | Ga0395905_0940862 | 3300037471 | Bacteria | 767 |
| 404 | Ga0436363_0627825 | 3300039450 | Bacteria | 609 |
| 405 | Ga0439465_0127568 | 3300041413 | Bacteria | 896 |
| 406 | Ga0451802_1555010 | 3300041460 | Bacteria | 614 |
| 407 | Ga0451853_2068090 | 3300041512 | Bacteria | 770 |
| 408 | Ga0439446_0154201 | 3300042156 | Bacteria | 757 |
| 409 | Ga0439464_0006676 | 3300042439 | Bacteria | 3011 |
| 410 | Ga0466970_0785228 | 3300044765 | Bacteria | 557 |
| 411 | Ga0466960_0294412 | 3300044901 | Bacteria | 913 |
| 412 | Ga0495627_087003 | 3300046453 | Bacteria | 901 |
| 413 | Ga0495590_0364812 | 3300046457 | Bacteria | 550 |
| 414 | Ga0495638_0039054 | 3300046460 | Bacteria | 3015 |
| 415 | Ga0495638_0220978 | 3300046460 | Bacteria | 1059 |
| 416 | Ga0495650_0138866 | 3300046471 | Bacteria | 881 |
| 417 | Ga0495650_0247932 | 3300046471 | Bacteria | 606 |
| 418 | Ga0495616_0000007 | 3300046513 | Bacteria | 227689 |
| 419 | Ga0495642_0134181 | 3300046528 | Bacteria | 1067 |
| 420 | Ga0495621_0005871 | 3300046539 | Bacteria | 3554 |
| 421 | Ga0495621_0355868 | 3300046539 | Bacteria | 615 |
| 422 | Ga0495669_0008391 | 3300046684 | Bacteria | 4344 |
| 423 | Ga0495670_0430653 | 3300046691 | Bacteria | 714 |
| 424 | Ga0495671_0048528 | 3300046692 | Bacteria | 2118 |
| 425 | Ga0495686_0000262 | 3300047472 | Bacteria | 94462 |
| 426 | Ga0495686_0000834 | 3300047472 | Bacteria | 39641 |
| 427 | Ga0495686_0458241 | 3300047472 | Bacteria | 676 |
| 428 | Ga0496101_0199974 | 3300048904 | Bacteria | 1544 |
| 429 | Ga0496102_1006514 | 3300048905 | Bacteria | 754 |
| 430 | Ga0496103_0026623 | 3300048906 | Bacteria | 3501 |
| 431 | Ga0496103_0158571 | 3300048906 | Bacteria | 1451 |
| 432 | Ga0496107_0081724 | 3300048910 | Bacteria | 2357 |
| 433 | Ga0496108_0157347 | 3300048911 | Bacteria | 1962 |
| 434 | Ga0496108_0380922 | 3300048911 | Bacteria | 1232 |
| 435 | Ga0496109_0276936 | 3300048912 | Bacteria | 1581 |
| 436 | Ga0496109_1087582 | 3300048912 | Bacteria | 737 |
| 437 | Ga0496110_0007823 | 3300048913 | Bacteria | 8565 |
| 438 | Ga0496111_0054410 | 3300048914 | Bacteria | 2893 |
| 439 | Ga0496114_0009716 | 3300048917 | Bacteria | 7642 |
| 440 | Ga0496116_0170115 | 3300048919 | Bacteria | 1182 |
| 441 | Ga0496117_0005718 | 3300048920 | Bacteria | 12932 |
| 442 | Ga0496117_0030629 | 3300048920 | Bacteria | 4124 |
| 443 | Ga0496117_0061445 | 3300048920 | Bacteria | 2582 |
| 444 | Ga0496118_0000493 | 3300048921 | Bacteria | 65468 |
| 445 | Ga0496118_0001107 | 3300048921 | Bacteria | 41821 |
| 446 | Ga0496118_0037508 | 3300048921 | Bacteria | 3899 |
| 447 | Ga0496118_0045558 | 3300048921 | Bacteria | 3422 |
| 448 | Ga0496121_0001342 | 3300048924 | Bacteria | 42142 |
| 449 | Ga0496121_0098057 | 3300048924 | Bacteria | 2269 |
| 450 | Ga0496121_0126319 | 3300048924 | Bacteria | 1922 |
| 451 | Ga0496121_0463062 | 3300048924 | Bacteria | 814 |
| 452 | Ga0496122_0000306 | 3300048925 | Bacteria | 108166 |
| 453 | Ga0496122_0030304 | 3300048925 | Bacteria | 4537 |
| 454 | Ga0496123_0001592 | 3300048926 | Bacteria | 30871 |
| 455 | Ga0496124_0077370 | 3300048927 | Bacteria | 2744 |
| 456 | Ga0496125_0017748 | 3300048928 | Bacteria | 6774 |
| 457 | Ga0496125_0018638 | 3300048928 | Bacteria | 6587 |
| 458 | Ga0496125_0211088 | 3300048928 | Bacteria | 1261 |
| 459 | Ga0496125_0278917 | 3300048928 | Bacteria | 1037 |
| 460 | Ga0496125_0473182 | 3300048928 | Bacteria | 712 |
| 461 | Ga0496126_0111938 | 3300048929 | Bacteria | 2377 |
| 462 | Ga0496126_0161083 | 3300048929 | Bacteria | 1917 |
| 463 | Ga0501292_000022 | 3300049515 | Bacteria | 47432 |
| 464 | Ga0501294_000093 | 3300049517 | Bacteria | 9905 |
| 465 | Ga0501033_0046394 | 3300049570 | Bacteria | 3231 |
| 466 | Ga0501034_0064209 | 3300049571 | Bacteria | 3686 |
| 467 | Ga0501043_0086941 | 3300049579 | Bacteria | 2457 |
| 468 | Ga0501073_0414312 | 3300049589 | Bacteria | 931 |
| 469 | Ga0501198_006741 | 3300049649 | Bacteria | 1640 |
| 470 | Ga0501202_227463 | 3300049652 | Bacteria | 518 |
| 471 | Ga0501206_028555 | 3300049653 | Bacteria | 821 |
| 472 | Ga0501222_000207 | 3300049662 | Bacteria | 10398 |
| 473 | Ga0501223_000599 | 3300049663 | Bacteria | 8650 |
| 474 | Ga0501223_000978 | 3300049663 | Bacteria | 6741 |
| 475 | Ga0501224_000006 | 3300049664 | Bacteria | 149611 |
| 476 | Ga0501224_000109 | 3300049664 | Bacteria | 8861 |
| 477 | Ga0501227_021759 | 3300049665 | Bacteria | 1479 |
| 478 | Ga0501233_000508 | 3300049668 | Bacteria | 6253 |
| 479 | Ga0501233_083091 | 3300049668 | Bacteria | 827 |
| 480 | Ga0501235_002784 | 3300049669 | Bacteria | 3764 |
| 481 | Ga0501235_050002 | 3300049669 | Bacteria | 967 |
| 482 | Ga0501236_043757 | 3300049670 | Bacteria | 749 |
| 483 | Ga0501239_028127 | 3300049672 | Bacteria | 725 |
| 484 | Ga0501259_000841 | 3300049688 | Bacteria | 5056 |
| 485 | Ga0501261_000075 | 3300049690 | Bacteria | 17084 |
| 486 | Ga0501225_0001785 | 3300049705 | Bacteria | 6734 |
| 487 | Ga0501225_0001860 | 3300049705 | Bacteria | 6631 |
| 488 | Ga0501229_076860 | 3300049706 | Bacteria | 530 |
| 489 | Ga0501245_000635 | 3300049708 | Bacteria | 4325 |
| 490 | Ga0501268_009369 | 3300049765 | Bacteria | 1504 |
| 491 | Ga0501279_000012 | 3300049775 | Bacteria | 80359 |
| 492 | Ga0501279_095680 | 3300049775 | Bacteria | 529 |
| 493 | Ga0501280_000005 | 3300049776 | Bacteria | 85174 |
| 494 | Ga0501281_00020 | 3300049777 | Bacteria | 19726 |
| 495 | Ga0501282_000176 | 3300049778 | Bacteria | 7822 |
| 496 | Ga0501044_0025435 | 3300049823 | Bacteria | 6274 |
| 497 | Ga0501226_000355 | 3300049853 | Bacteria | 6688 |
| 498 | nmdc:mga0qj67_824388_c1 | 3300050509 | Bacteria | 733 |
| 499 | nmdc:mga06r32_53054_c1 | 3300050510 | Bacteria | 3884 |
| 500 | Ga0500643_000121 | 3300053087 | Bacteria | 81461 |
| 501 | Ga0500643_002760 | 3300053087 | Bacteria | 8790 |
| 502 | Ga0500643_016369 | 3300053087 | Bacteria | 2513 |
| 503 | Ga0500566_0079841 | 3300053094 | Bacteria | 1823 |
| 504 | Ga0500641_0173514 | 3300053096 | Bacteria | 928 |
| 505 | Ga0500562_081465 | 3300053108 | Bacteria | 876 |
| 506 | Ga0500592_000224 | 3300053116 | Bacteria | 10279 |
| 507 | Ga0500594_0005662 | 3300053118 | Bacteria | 2776 |
| 508 | Ga0500608_133899 | 3300053122 | Bacteria | 1108 |
| 509 | Ga0500658_0296373 | 3300053134 | Bacteria | 743 |
| 510 | Ga0500559_0098159 | 3300053136 | Bacteria | 1347 |
| 511 | Ga0500559_0289904 | 3300053136 | Bacteria | 769 |
| 512 | Ga0500577_0098457 | 3300053142 | Bacteria | 1192 |
| 513 | Ga0500604_0013225 | 3300053151 | Bacteria | 2234 |
| 514 | Ga0500616_0007857 | 3300053153 | Bacteria | 6713 |
| 515 | Ga0500616_0270272 | 3300053153 | Bacteria | 718 |
| 516 | Ga0500624_000254 | 3300053157 | Bacteria | 18781 |
| 517 | Ga0500627_0000272 | 3300053158 | Bacteria | 14690 |
| 518 | Ga0500636_0006645 | 3300053177 | Bacteria | 6650 |
| 519 | Ga0500587_011857 | 3300053739 | Bacteria | 1100 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026041 | Ga0207639_11208503 | Ga0207639_112085031 | 113 |
| 2 | 3300048906 | Ga0496103_0158571 | Ga0496103_0158571_16_399 | 113 |
| 3 | 3300032004 | Ga0307414_10269538 | Ga0307414_102695382 | 120 |
| 4 | 3300006847 | Ga0075431_100009771 | Ga0075431_1000097714 | 121 |
| 5 | iso_pu_bacteria | 2896429255 | 2896429262 | 122 |
| 6 | 3300005577 | Ga0068857_100010280 | Ga0068857_1000102802 | 123 |
| 7 | 3300005614 | Ga0068856_102241729 | Ga0068856_1022417291 | 123 |
| 8 | 3300005616 | Ga0068852_102066655 | Ga0068852_1020666552 | 123 |
| 9 | 3300005834 | Ga0068851_10018450 | Ga0068851_100184502 | 123 |
| 10 | 3300026078 | Ga0207702_11846804 | Ga0207702_118468041 | 123 |
| 11 | 3300053177 | Ga0500636_0006645 | Ga0500636_0006645_5660_6073 | 124 |
| 12 | 3300046453 | Ga0495627_087003 | Ga0495627_087003_149_580 | 125 |
| 13 | 3300048928 | Ga0496125_0278917 | Ga0496125_0278917_508_954 | 125 |
| 14 | 3300053087 | Ga0500643_016369 | Ga0500643_016369_763_1194 | 125 |
| 15 | 3300053153 | Ga0500616_0270272 | Ga0500616_0270272_16_405 | 125 |
| 16 | 3300053157 | Ga0500624_000254 | Ga0500624_000254_564_995 | 125 |
| 17 | 3300005577 | Ga0068857_101107390 | Ga0068857_1011073902 | 126 |
| 18 | 3300014326 | Ga0157380_10932029 | Ga0157380_109320292 | 126 |
| 19 | 3300031731 | Ga0307405_11323257 | Ga0307405_113232572 | 126 |
| 20 | 3300031852 | Ga0307410_11226445 | Ga0307410_112264452 | 126 |
| 21 | 3300032004 | Ga0307414_10895018 | Ga0307414_108950182 | 126 |
| 22 | 3300041413 | Ga0439465_0127568 | Ga0439465_0127568_14_403 | 126 |
| 23 | 3300044901 | Ga0466960_0294412 | Ga0466960_0294412_409_798 | 126 |
| 24 | 3300046539 | Ga0495621_0005871 | Ga0495621_0005871_1977_2366 | 126 |
| 25 | 3300046539 | Ga0495621_0355868 | Ga0495621_0355868_126_515 | 126 |
| 26 | 3300049652 | Ga0501202_227463 | Ga0501202_227463_12_401 | 126 |
| 27 | 3300049672 | Ga0501239_028127 | Ga0501239_028127_129_518 | 126 |
| 28 | 3300049765 | Ga0501268_009369 | Ga0501268_009369_821_1210 | 126 |
| 29 | 3300049775 | Ga0501279_095680 | Ga0501279_095680_98_487 | 126 |
| 30 | 3300050510 | nmdc:mga06r32_53054_c1 | nmdc:mga06r32_53054_c1_1735_2124 | 126 |
| 31 | 3300025931 | Ga0207644_10666886 | Ga0207644_106668862 | 127 |
| 32 | 3300025960 | Ga0207651_10986718 | Ga0207651_109867182 | 127 |
| 33 | 3300026095 | Ga0207676_10123464 | Ga0207676_101234641 | 127 |
| 34 | 3300032004 | Ga0307414_10141905 | Ga0307414_101419052 | 127 |
| 35 | 3300032005 | Ga0307411_11568581 | Ga0307411_115685812 | 127 |
| 36 | 3300046691 | Ga0495670_0430653 | Ga0495670_0430653_243_635 | 127 |
| 37 | 3300048912 | Ga0496109_1087582 | Ga0496109_1087582_136_528 | 127 |
| 38 | 3300053134 | Ga0500658_0296373 | Ga0500658_0296373_21_413 | 127 |
| 39 | 3300053094 | Ga0500566_0079841 | Ga0500566_0079841_968_1363 | 129 |
| 40 | 3300053122 | Ga0500608_133899 | Ga0500608_133899_456_851 | 129 |
| 41 | 3300046460 | Ga0495638_0039054 | Ga0495638_0039054_1672_2127 | 133 |
| 42 | 3300046692 | Ga0495671_0048528 | Ga0495671_0048528_1625_2089 | 133 |
| 43 | 3300053118 | Ga0500594_0005662 | Ga0500594_0005662_39_503 | 133 |
| 44 | iso_pu_bacteria | 2919709256 | 2919711202 | 133 |
| 45 | 3300005539 | Ga0068853_100005064 | Ga0068853_1000050646 | 134 |
| 46 | 3300005578 | Ga0068854_101019087 | Ga0068854_1010190871 | 134 |
| 47 | 3300025904 | Ga0207647_10342559 | Ga0207647_103425592 | 134 |
| 48 | 3300025981 | Ga0207640_10040236 | Ga0207640_100402362 | 134 |
| 49 | 3300026041 | Ga0207639_10014011 | Ga0207639_100140116 | 134 |
| 50 | 3300026116 | Ga0207674_10000811 | Ga0207674_1000081138 | 134 |
| 51 | 3300053739 | Ga0500587_011857 | Ga0500587_011857_196_669 | 134 |
| 52 | iso_pu_bacteria | 2808606401 | 2809065332 | 134 |
| 53 | iso_pu_bacteria | 2808606404 | 2809081276 | 134 |
| 54 | iso_pu_bacteria | 2808606405 | 2809085641 | 134 |
| 55 | iso_pu_bacteria | 2880518877 | 2880520824 | 134 |
| 56 | 3300025926 | Ga0207659_10798266 | Ga0207659_107982662 | 135 |
| 57 | iso_pu_bacteria | 2775507255 | 2778125494 | 135 |
| 58 | 3300004625 | Ga0055543_1033865 | Ga0055543_10338651 | 136 |
| 59 | 3300005262 | Ga0065165_1074914 | Ga0065165_10749142 | 136 |
| 60 | 3300009148 | Ga0105243_10233911 | Ga0105243_102339113 | 136 |
| 61 | 3300025944 | Ga0207661_10642839 | Ga0207661_106428392 | 136 |
| 62 | 3300032004 | Ga0307414_12044263 | Ga0307414_120442631 | 136 |
| 63 | 3300053087 | Ga0500643_002760 | Ga0500643_002760_7756_8238 | 136 |
| 64 | iso_pu_bacteria | 2885429604 | 2885432386 | 136 |
| 65 | 3300005331 | Ga0070670_100004155 | Ga0070670_1000041555 | 137 |
| 66 | 3300005335 | Ga0070666_10000171 | Ga0070666_1000017127 | 137 |
| 67 | 3300005347 | Ga0070668_100064809 | Ga0070668_1000648092 | 137 |
| 68 | 3300005353 | Ga0070669_100000001 | Ga0070669_10000000132 | 137 |
| 69 | 3300005355 | Ga0070671_100000007 | Ga0070671_100000007234 | 137 |
| 70 | 3300005367 | Ga0070667_100075842 | Ga0070667_1000758422 | 137 |
| 71 | 3300005468 | Ga0070707_101022641 | Ga0070707_1010226412 | 137 |
| 72 | 3300005548 | Ga0070665_100026918 | Ga0070665_1000269182 | 137 |
| 73 | 3300005617 | Ga0068859_100000787 | Ga0068859_10000078728 | 137 |
| 74 | 3300005617 | Ga0068859_100010809 | Ga0068859_10001080912 | 137 |
| 75 | 3300005618 | Ga0068864_100000809 | Ga0068864_10000080931 | 137 |
| 76 | 3300005618 | Ga0068864_100576393 | Ga0068864_1005763931 | 137 |
| 77 | 3300005719 | Ga0068861_100000094 | Ga0068861_10000009440 | 137 |
| 78 | 3300005719 | Ga0068861_100002527 | Ga0068861_10000252712 | 137 |
| 79 | 3300005841 | Ga0068863_100008510 | Ga0068863_1000085102 | 137 |
| 80 | 3300005843 | Ga0068860_100018882 | Ga0068860_1000188826 | 137 |
| 81 | 3300005844 | Ga0068862_100000468 | Ga0068862_10000046832 | 137 |
| 82 | 3300006931 | Ga0097620_100000787 | Ga0097620_10000078728 | 137 |
| 83 | 3300006931 | Ga0097620_100010809 | Ga0097620_10001080912 | 137 |
| 84 | 3300009101 | Ga0105247_10002160 | Ga0105247_100021605 | 137 |
| 85 | 3300009148 | Ga0105243_10256761 | Ga0105243_102567612 | 137 |
| 86 | 3300009177 | Ga0105248_10000296 | Ga0105248_1000029620 | 137 |
| 87 | 3300009177 | Ga0105248_10108107 | Ga0105248_101081074 | 137 |
| 88 | 3300009553 | Ga0105249_10024855 | Ga0105249_100248553 | 137 |
| 89 | 3300013306 | Ga0163162_10016899 | Ga0163162_100168997 | 137 |
| 90 | 3300014968 | Ga0157379_10028314 | Ga0157379_100283145 | 137 |
| 91 | 3300014968 | Ga0157379_10228446 | Ga0157379_102284462 | 137 |
| 92 | 3300017792 | Ga0163161_10179163 | Ga0163161_101791632 | 137 |
| 93 | 3300025290 | Ga0207673_1003309 | Ga0207673_10033092 | 137 |
| 94 | 3300025315 | Ga0207697_10000442 | Ga0207697_100004421 | 137 |
| 95 | 3300025900 | Ga0207710_10005275 | Ga0207710_100052757 | 137 |
| 96 | 3300025903 | Ga0207680_10001461 | Ga0207680_1000146112 | 137 |
| 97 | 3300025922 | Ga0207646_10931621 | Ga0207646_109316212 | 137 |
| 98 | 3300025923 | Ga0207681_10000002 | Ga0207681_10000002971 | 137 |
| 99 | 3300025925 | Ga0207650_10015111 | Ga0207650_100151113 | 137 |
| 100 | 3300025931 | Ga0207644_10000002 | Ga0207644_10000002909 | 137 |
| 101 | 3300025935 | Ga0207709_10224778 | Ga0207709_102247783 | 137 |
| 102 | 3300025941 | Ga0207711_10000251 | Ga0207711_1000025118 | 137 |
| 103 | 3300025941 | Ga0207711_10122361 | Ga0207711_101223614 | 137 |
| 104 | 3300025961 | Ga0207712_10039787 | Ga0207712_100397872 | 137 |
| 105 | 3300025972 | Ga0207668_10001858 | Ga0207668_100018584 | 137 |
| 106 | 3300025986 | Ga0207658_10024359 | Ga0207658_100243597 | 137 |
| 107 | 3300026088 | Ga0207641_10048450 | Ga0207641_100484502 | 137 |
| 108 | 3300026095 | Ga0207676_10000383 | Ga0207676_100003832 | 137 |
| 109 | 3300026118 | Ga0207675_100000041 | Ga0207675_10000004162 | 137 |
| 110 | 3300026118 | Ga0207675_100005628 | Ga0207675_10000562812 | 137 |
| 111 | 3300028379 | Ga0268266_10019585 | Ga0268266_100195858 | 137 |
| 112 | 3300028380 | Ga0268265_10001875 | Ga0268265_1000187521 | 137 |
| 113 | 3300028381 | Ga0268264_10000071 | Ga0268264_1000007112 | 137 |
| 114 | 3300028786 | Ga0307517_10014909 | Ga0307517_100149092 | 137 |
| 115 | 3300031251 | Ga0265327_10055612 | Ga0265327_100556123 | 137 |
| 116 | 3300031456 | Ga0307513_10632148 | Ga0307513_106321482 | 137 |
| 117 | 3300047472 | Ga0495686_0000262 | Ga0495686_0000262_85501_85935 | 137 |
| 118 | 3300048925 | Ga0496122_0000306 | Ga0496122_0000306_58064_58576 | 137 |
| 119 | 3300048926 | Ga0496123_0001592 | Ga0496123_0001592_22227_22739 | 137 |
| 120 | 3300048928 | Ga0496125_0017748 | Ga0496125_0017748_5537_6001 | 137 |
| 121 | 3300048928 | Ga0496125_0473182 | Ga0496125_0473182_141_653 | 137 |
| 122 | 3300048929 | Ga0496126_0161083 | Ga0496126_0161083_841_1353 | 137 |
| 123 | 3300050509 | nmdc:mga0qj67_824388_c1 | nmdc:mga0qj67_824388_c1_147_569 | 137 |
| 124 | 3300053136 | Ga0500559_0289904 | Ga0500559_0289904_193_705 | 137 |
| 125 | 3300053142 | Ga0500577_0098457 | Ga0500577_0098457_699_1133 | 137 |
| 126 | 3300002459 | JGI24751J29686_10028971 | JGI24751J29686_100289712 | 138 |
| 127 | 3300003773 | Ga0055537_1001791 | Ga0055537_10017915 | 138 |
| 128 | 3300003775 | Ga0055524_1000118 | Ga0055524_100011835 | 138 |
| 129 | 3300003791 | Ga0055530_10017528 | Ga0055530_100175282 | 138 |
| 130 | 3300003794 | Ga0055531_10000073 | Ga0055531_10000073108 | 138 |
| 131 | 3300003794 | Ga0055531_10008805 | Ga0055531_100088053 | 138 |
| 132 | 3300005262 | Ga0065165_1030331 | Ga0065165_10303313 | 138 |
| 133 | 3300005295 | Ga0065707_10044766 | Ga0065707_100447661 | 138 |
| 134 | 3300005331 | Ga0070670_100036936 | Ga0070670_1000369363 | 138 |
| 135 | 3300005353 | Ga0070669_100012326 | Ga0070669_1000123264 | 138 |
| 136 | 3300005353 | Ga0070669_100040711 | Ga0070669_1000407113 | 138 |
| 137 | 3300005355 | Ga0070671_100067370 | Ga0070671_1000673702 | 138 |
| 138 | 3300005466 | Ga0070685_10057007 | Ga0070685_100570072 | 138 |
| 139 | 3300005548 | Ga0070665_100169873 | Ga0070665_1001698731 | 138 |
| 140 | 3300005618 | Ga0068864_101114098 | Ga0068864_1011140982 | 138 |
| 141 | 3300005844 | Ga0068862_100405747 | Ga0068862_1004057472 | 138 |
| 142 | 3300005985 | Ga0081539_10013701 | Ga0081539_100137011 | 138 |
| 143 | 3300006948 | Ga0099826_10353641 | Ga0099826_103536411 | 138 |
| 144 | 3300025263 | Ga0209565_1000011 | Ga0209565_1000011463 | 138 |
| 145 | 3300025273 | Ga0209673_1003868 | Ga0209673_100386813 | 138 |
| 146 | 3300025297 | Ga0209758_1008619 | Ga0209758_10086197 | 138 |
| 147 | 3300025298 | Ga0209050_1000209 | Ga0209050_1000209132 | 138 |
| 148 | 3300025298 | Ga0209050_1006138 | Ga0209050_100613812 | 138 |
| 149 | 3300025299 | Ga0209256_1000016 | Ga0209256_1000016137 | 138 |
| 150 | 3300025304 | Ga0209257_1000027 | Ga0209257_1000027570 | 138 |
| 151 | 3300025304 | Ga0209257_1006974 | Ga0209257_100697410 | 138 |
| 152 | 3300025923 | Ga0207681_10268125 | Ga0207681_102681252 | 138 |
| 153 | 3300025925 | Ga0207650_10036067 | Ga0207650_100360673 | 138 |
| 154 | 3300026095 | Ga0207676_10944673 | Ga0207676_109446731 | 138 |
| 155 | 3300028380 | Ga0268265_10099240 | Ga0268265_100992402 | 138 |
| 156 | 3300031548 | Ga0307408_100265169 | Ga0307408_1002651692 | 138 |
| 157 | 3300031731 | Ga0307405_10039398 | Ga0307405_100393984 | 138 |
| 158 | 3300031824 | Ga0307413_10238653 | Ga0307413_102386532 | 138 |
| 159 | 3300031901 | Ga0307406_10061761 | Ga0307406_100617613 | 138 |
| 160 | 3300031903 | Ga0307407_10194740 | Ga0307407_101947402 | 138 |
| 161 | 3300031911 | Ga0307412_10674097 | Ga0307412_106740972 | 138 |
| 162 | 3300031995 | Ga0307409_100064682 | Ga0307409_1000646825 | 138 |
| 163 | 3300032002 | Ga0307416_100045139 | Ga0307416_1000451395 | 138 |
| 164 | 3300032004 | Ga0307414_10155110 | Ga0307414_101551102 | 138 |
| 165 | 3300032004 | Ga0307414_10335293 | Ga0307414_103352932 | 138 |
| 166 | 3300032004 | Ga0307414_10783788 | Ga0307414_107837881 | 138 |
| 167 | 3300032005 | Ga0307411_10134325 | Ga0307411_101343252 | 138 |
| 168 | 3300032126 | Ga0307415_100125483 | Ga0307415_1001254833 | 138 |
| 169 | 3300032126 | Ga0307415_102073081 | Ga0307415_1020730812 | 138 |
| 170 | 3300044765 | Ga0466970_0785228 | Ga0466970_0785228_37_474 | 138 |
| 171 | 3300049515 | Ga0501292_000022 | Ga0501292_000022_23263_23697 | 138 |
| 172 | 3300049517 | Ga0501294_000093 | Ga0501294_000093_7962_8396 | 138 |
| 173 | 3300049653 | Ga0501206_028555 | Ga0501206_028555_73_507 | 138 |
| 174 | 3300049662 | Ga0501222_000207 | Ga0501222_000207_3369_3803 | 138 |
| 175 | 3300049663 | Ga0501223_000599 | Ga0501223_000599_7932_8366 | 138 |
| 176 | 3300049664 | Ga0501224_000109 | Ga0501224_000109_7882_8316 | 138 |
| 177 | 3300049665 | Ga0501227_021759 | Ga0501227_021759_322_756 | 138 |
| 178 | 3300049668 | Ga0501233_083091 | Ga0501233_083091_124_558 | 138 |
| 179 | 3300049669 | Ga0501235_002784 | Ga0501235_002784_2810_3244 | 138 |
| 180 | 3300049670 | Ga0501236_043757 | Ga0501236_043757_112_546 | 138 |
| 181 | 3300049688 | Ga0501259_000841 | Ga0501259_000841_4104_4538 | 138 |
| 182 | 3300049690 | Ga0501261_000075 | Ga0501261_000075_9685_10119 | 138 |
| 183 | 3300049705 | Ga0501225_0001860 | Ga0501225_0001860_3427_3861 | 138 |
| 184 | 3300049706 | Ga0501229_076860 | Ga0501229_076860_57_491 | 138 |
| 185 | 3300049708 | Ga0501245_000635 | Ga0501245_000635_2706_3140 | 138 |
| 186 | 3300049775 | Ga0501279_000012 | Ga0501279_000012_46381_46815 | 138 |
| 187 | 3300049776 | Ga0501280_000005 | Ga0501280_000005_23047_23481 | 138 |
| 188 | 3300049777 | Ga0501281_00020 | Ga0501281_00020_6653_7087 | 138 |
| 189 | 3300049778 | Ga0501282_000176 | Ga0501282_000176_1404_1838 | 138 |
| 190 | 3300053096 | Ga0500641_0173514 | Ga0500641_0173514_115_552 | 138 |
| 191 | iso_pu_bacteria | 2984564862 | 2984565093 | 138 |
| 192 | 3300001979 | JGI24740J21852_10131538 | JGI24740J21852_101315381 | 139 |
| 193 | 3300001989 | JGI24739J22299_10001913 | JGI24739J22299_100019134 | 139 |
| 194 | 3300001989 | JGI24739J22299_10052324 | JGI24739J22299_100523242 | 139 |
| 195 | 3300001990 | JGI24737J22298_10039902 | JGI24737J22298_100399022 | 139 |
| 196 | 3300001990 | JGI24737J22298_10100943 | JGI24737J22298_101009432 | 139 |
| 197 | 3300002067 | JGI24735J21928_10002676 | JGI24735J21928_100026762 | 139 |
| 198 | 3300002067 | JGI24735J21928_10040869 | JGI24735J21928_100408692 | 139 |
| 199 | 3300002075 | JGI24738J21930_10001021 | JGI24738J21930_100010214 | 139 |
| 200 | 3300005289 | Ga0065704_10244845 | Ga0065704_102448452 | 139 |
| 201 | 3300005327 | Ga0070658_10019979 | Ga0070658_100199794 | 139 |
| 202 | 3300005329 | Ga0070683_100234171 | Ga0070683_1002341713 | 139 |
| 203 | 3300005344 | Ga0070661_100313629 | Ga0070661_1003136292 | 139 |
| 204 | 3300005347 | Ga0070668_100010996 | Ga0070668_1000109963 | 139 |
| 205 | 3300005366 | Ga0070659_100036312 | Ga0070659_1000363125 | 139 |
| 206 | 3300005455 | Ga0070663_100005719 | Ga0070663_1000057198 | 139 |
| 207 | 3300005548 | Ga0070665_100064570 | Ga0070665_1000645704 | 139 |
| 208 | 3300005578 | Ga0068854_100336585 | Ga0068854_1003365851 | 139 |
| 209 | 3300005616 | Ga0068852_100250008 | Ga0068852_1002500082 | 139 |
| 210 | 3300005834 | Ga0068851_10022324 | Ga0068851_100223244 | 139 |
| 211 | 3300013307 | Ga0157372_11550593 | Ga0157372_115505931 | 139 |
| 212 | 3300017792 | Ga0163161_10020336 | Ga0163161_100203365 | 139 |
| 213 | 3300021377 | Ga0213874_10270176 | Ga0213874_102701761 | 139 |
| 214 | 3300025321 | Ga0207656_10009065 | Ga0207656_100090654 | 139 |
| 215 | 3300025735 | Ga0207713_1014992 | Ga0207713_10149926 | 139 |
| 216 | 3300025924 | Ga0207694_10549781 | Ga0207694_105497812 | 139 |
| 217 | 3300025961 | Ga0207712_10429354 | Ga0207712_104293542 | 139 |
| 218 | 3300025981 | Ga0207640_10247385 | Ga0207640_102473852 | 139 |
| 219 | 3300026035 | Ga0207703_10040742 | Ga0207703_100407422 | 139 |
| 220 | 3300026067 | Ga0207678_10000068 | Ga0207678_1000006814 | 139 |
| 221 | 3300026142 | Ga0207698_10258887 | Ga0207698_102588872 | 139 |
| 222 | 3300026142 | Ga0207698_10688419 | Ga0207698_106884192 | 139 |
| 223 | 3300031548 | Ga0307408_100011557 | Ga0307408_1000115574 | 139 |
| 224 | 3300031548 | Ga0307408_100051480 | Ga0307408_1000514804 | 139 |
| 225 | 3300031548 | Ga0307408_101078937 | Ga0307408_1010789372 | 139 |
| 226 | 3300031731 | Ga0307405_10023829 | Ga0307405_100238294 | 139 |
| 227 | 3300031731 | Ga0307405_10219714 | Ga0307405_102197142 | 139 |
| 228 | 3300031731 | Ga0307405_11559296 | Ga0307405_115592961 | 139 |
| 229 | 3300031852 | Ga0307410_10025503 | Ga0307410_100255032 | 139 |
| 230 | 3300031901 | Ga0307406_10036022 | Ga0307406_100360225 | 139 |
| 231 | 3300031901 | Ga0307406_10652952 | Ga0307406_106529522 | 139 |
| 232 | 3300031901 | Ga0307406_11326436 | Ga0307406_113264361 | 139 |
| 233 | 3300031911 | Ga0307412_10059289 | Ga0307412_100592894 | 139 |
| 234 | 3300031911 | Ga0307412_10084975 | Ga0307412_100849753 | 139 |
| 235 | 3300031995 | Ga0307409_100076623 | Ga0307409_1000766232 | 139 |
| 236 | 3300031995 | Ga0307409_101569545 | Ga0307409_1015695452 | 139 |
| 237 | 3300032002 | Ga0307416_100036866 | Ga0307416_1000368665 | 139 |
| 238 | 3300032002 | Ga0307416_100049966 | Ga0307416_1000499662 | 139 |
| 239 | 3300032004 | Ga0307414_10018974 | Ga0307414_100189745 | 139 |
| 240 | 3300032005 | Ga0307411_10050922 | Ga0307411_100509223 | 139 |
| 241 | 3300032126 | Ga0307415_100100707 | Ga0307415_1001007074 | 139 |
| 242 | 3300037471 | Ga0395905_0940862 | Ga0395905_0940862_89_529 | 139 |
| 243 | 3300039450 | Ga0436363_0627825 | Ga0436363_0627825_132_572 | 139 |
| 244 | 3300046460 | Ga0495638_0220978 | Ga0495638_0220978_67_507 | 139 |
| 245 | 3300046471 | Ga0495650_0247932 | Ga0495650_0247932_17_457 | 139 |
| 246 | 3300047472 | Ga0495686_0458241 | Ga0495686_0458241_139_579 | 139 |
| 247 | 3300048920 | Ga0496117_0030629 | Ga0496117_0030629_624_1064 | 139 |
| 248 | 3300048921 | Ga0496118_0037508 | Ga0496118_0037508_2621_3061 | 139 |
| 249 | iso_pu_bacteria | 2885427238 | 2885427275 | 139 |
| 250 | 3300005293 | Ga0065715_10115198 | Ga0065715_101151983 | 140 |
| 251 | 3300005293 | Ga0065715_10546941 | Ga0065715_105469411 | 140 |
| 252 | 3300005336 | Ga0070680_100107653 | Ga0070680_1001076532 | 140 |
| 253 | 3300005353 | Ga0070669_100429053 | Ga0070669_1004290532 | 140 |
| 254 | 3300005355 | Ga0070671_100232893 | Ga0070671_1002328932 | 140 |
| 255 | 3300005458 | Ga0070681_10216562 | Ga0070681_102165622 | 140 |
| 256 | 3300005530 | Ga0070679_100051356 | Ga0070679_1000513564 | 140 |
| 257 | 3300005563 | Ga0068855_100009733 | Ga0068855_1000097335 | 140 |
| 258 | 3300005578 | Ga0068854_100046585 | Ga0068854_1000465853 | 140 |
| 259 | 3300005578 | Ga0068854_100214226 | Ga0068854_1002142262 | 140 |
| 260 | 3300005614 | Ga0068856_101684453 | Ga0068856_1016844531 | 140 |
| 261 | 3300006048 | Ga0075363_100002692 | Ga0075363_1000026926 | 140 |
| 262 | 3300006178 | Ga0075367_10000051 | Ga0075367_1000005114 | 140 |
| 263 | 3300006358 | Ga0068871_100807870 | Ga0068871_1008078702 | 140 |
| 264 | 3300009093 | Ga0105240_10072045 | Ga0105240_100720454 | 140 |
| 265 | 3300009174 | Ga0105241_10473388 | Ga0105241_104733882 | 140 |
| 266 | 3300010375 | Ga0105239_11148465 | Ga0105239_111484652 | 140 |
| 267 | 3300025909 | Ga0207705_10376076 | Ga0207705_103760762 | 140 |
| 268 | 3300025911 | Ga0207654_10163870 | Ga0207654_101638702 | 140 |
| 269 | 3300025912 | Ga0207707_10327945 | Ga0207707_103279452 | 140 |
| 270 | 3300025913 | Ga0207695_10017242 | Ga0207695_100172422 | 140 |
| 271 | 3300025919 | Ga0207657_10331742 | Ga0207657_103317422 | 140 |
| 272 | 3300025921 | Ga0207652_10115191 | Ga0207652_101151912 | 140 |
| 273 | 3300025925 | Ga0207650_10197717 | Ga0207650_101977172 | 140 |
| 274 | 3300025940 | Ga0207691_10883584 | Ga0207691_108835842 | 140 |
| 275 | 3300025944 | Ga0207661_10410439 | Ga0207661_104104392 | 140 |
| 276 | 3300025949 | Ga0207667_10031117 | Ga0207667_100311175 | 140 |
| 277 | 3300026078 | Ga0207702_11476383 | Ga0207702_114763832 | 140 |
| 278 | 3300027614 | Ga0209970_1100606 | Ga0209970_11006061 | 140 |
| 279 | 3300027866 | Ga0209813_10000172 | Ga0209813_100001722 | 140 |
| 280 | 3300027876 | Ga0209974_10008028 | Ga0209974_100080282 | 140 |
| 281 | 3300030731 | Ga0316177_1010467 | Ga0316177_10104672 | 140 |
| 282 | 3300030735 | Ga0316178_1151566 | Ga0316178_11515662 | 140 |
| 283 | 3300030736 | Ga0316180_1187281 | Ga0316180_11872813 | 140 |
| 284 | 3300030742 | Ga0316183_1180393 | Ga0316183_11803932 | 140 |
| 285 | 3300030745 | Ga0316182_1153558 | Ga0316182_11535582 | 140 |
| 286 | 3300031548 | Ga0307408_100335925 | Ga0307408_1003359252 | 140 |
| 287 | 3300031548 | Ga0307408_100396029 | Ga0307408_1003960292 | 140 |
| 288 | 3300031731 | Ga0307405_10067552 | Ga0307405_100675524 | 140 |
| 289 | 3300031731 | Ga0307405_10114949 | Ga0307405_101149492 | 140 |
| 290 | 3300031731 | Ga0307405_10243906 | Ga0307405_102439062 | 140 |
| 291 | 3300031824 | Ga0307413_10009505 | Ga0307413_100095056 | 140 |
| 292 | 3300031824 | Ga0307413_10013310 | Ga0307413_100133101 | 140 |
| 293 | 3300031824 | Ga0307413_10060608 | Ga0307413_100606084 | 140 |
| 294 | 3300031824 | Ga0307413_10062284 | Ga0307413_100622843 | 140 |
| 295 | 3300031824 | Ga0307413_10784987 | Ga0307413_107849871 | 140 |
| 296 | 3300031824 | Ga0307413_11350426 | Ga0307413_113504261 | 140 |
| 297 | 3300031824 | Ga0307413_11437520 | Ga0307413_114375202 | 140 |
| 298 | 3300031852 | Ga0307410_10231238 | Ga0307410_102312382 | 140 |
| 299 | 3300031852 | Ga0307410_10247483 | Ga0307410_102474832 | 140 |
| 300 | 3300031852 | Ga0307410_10270282 | Ga0307410_102702822 | 140 |
| 301 | 3300031852 | Ga0307410_10485635 | Ga0307410_104856352 | 140 |
| 302 | 3300031901 | Ga0307406_10006284 | Ga0307406_100062848 | 140 |
| 303 | 3300031901 | Ga0307406_10181581 | Ga0307406_101815812 | 140 |
| 304 | 3300031901 | Ga0307406_10397440 | Ga0307406_103974402 | 140 |
| 305 | 3300031903 | Ga0307407_10003784 | Ga0307407_100037847 | 140 |
| 306 | 3300031903 | Ga0307407_10024854 | Ga0307407_100248542 | 140 |
| 307 | 3300031903 | Ga0307407_10111121 | Ga0307407_101111212 | 140 |
| 308 | 3300031903 | Ga0307407_10781101 | Ga0307407_107811011 | 140 |
| 309 | 3300031911 | Ga0307412_10046826 | Ga0307412_100468263 | 140 |
| 310 | 3300031911 | Ga0307412_10134960 | Ga0307412_101349603 | 140 |
| 311 | 3300031911 | Ga0307412_10163373 | Ga0307412_101633732 | 140 |
| 312 | 3300031911 | Ga0307412_10700166 | Ga0307412_107001661 | 140 |
| 313 | 3300031911 | Ga0307412_10842715 | Ga0307412_108427152 | 140 |
| 314 | 3300031995 | Ga0307409_100007148 | Ga0307409_1000071488 | 140 |
| 315 | 3300031995 | Ga0307409_100022526 | Ga0307409_1000225265 | 140 |
| 316 | 3300031995 | Ga0307409_100113522 | Ga0307409_1001135222 | 140 |
| 317 | 3300031995 | Ga0307409_101696636 | Ga0307409_1016966362 | 140 |
| 318 | 3300032002 | Ga0307416_100541482 | Ga0307416_1005414822 | 140 |
| 319 | 3300032002 | Ga0307416_100810385 | Ga0307416_1008103852 | 140 |
| 320 | 3300032002 | Ga0307416_100905187 | Ga0307416_1009051871 | 140 |
| 321 | 3300032004 | Ga0307414_10005443 | Ga0307414_100054438 | 140 |
| 322 | 3300032004 | Ga0307414_10020384 | Ga0307414_100203842 | 140 |
| 323 | 3300032004 | Ga0307414_10020899 | Ga0307414_100208992 | 140 |
| 324 | 3300032004 | Ga0307414_10215528 | Ga0307414_102155282 | 140 |
| 325 | 3300032004 | Ga0307414_10355085 | Ga0307414_103550852 | 140 |
| 326 | 3300032004 | Ga0307414_10443906 | Ga0307414_104439061 | 140 |
| 327 | 3300032004 | Ga0307414_11471032 | Ga0307414_114710322 | 140 |
| 328 | 3300032005 | Ga0307411_10000768 | Ga0307411_100007682 | 140 |
| 329 | 3300032005 | Ga0307411_10122066 | Ga0307411_101220663 | 140 |
| 330 | 3300032126 | Ga0307415_100102552 | Ga0307415_1001025523 | 140 |
| 331 | 3300032126 | Ga0307415_100659027 | Ga0307415_1006590272 | 140 |
| 332 | 3300033180 | Ga0307510_10197820 | Ga0307510_101978203 | 140 |
| 333 | 3300041512 | Ga0451853_2068090 | Ga0451853_2068090_66_509 | 140 |
| 334 | 3300046471 | Ga0495650_0138866 | Ga0495650_0138866_90_557 | 140 |
| 335 | 3300046513 | Ga0495616_0000007 | Ga0495616_0000007_12087_12554 | 140 |
| 336 | 3300053087 | Ga0500643_000121 | Ga0500643_000121_46920_47360 | 140 |
| 337 | 3300053116 | Ga0500592_000224 | Ga0500592_000224_2274_2714 | 140 |
| 338 | 3300053136 | Ga0500559_0098159 | Ga0500559_0098159_139_582 | 140 |
| 339 | 3300053151 | Ga0500604_0013225 | Ga0500604_0013225_814_1254 | 140 |
| 340 | 3300053158 | Ga0500627_0000272 | Ga0500627_0000272_10340_10807 | 140 |
| 341 | 3300002239 | JGI24034J26672_10099075 | JGI24034J26672_100990751 | 141 |
| 342 | 3300005336 | Ga0070680_100000487 | Ga0070680_1000004873 | 141 |
| 343 | 3300005339 | Ga0070660_100044177 | Ga0070660_1000441772 | 141 |
| 344 | 3300005344 | Ga0070661_100000113 | Ga0070661_10000011343 | 141 |
| 345 | 3300005347 | Ga0070668_100079005 | Ga0070668_1000790054 | 141 |
| 346 | 3300005347 | Ga0070668_100087160 | Ga0070668_1000871604 | 141 |
| 347 | 3300005347 | Ga0070668_100698168 | Ga0070668_1006981682 | 141 |
| 348 | 3300005353 | Ga0070669_100121793 | Ga0070669_1001217934 | 141 |
| 349 | 3300005353 | Ga0070669_100463785 | Ga0070669_1004637852 | 141 |
| 350 | 3300005355 | Ga0070671_100020058 | Ga0070671_1000200587 | 141 |
| 351 | 3300005355 | Ga0070671_100062130 | Ga0070671_1000621303 | 141 |
| 352 | 3300005355 | Ga0070671_100487221 | Ga0070671_1004872212 | 141 |
| 353 | 3300005364 | Ga0070673_101260357 | Ga0070673_1012603572 | 141 |
| 354 | 3300005367 | Ga0070667_101023944 | Ga0070667_1010239442 | 141 |
| 355 | 3300005455 | Ga0070663_101270522 | Ga0070663_1012705222 | 141 |
| 356 | 3300005459 | Ga0068867_100202170 | Ga0068867_1002021702 | 141 |
| 357 | 3300005539 | Ga0068853_100051458 | Ga0068853_1000514582 | 141 |
| 358 | 3300005548 | Ga0070665_100371492 | Ga0070665_1003714922 | 141 |
| 359 | 3300005719 | Ga0068861_100403221 | Ga0068861_1004032212 | 141 |
| 360 | 3300005834 | Ga0068851_10088195 | Ga0068851_100881952 | 141 |
| 361 | 3300005844 | Ga0068862_100135638 | Ga0068862_1001356382 | 141 |
| 362 | 3300005844 | Ga0068862_100187415 | Ga0068862_1001874154 | 141 |
| 363 | 3300005844 | Ga0068862_101309562 | Ga0068862_1013095621 | 141 |
| 364 | 3300006237 | Ga0097621_100046877 | Ga0097621_1000468772 | 141 |
| 365 | 3300006358 | Ga0068871_101018119 | Ga0068871_1010181191 | 141 |
| 366 | 3300009011 | Ga0105251_10014149 | Ga0105251_100141496 | 141 |
| 367 | 3300009176 | Ga0105242_10976958 | Ga0105242_109769582 | 141 |
| 368 | 3300009177 | Ga0105248_10246547 | Ga0105248_102465473 | 141 |
| 369 | 3300009177 | Ga0105248_10479692 | Ga0105248_104796923 | 141 |
| 370 | 3300009545 | Ga0105237_10024202 | Ga0105237_100242023 | 141 |
| 371 | 3300009551 | Ga0105238_11751391 | Ga0105238_117513911 | 141 |
| 372 | 3300010375 | Ga0105239_10002689 | Ga0105239_1000268922 | 141 |
| 373 | 3300013306 | Ga0163162_10007008 | Ga0163162_100070083 | 141 |
| 374 | 3300013308 | Ga0157375_10002847 | Ga0157375_100028474 | 141 |
| 375 | 3300014325 | Ga0163163_10608265 | Ga0163163_106082651 | 141 |
| 376 | 3300017792 | Ga0163161_10014669 | Ga0163161_100146693 | 141 |
| 377 | 3300025913 | Ga0207695_10202888 | Ga0207695_102028883 | 141 |
| 378 | 3300025914 | Ga0207671_10001440 | Ga0207671_100014408 | 141 |
| 379 | 3300025919 | Ga0207657_10054497 | Ga0207657_100544974 | 141 |
| 380 | 3300025920 | Ga0207649_10000089 | Ga0207649_1000008946 | 141 |
| 381 | 3300025923 | Ga0207681_10408175 | Ga0207681_104081752 | 141 |
| 382 | 3300025924 | Ga0207694_11111459 | Ga0207694_111114591 | 141 |
| 383 | 3300025931 | Ga0207644_10532757 | Ga0207644_105327572 | 141 |
| 384 | 3300025931 | Ga0207644_10669787 | Ga0207644_106697872 | 141 |
| 385 | 3300025934 | Ga0207686_10511013 | Ga0207686_105110132 | 141 |
| 386 | 3300025940 | Ga0207691_10125090 | Ga0207691_101250902 | 141 |
| 387 | 3300025941 | Ga0207711_10264875 | Ga0207711_102648753 | 141 |
| 388 | 3300025941 | Ga0207711_10278727 | Ga0207711_102787273 | 141 |
| 389 | 3300025972 | Ga0207668_10003466 | Ga0207668_1000346614 | 141 |
| 390 | 3300025972 | Ga0207668_10077524 | Ga0207668_100775242 | 141 |
| 391 | 3300025986 | Ga0207658_10435562 | Ga0207658_104355622 | 141 |
| 392 | 3300026089 | Ga0207648_10682826 | Ga0207648_106828262 | 141 |
| 393 | 3300026118 | Ga0207675_100312728 | Ga0207675_1003127282 | 141 |
| 394 | 3300028379 | Ga0268266_11132404 | Ga0268266_111324041 | 141 |
| 395 | 3300028380 | Ga0268265_10078398 | Ga0268265_100783983 | 141 |
| 396 | 3300028380 | Ga0268265_10128782 | Ga0268265_101287823 | 141 |
| 397 | 3300028380 | Ga0268265_10546329 | Ga0268265_105463292 | 141 |
| 398 | 3300028380 | Ga0268265_12490559 | Ga0268265_124905591 | 141 |
| 399 | 3300031548 | Ga0307408_100117628 | Ga0307408_1001176282 | 141 |
| 400 | 3300031548 | Ga0307408_101238090 | Ga0307408_1012380902 | 141 |
| 401 | 3300031548 | Ga0307408_101975026 | Ga0307408_1019750262 | 141 |
| 402 | 3300031731 | Ga0307405_10131803 | Ga0307405_101318032 | 141 |
| 403 | 3300031731 | Ga0307405_10298729 | Ga0307405_102987292 | 141 |
| 404 | 3300031731 | Ga0307405_10619945 | Ga0307405_106199452 | 141 |
| 405 | 3300031824 | Ga0307413_10295783 | Ga0307413_102957832 | 141 |
| 406 | 3300031824 | Ga0307413_10314509 | Ga0307413_103145092 | 141 |
| 407 | 3300031824 | Ga0307413_10344969 | Ga0307413_103449692 | 141 |
| 408 | 3300031852 | Ga0307410_10129911 | Ga0307410_101299112 | 141 |
| 409 | 3300031852 | Ga0307410_10394589 | Ga0307410_103945892 | 141 |
| 410 | 3300031852 | Ga0307410_10475997 | Ga0307410_104759972 | 141 |
| 411 | 3300031901 | Ga0307406_10132577 | Ga0307406_101325773 | 141 |
| 412 | 3300031901 | Ga0307406_10311608 | Ga0307406_103116082 | 141 |
| 413 | 3300031901 | Ga0307406_10441583 | Ga0307406_104415832 | 141 |
| 414 | 3300031901 | Ga0307406_10543634 | Ga0307406_105436342 | 141 |
| 415 | 3300031903 | Ga0307407_10118948 | Ga0307407_101189483 | 141 |
| 416 | 3300031903 | Ga0307407_10278637 | Ga0307407_102786372 | 141 |
| 417 | 3300031911 | Ga0307412_10001563 | Ga0307412_100015633 | 141 |
| 418 | 3300031911 | Ga0307412_10187660 | Ga0307412_101876602 | 141 |
| 419 | 3300031995 | Ga0307409_100877530 | Ga0307409_1008775302 | 141 |
| 420 | 3300031995 | Ga0307409_100950883 | Ga0307409_1009508832 | 141 |
| 421 | 3300031995 | Ga0307409_101039404 | Ga0307409_1010394042 | 141 |
| 422 | 3300032002 | Ga0307416_100037872 | Ga0307416_1000378726 | 141 |
| 423 | 3300032002 | Ga0307416_100721329 | Ga0307416_1007213292 | 141 |
| 424 | 3300032002 | Ga0307416_100904890 | Ga0307416_1009048902 | 141 |
| 425 | 3300032002 | Ga0307416_100997021 | Ga0307416_1009970212 | 141 |
| 426 | 3300032002 | Ga0307416_101560537 | Ga0307416_1015605372 | 141 |
| 427 | 3300032004 | Ga0307414_10000308 | Ga0307414_1000030813 | 141 |
| 428 | 3300032004 | Ga0307414_10128427 | Ga0307414_101284274 | 141 |
| 429 | 3300032004 | Ga0307414_10263575 | Ga0307414_102635752 | 141 |
| 430 | 3300032004 | Ga0307414_10314894 | Ga0307414_103148942 | 141 |
| 431 | 3300032004 | Ga0307414_10365094 | Ga0307414_103650942 | 141 |
| 432 | 3300032004 | Ga0307414_10899357 | Ga0307414_108993572 | 141 |
| 433 | 3300032004 | Ga0307414_10921993 | Ga0307414_109219932 | 141 |
| 434 | 3300032004 | Ga0307414_11553035 | Ga0307414_115530352 | 141 |
| 435 | 3300032005 | Ga0307411_10012845 | Ga0307411_100128455 | 141 |
| 436 | 3300032005 | Ga0307411_10040468 | Ga0307411_100404684 | 141 |
| 437 | 3300032005 | Ga0307411_10245497 | Ga0307411_102454972 | 141 |
| 438 | 3300032005 | Ga0307411_11421177 | Ga0307411_114211771 | 141 |
| 439 | 3300032126 | Ga0307415_100038354 | Ga0307415_1000383543 | 141 |
| 440 | 3300042439 | Ga0439464_0006676 | Ga0439464_0006676_2009_2452 | 141 |
| 441 | 3300046457 | Ga0495590_0364812 | Ga0495590_0364812_65_508 | 141 |
| 442 | 3300046528 | Ga0495642_0134181 | Ga0495642_0134181_395_838 | 141 |
| 443 | 3300046684 | Ga0495669_0008391 | Ga0495669_0008391_1527_1970 | 141 |
| 444 | 3300047472 | Ga0495686_0000834 | Ga0495686_0000834_17789_18235 | 141 |
| 445 | 3300048910 | Ga0496107_0081724 | Ga0496107_0081724_1509_1952 | 141 |
| 446 | 3300048911 | Ga0496108_0157347 | Ga0496108_0157347_177_620 | 141 |
| 447 | 3300048911 | Ga0496108_0380922 | Ga0496108_0380922_21_545 | 141 |
| 448 | 3300048912 | Ga0496109_0276936 | Ga0496109_0276936_763_1206 | 141 |
| 449 | 3300048913 | Ga0496110_0007823 | Ga0496110_0007823_1250_1693 | 141 |
| 450 | 3300048914 | Ga0496111_0054410 | Ga0496111_0054410_1691_2134 | 141 |
| 451 | 3300048917 | Ga0496114_0009716 | Ga0496114_0009716_849_1292 | 141 |
| 452 | 3300048920 | Ga0496117_0061445 | Ga0496117_0061445_88_537 | 141 |
| 453 | 3300048921 | Ga0496118_0001107 | Ga0496118_0001107_18701_19150 | 141 |
| 454 | 3300048921 | Ga0496118_0045558 | Ga0496118_0045558_2257_2703 | 141 |
| 455 | 3300048924 | Ga0496121_0001342 | Ga0496121_0001342_21218_21664 | 141 |
| 456 | 3300048924 | Ga0496121_0098057 | Ga0496121_0098057_1078_1602 | 141 |
| 457 | 3300048924 | Ga0496121_0126319 | Ga0496121_0126319_1222_1671 | 141 |
| 458 | 3300048925 | Ga0496122_0030304 | Ga0496122_0030304_3356_3880 | 141 |
| 459 | 3300048927 | Ga0496124_0077370 | Ga0496124_0077370_1869_2318 | 141 |
| 460 | 3300048928 | Ga0496125_0018638 | Ga0496125_0018638_782_1306 | 141 |
| 461 | 3300048928 | Ga0496125_0211088 | Ga0496125_0211088_30_479 | 141 |
| 462 | 3300048929 | Ga0496126_0111938 | Ga0496126_0111938_1663_2109 | 141 |
| 463 | 3300049570 | Ga0501033_0046394 | Ga0501033_0046394_2563_3009 | 141 |
| 464 | 3300049571 | Ga0501034_0064209 | Ga0501034_0064209_900_1346 | 141 |
| 465 | 3300049579 | Ga0501043_0086941 | Ga0501043_0086941_1746_2192 | 141 |
| 466 | 3300049589 | Ga0501073_0414312 | Ga0501073_0414312_302_748 | 141 |
| 467 | 3300049649 | Ga0501198_006741 | Ga0501198_006741_361_807 | 141 |
| 468 | 3300049663 | Ga0501223_000978 | Ga0501223_000978_2795_3241 | 141 |
| 469 | 3300049664 | Ga0501224_000006 | Ga0501224_000006_136858_137304 | 141 |
| 470 | 3300049668 | Ga0501233_000508 | Ga0501233_000508_289_735 | 141 |
| 471 | 3300049669 | Ga0501235_050002 | Ga0501235_050002_145_591 | 141 |
| 472 | 3300049705 | Ga0501225_0001785 | Ga0501225_0001785_3546_3992 | 141 |
| 473 | 3300049823 | Ga0501044_0025435 | Ga0501044_0025435_2769_3215 | 141 |
| 474 | 3300049853 | Ga0501226_000355 | Ga0501226_000355_3459_3905 | 141 |
| 475 | 3300053153 | Ga0500616_0007857 | Ga0500616_0007857_4942_5382 | 141 |
| 476 | 3300053108 | Ga0500562_081465 | Ga0500562_081465_59_502 | 142 |
| 477 | 3300002239 | JGI24034J26672_10024749 | JGI24034J26672_100247492 | 143 |
| 478 | 3300005331 | Ga0070670_100091031 | Ga0070670_1000910313 | 143 |
| 479 | 3300005347 | Ga0070668_100000021 | Ga0070668_10000002131 | 143 |
| 480 | 3300005355 | Ga0070671_100000114 | Ga0070671_10000011429 | 143 |
| 481 | 3300005563 | Ga0068855_101084729 | Ga0068855_1010847291 | 143 |
| 482 | 3300005578 | Ga0068854_100102525 | Ga0068854_1001025252 | 143 |
| 483 | 3300005616 | Ga0068852_100303983 | Ga0068852_1003039832 | 143 |
| 484 | 3300005617 | Ga0068859_100041916 | Ga0068859_1000419162 | 143 |
| 485 | 3300005841 | Ga0068863_100000043 | Ga0068863_10000004332 | 143 |
| 486 | 3300005844 | Ga0068862_100319331 | Ga0068862_1003193312 | 143 |
| 487 | 3300006931 | Ga0097620_100041917 | Ga0097620_1000419172 | 143 |
| 488 | 3300025931 | Ga0207644_10000077 | Ga0207644_1000007730 | 143 |
| 489 | 3300025949 | Ga0207667_10048527 | Ga0207667_100485274 | 143 |
| 490 | 3300025961 | Ga0207712_10092327 | Ga0207712_100923272 | 143 |
| 491 | 3300025972 | Ga0207668_10000068 | Ga0207668_1000006831 | 143 |
| 492 | 3300025981 | Ga0207640_10194062 | Ga0207640_101940623 | 143 |
| 493 | 3300026088 | Ga0207641_10000031 | Ga0207641_1000003135 | 143 |
| 494 | 3300028380 | Ga0268265_10058781 | Ga0268265_100587811 | 143 |
| 495 | 3300028381 | Ga0268264_10016671 | Ga0268264_100166714 | 143 |
| 496 | 3300041460 | Ga0451802_1555010 | Ga0451802_1555010_97_543 | 143 |
| 497 | 3300042156 | Ga0439446_0154201 | Ga0439446_0154201_54_494 | 143 |
| 498 | 3300001976 | JGI24752J21851_1010400 | JGI24752J21851_10104001 | 146 |
| 499 | 3300005295 | Ga0065707_10081805 | Ga0065707_1008180521 | 146 |
| 500 | 3300005331 | Ga0070670_100000030 | Ga0070670_10000003044 | 146 |
| 501 | 3300005367 | Ga0070667_100001586 | Ga0070667_10000158612 | 146 |
| 502 | 3300005617 | Ga0068859_100804469 | Ga0068859_1008044692 | 146 |
| 503 | 3300005618 | Ga0068864_100000041 | Ga0068864_10000004144 | 146 |
| 504 | 3300005841 | Ga0068863_100000035 | Ga0068863_10000003544 | 146 |
| 505 | 3300005844 | Ga0068862_100000042 | Ga0068862_100000042131 | 146 |
| 506 | 3300006931 | Ga0097620_100804447 | Ga0097620_1008044472 | 146 |
| 507 | 3300009011 | Ga0105251_10000180 | Ga0105251_1000018044 | 146 |
| 508 | 3300009101 | Ga0105247_10207779 | Ga0105247_102077792 | 146 |
| 509 | 3300009177 | Ga0105248_10000045 | Ga0105248_1000004542 | 146 |
| 510 | 3300009553 | Ga0105249_10000055 | Ga0105249_10000055130 | 146 |
| 511 | 3300013306 | Ga0163162_10019966 | Ga0163162_100199662 | 146 |
| 512 | 3300014326 | Ga0157380_10000606 | Ga0157380_1000060621 | 146 |
| 513 | 3300014968 | Ga0157379_10027204 | Ga0157379_100272043 | 146 |
| 514 | 3300025735 | Ga0207713_1001001 | Ga0207713_100100116 | 146 |
| 515 | 3300025900 | Ga0207710_10209148 | Ga0207710_102091481 | 146 |
| 516 | 3300025925 | Ga0207650_10000238 | Ga0207650_1000023845 | 146 |
| 517 | 3300025941 | Ga0207711_10000027 | Ga0207711_10000027196 | 146 |
| 518 | 3300025961 | Ga0207712_10000262 | Ga0207712_1000026241 | 146 |
| 519 | 3300025986 | Ga0207658_10000362 | Ga0207658_100003623 | 146 |
| 520 | 3300026088 | Ga0207641_10000041 | Ga0207641_1000004143 | 146 |
| 521 | 3300026095 | Ga0207676_10000039 | Ga0207676_10000039134 | 146 |
| 522 | 3300028380 | Ga0268265_10000061 | Ga0268265_10000061109 | 146 |
| 523 | 3300048904 | Ga0496101_0199974 | Ga0496101_0199974_381_821 | 146 |
| 524 | 3300048905 | Ga0496102_1006514 | Ga0496102_1006514_225_665 | 146 |
| 525 | 3300048906 | Ga0496103_0026623 | Ga0496103_0026623_1465_1905 | 146 |
| 526 | 3300048919 | Ga0496116_0170115 | Ga0496116_0170115_403_843 | 146 |
| 527 | 3300048920 | Ga0496117_0005718 | Ga0496117_0005718_4114_4554 | 146 |
| 528 | 3300048921 | Ga0496118_0000493 | Ga0496118_0000493_38033_38473 | 146 |
| 529 | 3300048924 | Ga0496121_0463062 | Ga0496121_0463062_103_543 | 146 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.8681 | 65 | 138 |
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.8465 | 65 | 138 |
| 4u0o-assembly1.cif.gz_B | crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt | 0.7397 | 90 | 137 |
| 1dqw-assembly1.cif.gz_A | crystal structure of orotidine 5'-phosphate decarboxylase | 0.706 | 108 | 139 |
| 8pek-assembly1.cif.gz_B | structure of the dimeric, periplasmic domain of exbd | 0.7043 | 48 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pfuA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.7813 | 66 | 137 | 3.30.420.270 |
| 2pfuA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.7722 | 66 | 137 | 3.30.420.270 |
| af_Q55DS6_13_159_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7652 | 106 | 140 | 3.30.420.40 |
| af_Q0JPY3_361_453_3.80.10.10 | Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor | 0.7542 | 106 | 139 | 3.80.10.10 |
| af_Q8IN10_6_181_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.7258 | 104 | 139 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F0CAJ8-F1-model_v4 | deleted | 0.9406 | 66 | 138 |
|
| AF-F0CAJ8-F1-model_v4 | deleted | 0.8836 | 66 | 138 |
|
| AF-A0A0S7X6Y9-F1-model_v4 | Biopolymer transporter ExbD | 0.8814 | 61 | 141 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A7Z2ZJG0-F1-model_v4 | Biopolymer transporter ExbD | 0.8541 | 48 | 138 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A3M1K2I6-F1-model_v4 | Protein TolR | 0.8444 | 69 | 146 |
GO:0005886
GO:0015031 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar