F459797

General Info

Members Datasets Scaffolds Average Seq Length
529 247 519 147

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10014149|Ga0105251_100141496
Length 174
Sequence VSWKRSGDLEHRCKDGGVLMAMSGPPSSRRGRHRAPMADINVTPLVDVMLVLLIIFMVTAPLLVTGVPVNLPETRAKGLDQDQKPTVVSIDRDGGVFIDDAQISDAELPGRLAEIMSANAGKADPPQIFLRADKGLDYGRVMLVMGELNRAGLNKVALVSTGTEQGSAVSSGSE

Samples

Sample ID Description Type Environment
1 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
2 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
3 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
4 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
5 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
6 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
7 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
8 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
9 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
10 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
11 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
144 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
145 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
146 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
147 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
169 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
173 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
202 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
208 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
209 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
210 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
211 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
212 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
213 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
214 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
215 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
216 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
217 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
218 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
219 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
220 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
221 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
222 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
223 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
224 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
225 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
226 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
227 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
233 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
234 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
235 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
236 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
237 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
238 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
239 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
240 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
241 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
242 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
245 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
246 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
247 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.11
Metatranscriptomes 0
Isolates 1.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 7.37
Nodule 0.19
Rhizoplane 2.46
Rhizosphere 83.93
Stem 0
Stem Tuber 0.19
Unclassified 5.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1010400 3300001976 Bacteria 1214
2 JGI24740J21852_10131538 3300001979 Bacteria 624
3 JGI24739J22299_10001913 3300001989 Bacteria 7966
4 JGI24739J22299_10052324 3300001989 Bacteria 1314
5 JGI24737J22298_10039902 3300001990 Bacteria 1442
6 JGI24737J22298_10100943 3300001990 Bacteria 855
7 JGI24735J21928_10002676 3300002067 Bacteria 6157
8 JGI24735J21928_10040869 3300002067 Bacteria 1353
9 JGI24738J21930_10001021 3300002075 Bacteria 7993
10 JGI24034J26672_10024749 3300002239 Bacteria 958
11 JGI24034J26672_10099075 3300002239 Bacteria 548
12 JGI24751J29686_10028971 3300002459 Bacteria 1150
13 Ga0055537_1001791 3300003773 Bacteria 7833
14 Ga0055524_1000118 3300003775 Bacteria 93202
15 Ga0055530_10017528 3300003791 Bacteria 2242
16 Ga0055531_10000073 3300003794 Bacteria 109510
17 Ga0055531_10008805 3300003794 Bacteria 5257
18 Ga0055543_1033865 3300004625 Bacteria 882
19 Ga0065165_1030331 3300005262 Bacteria 1721
20 Ga0065165_1074914 3300005262 Bacteria 891
21 Ga0065704_10244845 3300005289 Bacteria 1005
22 Ga0065715_10115198 3300005293 Bacteria 2423
23 Ga0065715_10546941 3300005293 Bacteria 744
24 Ga0065707_10044766 3300005295 Bacteria 869
25 Ga0065707_10081805 3300005295 Bacteria 38502
26 Ga0070658_10019979 3300005327 Bacteria 5364
27 Ga0070683_100234171 3300005329 Bacteria 1746
28 Ga0070670_100000030 3300005331 Bacteria 164211
29 Ga0070670_100004155 3300005331 Bacteria 12108
30 Ga0070670_100036936 3300005331 Bacteria 4203
31 Ga0070670_100091031 3300005331 Bacteria 2622
32 Ga0070666_10000171 3300005335 Bacteria 44565
33 Ga0070680_100000487 3300005336 Bacteria 27255
34 Ga0070680_100107653 3300005336 Bacteria 2319
35 Ga0070660_100044177 3300005339 Bacteria 3407
36 Ga0070661_100000113 3300005344 Bacteria 67566
37 Ga0070661_100313629 3300005344 Bacteria 1223
38 Ga0070668_100000021 3300005347 Bacteria 96397
39 Ga0070668_100010996 3300005347 Bacteria 6737
40 Ga0070668_100064809 3300005347 Bacteria 2833
41 Ga0070668_100079005 3300005347 Bacteria 2575
42 Ga0070668_100087160 3300005347 Bacteria 2456
43 Ga0070668_100698168 3300005347 Bacteria 895
44 Ga0070669_100000001 3300005353 Bacteria 537589
45 Ga0070669_100012326 3300005353 Bacteria 6064
46 Ga0070669_100040711 3300005353 Bacteria 3378
47 Ga0070669_100121793 3300005353 Bacteria 1991
48 Ga0070669_100429053 3300005353 Bacteria 1086
49 Ga0070669_100463785 3300005353 Bacteria 1046
50 Ga0070671_100000007 3300005355 Bacteria 250397
51 Ga0070671_100000114 3300005355 Bacteria 51983
52 Ga0070671_100020058 3300005355 Bacteria 5447
53 Ga0070671_100062130 3300005355 Bacteria 3111
54 Ga0070671_100067370 3300005355 Bacteria 2985
55 Ga0070671_100232893 3300005355 Bacteria 1563
56 Ga0070671_100487221 3300005355 Bacteria 1060
57 Ga0070673_101260357 3300005364 Bacteria 694
58 Ga0070659_100036312 3300005366 Bacteria 3841
59 Ga0070667_100001586 3300005367 Bacteria 20353
60 Ga0070667_100075842 3300005367 Bacteria 2871
61 Ga0070667_101023944 3300005367 Bacteria 771
62 Ga0070663_100005719 3300005455 Bacteria 7413
63 Ga0070663_101270522 3300005455 Bacteria 649
64 Ga0070681_10216562 3300005458 Bacteria 1831
65 Ga0068867_100202170 3300005459 Bacteria 1591
66 Ga0070685_10057007 3300005466 Bacteria 2273
67 Ga0070707_101022641 3300005468 Bacteria 792
68 Ga0070679_100051356 3300005530 Bacteria 4107
69 Ga0068853_100005064 3300005539 Bacteria 10281
70 Ga0068853_100051458 3300005539 Bacteria 3545
71 Ga0070665_100026918 3300005548 Bacteria 5792
72 Ga0070665_100064570 3300005548 Bacteria 3671
73 Ga0070665_100169873 3300005548 Bacteria 2182
74 Ga0070665_100371492 3300005548 Bacteria 1437
75 Ga0068855_100009733 3300005563 Bacteria 11595
76 Ga0068855_101084729 3300005563 Bacteria 838
77 Ga0068857_100010280 3300005577 Bacteria 8132
78 Ga0068857_101107390 3300005577 Bacteria 765
79 Ga0068854_100046585 3300005578 Bacteria 3087
80 Ga0068854_100102525 3300005578 Bacteria 2147
81 Ga0068854_100214226 3300005578 Bacteria 1521
82 Ga0068854_100336585 3300005578 Bacteria 1231
83 Ga0068854_101019087 3300005578 Bacteria 734
84 Ga0068856_101684453 3300005614 Bacteria 647
85 Ga0068856_102241729 3300005614 Bacteria 555
86 Ga0068852_100250008 3300005616 Bacteria 1698
87 Ga0068852_100303983 3300005616 Bacteria 1545
88 Ga0068852_102066655 3300005616 Bacteria 592
89 Ga0068859_100000787 3300005617 Bacteria 32070
90 Ga0068859_100010809 3300005617 Bacteria 9190
91 Ga0068859_100041916 3300005617 Bacteria 4598
92 Ga0068859_100804469 3300005617 Bacteria 1027
93 Ga0068864_100000041 3300005618 Bacteria 165878
94 Ga0068864_100000809 3300005618 Bacteria 26301
95 Ga0068864_100576393 3300005618 Bacteria 1090
96 Ga0068864_101114098 3300005618 Bacteria 786
97 Ga0068861_100000094 3300005719 Bacteria 43101
98 Ga0068861_100002527 3300005719 Bacteria 11948
99 Ga0068861_100403221 3300005719 Bacteria 1214
100 Ga0068851_10018450 3300005834 Bacteria 3360
101 Ga0068851_10022324 3300005834 Bacteria 3081
102 Ga0068851_10088195 3300005834 Bacteria 1630
103 Ga0068863_100000035 3300005841 Bacteria 165877
104 Ga0068863_100000043 3300005841 Bacteria 153935
105 Ga0068863_100008510 3300005841 Bacteria 10020
106 Ga0068860_100018882 3300005843 Bacteria 6699
107 Ga0068862_100000042 3300005844 Bacteria 165084
108 Ga0068862_100000468 3300005844 Bacteria 43578
109 Ga0068862_100135638 3300005844 Bacteria 2181
110 Ga0068862_100187415 3300005844 Bacteria 1860
111 Ga0068862_100319331 3300005844 Bacteria 1433
112 Ga0068862_100405747 3300005844 Bacteria 1276
113 Ga0068862_101309562 3300005844 Bacteria 726
114 Ga0081539_10013701 3300005985 Bacteria 6089
115 Ga0075363_100002692 3300006048 Bacteria 7347
116 Ga0075367_10000051 3300006178 Bacteria 27695
117 Ga0097621_100046877 3300006237 Bacteria 3499
118 Ga0068871_100807870 3300006358 Bacteria 865
119 Ga0068871_101018119 3300006358 Bacteria 772
120 Ga0075431_100009771 3300006847 Bacteria 9634
121 Ga0097620_100000787 3300006931 Bacteria 32070
122 Ga0097620_100010809 3300006931 Bacteria 9190
123 Ga0097620_100041917 3300006931 Bacteria 4598
124 Ga0097620_100804447 3300006931 Bacteria 1027
125 Ga0099826_10353641 3300006948 Bacteria 730
126 Ga0105251_10000180 3300009011 Bacteria 63702
127 Ga0105251_10014149 3300009011 Bacteria 4426
128 Ga0105240_10072045 3300009093 Bacteria 4272
129 Ga0105247_10002160 3300009101 Bacteria 13576
130 Ga0105247_10207779 3300009101 Bacteria 1319
131 Ga0105243_10233911 3300009148 Bacteria 1632
132 Ga0105243_10256761 3300009148 Bacteria 1563
133 Ga0105241_10473388 3300009174 Bacteria 1112
134 Ga0105242_10976958 3300009176 Bacteria 853
135 Ga0105248_10000045 3300009177 Bacteria 165909
136 Ga0105248_10000296 3300009177 Bacteria 59123
137 Ga0105248_10108107 3300009177 Bacteria 3136
138 Ga0105248_10246547 3300009177 Bacteria 2011
139 Ga0105248_10479692 3300009177 Bacteria 1402
140 Ga0105237_10024202 3300009545 Bacteria 6213
141 Ga0105238_11751391 3300009551 Bacteria 653
142 Ga0105249_10000055 3300009553 Bacteria 161674
143 Ga0105249_10024855 3300009553 Bacteria 5388
144 Ga0105239_10002689 3300010375 Bacteria 22375
145 Ga0105239_11148465 3300010375 Bacteria 895
146 Ga0163162_10007008 3300013306 Bacteria 10933
147 Ga0163162_10016899 3300013306 Bacteria 7134
148 Ga0163162_10019966 3300013306 Bacteria 6582
149 Ga0157372_11550593 3300013307 Bacteria 763
150 Ga0157375_10002847 3300013308 Bacteria 14973
151 Ga0163163_10608265 3300014325 Bacteria 1156
152 Ga0157380_10000606 3300014326 Bacteria 22069
153 Ga0157380_10932029 3300014326 Bacteria 897
154 Ga0157379_10027204 3300014968 Bacteria 5092
155 Ga0157379_10028314 3300014968 Bacteria 4986
156 Ga0157379_10228446 3300014968 Bacteria 1687
157 Ga0163161_10014669 3300017792 Bacteria 5456
158 Ga0163161_10020336 3300017792 Bacteria 4658
159 Ga0163161_10179163 3300017792 Bacteria 1624
160 Ga0213874_10270176 3300021377 Bacteria 632
161 Ga0209565_1000011 3300025263 Bacteria 637062
162 Ga0209673_1003868 3300025273 Bacteria 8450
163 Ga0207673_1003309 3300025290 Bacteria 1878
164 Ga0209758_1008619 3300025297 Bacteria 6550
165 Ga0209050_1000209 3300025298 Bacteria 130884
166 Ga0209050_1006138 3300025298 Bacteria 7240
167 Ga0209256_1000016 3300025299 Bacteria 599092
168 Ga0209257_1000027 3300025304 Bacteria 703541
169 Ga0209257_1006974 3300025304 Bacteria 7035
170 Ga0207697_10000442 3300025315 Bacteria 23401
171 Ga0207656_10009065 3300025321 Bacteria 3687
172 Ga0207713_1001001 3300025735 Bacteria 24726
173 Ga0207713_1014992 3300025735 Bacteria 3996
174 Ga0207710_10005275 3300025900 Bacteria 5584
175 Ga0207710_10209148 3300025900 Bacteria 965
176 Ga0207680_10001461 3300025903 Bacteria 11187
177 Ga0207647_10342559 3300025904 Bacteria 847
178 Ga0207705_10376076 3300025909 Bacteria 1097
179 Ga0207654_10163870 3300025911 Bacteria 1438
180 Ga0207707_10327945 3300025912 Bacteria 1321
181 Ga0207695_10017242 3300025913 Bacteria 8411
182 Ga0207695_10202888 3300025913 Bacteria 1896
183 Ga0207671_10001440 3300025914 Bacteria 27565
184 Ga0207657_10054497 3300025919 Bacteria 3458
185 Ga0207657_10331742 3300025919 Bacteria 1201
186 Ga0207649_10000089 3300025920 Bacteria 76923
187 Ga0207652_10115191 3300025921 Bacteria 2388
188 Ga0207646_10931621 3300025922 Bacteria 770
189 Ga0207681_10000002 3300025923 Bacteria 985597
190 Ga0207681_10268125 3300025923 Bacteria 1339
191 Ga0207681_10408175 3300025923 Bacteria 1098
192 Ga0207694_10549781 3300025924 Bacteria 969
193 Ga0207694_11111459 3300025924 Bacteria 669
194 Ga0207650_10000238 3300025925 Bacteria 61061
195 Ga0207650_10015111 3300025925 Bacteria 5371
196 Ga0207650_10036067 3300025925 Bacteria 3596
197 Ga0207650_10197717 3300025925 Bacteria 1609
198 Ga0207659_10798266 3300025926 Bacteria 811
199 Ga0207644_10000002 3300025931 Bacteria 942221
200 Ga0207644_10000077 3300025931 Bacteria 72394
201 Ga0207644_10532757 3300025931 Bacteria 971
202 Ga0207644_10666886 3300025931 Bacteria 866
203 Ga0207644_10669787 3300025931 Bacteria 864
204 Ga0207686_10511013 3300025934 Bacteria 934
205 Ga0207709_10224778 3300025935 Bacteria 1356
206 Ga0207691_10125090 3300025940 Bacteria 2276
207 Ga0207691_10883584 3300025940 Bacteria 749
208 Ga0207711_10000027 3300025941 Bacteria 236548
209 Ga0207711_10000251 3300025941 Bacteria 57860
210 Ga0207711_10122361 3300025941 Bacteria 2324
211 Ga0207711_10264875 3300025941 Bacteria 1580
212 Ga0207711_10278727 3300025941 Bacteria 1539
213 Ga0207661_10410439 3300025944 Bacteria 1229
214 Ga0207661_10642839 3300025944 Bacteria 975
215 Ga0207667_10031117 3300025949 Bacteria 5764
216 Ga0207667_10048527 3300025949 Bacteria 4489
217 Ga0207651_10986718 3300025960 Bacteria 752
218 Ga0207712_10000262 3300025961 Bacteria 51101
219 Ga0207712_10039787 3300025961 Bacteria 3223
220 Ga0207712_10092327 3300025961 Bacteria 2232
221 Ga0207712_10429354 3300025961 Bacteria 1116
222 Ga0207668_10000068 3300025972 Bacteria 81202
223 Ga0207668_10001858 3300025972 Bacteria 12320
224 Ga0207668_10003466 3300025972 Bacteria 9257
225 Ga0207668_10077524 3300025972 Bacteria 2396
226 Ga0207640_10040236 3300025981 Bacteria 2964
227 Ga0207640_10194062 3300025981 Bacteria 1533
228 Ga0207640_10247385 3300025981 Bacteria 1382
229 Ga0207658_10000362 3300025986 Bacteria 44869
230 Ga0207658_10024359 3300025986 Bacteria 4234
231 Ga0207658_10435562 3300025986 Bacteria 1158
232 Ga0207703_10040742 3300026035 Bacteria 3719
233 Ga0207639_10014011 3300026041 Bacteria 5626
234 Ga0207639_11208503 3300026041 Bacteria 709
235 Ga0207678_10000068 3300026067 Bacteria 81610
236 Ga0207702_11476383 3300026078 Bacteria 673
237 Ga0207702_11846804 3300026078 Bacteria 596
238 Ga0207641_10000031 3300026088 Bacteria 224320
239 Ga0207641_10000041 3300026088 Bacteria 191595
240 Ga0207641_10048450 3300026088 Bacteria 3586
241 Ga0207648_10682826 3300026089 Bacteria 951
242 Ga0207676_10000039 3300026095 Bacteria 171142
243 Ga0207676_10000383 3300026095 Bacteria 37759
244 Ga0207676_10123464 3300026095 Bacteria 2188
245 Ga0207676_10944673 3300026095 Bacteria 847
246 Ga0207674_10000811 3300026116 Bacteria 40585
247 Ga0207675_100000041 3300026118 Bacteria 90476
248 Ga0207675_100005628 3300026118 Bacteria 11998
249 Ga0207675_100312728 3300026118 Bacteria 1532
250 Ga0207698_10258887 3300026142 Bacteria 1597
251 Ga0207698_10688419 3300026142 Bacteria 1016
252 Ga0209970_1100606 3300027614 Bacteria 552
253 Ga0209813_10000172 3300027866 Bacteria 21011
254 Ga0209974_10008028 3300027876 Bacteria 3617
255 Ga0268266_10019585 3300028379 Bacteria 5765
256 Ga0268266_11132404 3300028379 Bacteria 757
257 Ga0268265_10000061 3300028380 Bacteria 148625
258 Ga0268265_10001875 3300028380 Bacteria 16712
259 Ga0268265_10058781 3300028380 Bacteria 2938
260 Ga0268265_10078398 3300028380 Bacteria 2598
261 Ga0268265_10099240 3300028380 Bacteria 2347
262 Ga0268265_10128782 3300028380 Bacteria 2099
263 Ga0268265_10546329 3300028380 Bacteria 1099
264 Ga0268265_12490559 3300028380 Bacteria 523
265 Ga0268264_10000071 3300028381 Bacteria 267236
266 Ga0268264_10016671 3300028381 Bacteria 6017
267 Ga0307517_10014909 3300028786 Bacteria 10383
268 Ga0316177_1010467 3300030731 Bacteria 1164
269 Ga0316178_1151566 3300030735 Bacteria 2421
270 Ga0316180_1187281 3300030736 Bacteria 2314
271 Ga0316183_1180393 3300030742 Bacteria 927
272 Ga0316182_1153558 3300030745 Bacteria 966
273 Ga0265327_10055612 3300031251 Bacteria 2043
274 Ga0307513_10632148 3300031456 Bacteria 778
275 Ga0307408_100011557 3300031548 Bacteria 5834
276 Ga0307408_100051480 3300031548 Bacteria 2966
277 Ga0307408_100117628 3300031548 Bacteria 2053
278 Ga0307408_100265169 3300031548 Bacteria 1423
279 Ga0307408_100335925 3300031548 Bacteria 1277
280 Ga0307408_100396029 3300031548 Bacteria 1185
281 Ga0307408_101078937 3300031548 Bacteria 744
282 Ga0307408_101238090 3300031548 Bacteria 697
283 Ga0307408_101975026 3300031548 Bacteria 560
284 Ga0307405_10023829 3300031731 Bacteria 3485
285 Ga0307405_10039398 3300031731 Bacteria 2855
286 Ga0307405_10067552 3300031731 Bacteria 2285
287 Ga0307405_10114949 3300031731 Bacteria 1830
288 Ga0307405_10131803 3300031731 Bacteria 1728
289 Ga0307405_10219714 3300031731 Bacteria 1393
290 Ga0307405_10243906 3300031731 Bacteria 1333
291 Ga0307405_10298729 3300031731 Bacteria 1220
292 Ga0307405_10619945 3300031731 Bacteria 885
293 Ga0307405_11323257 3300031731 Bacteria 627
294 Ga0307405_11559296 3300031731 Bacteria 582
295 Ga0307413_10009505 3300031824 Bacteria 4658
296 Ga0307413_10013310 3300031824 Bacteria 4130
297 Ga0307413_10060608 3300031824 Bacteria 2330
298 Ga0307413_10062284 3300031824 Bacteria 2306
299 Ga0307413_10238653 3300031824 Bacteria 1340
300 Ga0307413_10295783 3300031824 Bacteria 1225
301 Ga0307413_10314509 3300031824 Bacteria 1193
302 Ga0307413_10344969 3300031824 Bacteria 1147
303 Ga0307413_10784987 3300031824 Bacteria 799
304 Ga0307413_11350426 3300031824 Bacteria 625
305 Ga0307413_11437520 3300031824 Bacteria 608
306 Ga0307410_10025503 3300031852 Bacteria 3710
307 Ga0307410_10129911 3300031852 Bacteria 1849
308 Ga0307410_10231238 3300031852 Bacteria 1428
309 Ga0307410_10247483 3300031852 Bacteria 1384
310 Ga0307410_10270282 3300031852 Bacteria 1329
311 Ga0307410_10394589 3300031852 Bacteria 1116
312 Ga0307410_10475997 3300031852 Bacteria 1023
313 Ga0307410_10485635 3300031852 Bacteria 1014
314 Ga0307410_11226445 3300031852 Bacteria 654
315 Ga0307406_10006284 3300031901 Bacteria 6547
316 Ga0307406_10036022 3300031901 Bacteria 3046
317 Ga0307406_10061761 3300031901 Bacteria 2421
318 Ga0307406_10132577 3300031901 Bacteria 1751
319 Ga0307406_10181581 3300031901 Bacteria 1532
320 Ga0307406_10311608 3300031901 Bacteria 1213
321 Ga0307406_10397440 3300031901 Bacteria 1091
322 Ga0307406_10441583 3300031901 Bacteria 1041
323 Ga0307406_10543634 3300031901 Bacteria 949
324 Ga0307406_10652952 3300031901 Bacteria 873
325 Ga0307406_11326436 3300031901 Bacteria 629
326 Ga0307407_10003784 3300031903 Bacteria 6294
327 Ga0307407_10024854 3300031903 Bacteria 3148
328 Ga0307407_10111121 3300031903 Bacteria 1720
329 Ga0307407_10118948 3300031903 Bacteria 1671
330 Ga0307407_10194740 3300031903 Bacteria 1354
331 Ga0307407_10278637 3300031903 Bacteria 1157
332 Ga0307407_10781101 3300031903 Bacteria 725
333 Ga0307412_10001563 3300031911 Bacteria 12598
334 Ga0307412_10046826 3300031911 Bacteria 2836
335 Ga0307412_10059289 3300031911 Bacteria 2564
336 Ga0307412_10084975 3300031911 Bacteria 2198
337 Ga0307412_10134960 3300031911 Bacteria 1799
338 Ga0307412_10163373 3300031911 Bacteria 1657
339 Ga0307412_10187660 3300031911 Bacteria 1560
340 Ga0307412_10674097 3300031911 Bacteria 885
341 Ga0307412_10700166 3300031911 Bacteria 869
342 Ga0307412_10842715 3300031911 Bacteria 799
343 Ga0307409_100007148 3300031995 Bacteria 6650
344 Ga0307409_100022526 3300031995 Bacteria 4346
345 Ga0307409_100064682 3300031995 Bacteria 2874
346 Ga0307409_100076623 3300031995 Bacteria 2682
347 Ga0307409_100113522 3300031995 Bacteria 2277
348 Ga0307409_100877530 3300031995 Bacteria 909
349 Ga0307409_100950883 3300031995 Bacteria 875
350 Ga0307409_101039404 3300031995 Bacteria 838
351 Ga0307409_101569545 3300031995 Bacteria 686
352 Ga0307409_101696636 3300031995 Bacteria 660
353 Ga0307416_100036866 3300032002 Bacteria 3756
354 Ga0307416_100037872 3300032002 Bacteria 3716
355 Ga0307416_100045139 3300032002 Bacteria 3467
356 Ga0307416_100049966 3300032002 Bacteria 3329
357 Ga0307416_100541482 3300032002 Bacteria 1236
358 Ga0307416_100721329 3300032002 Bacteria 1087
359 Ga0307416_100810385 3300032002 Bacteria 1032
360 Ga0307416_100904890 3300032002 Bacteria 982
361 Ga0307416_100905187 3300032002 Bacteria 982
362 Ga0307416_100997021 3300032002 Bacteria 940
363 Ga0307416_101560537 3300032002 Bacteria 766
364 Ga0307414_10000308 3300032004 Bacteria 28338
365 Ga0307414_10005443 3300032004 Bacteria 7010
366 Ga0307414_10018974 3300032004 Bacteria 4251
367 Ga0307414_10020384 3300032004 Bacteria 4132
368 Ga0307414_10020899 3300032004 Bacteria 4090
369 Ga0307414_10128427 3300032004 Bacteria 1963
370 Ga0307414_10141905 3300032004 Bacteria 1882
371 Ga0307414_10155110 3300032004 Bacteria 1811
372 Ga0307414_10215528 3300032004 Bacteria 1572
373 Ga0307414_10263575 3300032004 Bacteria 1439
374 Ga0307414_10269538 3300032004 Bacteria 1425
375 Ga0307414_10314894 3300032004 Bacteria 1329
376 Ga0307414_10335293 3300032004 Bacteria 1293
377 Ga0307414_10355085 3300032004 Bacteria 1259
378 Ga0307414_10365094 3300032004 Bacteria 1243
379 Ga0307414_10443906 3300032004 Bacteria 1136
380 Ga0307414_10783788 3300032004 Bacteria 868
381 Ga0307414_10895018 3300032004 Bacteria 813
382 Ga0307414_10899357 3300032004 Bacteria 811
383 Ga0307414_10921993 3300032004 Bacteria 801
384 Ga0307414_11471032 3300032004 Bacteria 634
385 Ga0307414_11553035 3300032004 Bacteria 616
386 Ga0307414_12044263 3300032004 Bacteria 535
387 Ga0307411_10000768 3300032005 Bacteria 11868
388 Ga0307411_10012845 3300032005 Bacteria 4591
389 Ga0307411_10040468 3300032005 Bacteria 2957
390 Ga0307411_10050922 3300032005 Bacteria 2699
391 Ga0307411_10122066 3300032005 Bacteria 1887
392 Ga0307411_10134325 3300032005 Bacteria 1813
393 Ga0307411_10245497 3300032005 Bacteria 1404
394 Ga0307411_11421177 3300032005 Bacteria 635
395 Ga0307411_11568581 3300032005 Bacteria 607
396 Ga0307415_100038354 3300032126 Bacteria 3157
397 Ga0307415_100100707 3300032126 Bacteria 2118
398 Ga0307415_100102552 3300032126 Bacteria 2102
399 Ga0307415_100125483 3300032126 Bacteria 1933
400 Ga0307415_100659027 3300032126 Bacteria 939
401 Ga0307415_102073081 3300032126 Bacteria 555
402 Ga0307510_10197820 3300033180 Bacteria 1549
403 Ga0395905_0940862 3300037471 Bacteria 767
404 Ga0436363_0627825 3300039450 Bacteria 609
405 Ga0439465_0127568 3300041413 Bacteria 896
406 Ga0451802_1555010 3300041460 Bacteria 614
407 Ga0451853_2068090 3300041512 Bacteria 770
408 Ga0439446_0154201 3300042156 Bacteria 757
409 Ga0439464_0006676 3300042439 Bacteria 3011
410 Ga0466970_0785228 3300044765 Bacteria 557
411 Ga0466960_0294412 3300044901 Bacteria 913
412 Ga0495627_087003 3300046453 Bacteria 901
413 Ga0495590_0364812 3300046457 Bacteria 550
414 Ga0495638_0039054 3300046460 Bacteria 3015
415 Ga0495638_0220978 3300046460 Bacteria 1059
416 Ga0495650_0138866 3300046471 Bacteria 881
417 Ga0495650_0247932 3300046471 Bacteria 606
418 Ga0495616_0000007 3300046513 Bacteria 227689
419 Ga0495642_0134181 3300046528 Bacteria 1067
420 Ga0495621_0005871 3300046539 Bacteria 3554
421 Ga0495621_0355868 3300046539 Bacteria 615
422 Ga0495669_0008391 3300046684 Bacteria 4344
423 Ga0495670_0430653 3300046691 Bacteria 714
424 Ga0495671_0048528 3300046692 Bacteria 2118
425 Ga0495686_0000262 3300047472 Bacteria 94462
426 Ga0495686_0000834 3300047472 Bacteria 39641
427 Ga0495686_0458241 3300047472 Bacteria 676
428 Ga0496101_0199974 3300048904 Bacteria 1544
429 Ga0496102_1006514 3300048905 Bacteria 754
430 Ga0496103_0026623 3300048906 Bacteria 3501
431 Ga0496103_0158571 3300048906 Bacteria 1451
432 Ga0496107_0081724 3300048910 Bacteria 2357
433 Ga0496108_0157347 3300048911 Bacteria 1962
434 Ga0496108_0380922 3300048911 Bacteria 1232
435 Ga0496109_0276936 3300048912 Bacteria 1581
436 Ga0496109_1087582 3300048912 Bacteria 737
437 Ga0496110_0007823 3300048913 Bacteria 8565
438 Ga0496111_0054410 3300048914 Bacteria 2893
439 Ga0496114_0009716 3300048917 Bacteria 7642
440 Ga0496116_0170115 3300048919 Bacteria 1182
441 Ga0496117_0005718 3300048920 Bacteria 12932
442 Ga0496117_0030629 3300048920 Bacteria 4124
443 Ga0496117_0061445 3300048920 Bacteria 2582
444 Ga0496118_0000493 3300048921 Bacteria 65468
445 Ga0496118_0001107 3300048921 Bacteria 41821
446 Ga0496118_0037508 3300048921 Bacteria 3899
447 Ga0496118_0045558 3300048921 Bacteria 3422
448 Ga0496121_0001342 3300048924 Bacteria 42142
449 Ga0496121_0098057 3300048924 Bacteria 2269
450 Ga0496121_0126319 3300048924 Bacteria 1922
451 Ga0496121_0463062 3300048924 Bacteria 814
452 Ga0496122_0000306 3300048925 Bacteria 108166
453 Ga0496122_0030304 3300048925 Bacteria 4537
454 Ga0496123_0001592 3300048926 Bacteria 30871
455 Ga0496124_0077370 3300048927 Bacteria 2744
456 Ga0496125_0017748 3300048928 Bacteria 6774
457 Ga0496125_0018638 3300048928 Bacteria 6587
458 Ga0496125_0211088 3300048928 Bacteria 1261
459 Ga0496125_0278917 3300048928 Bacteria 1037
460 Ga0496125_0473182 3300048928 Bacteria 712
461 Ga0496126_0111938 3300048929 Bacteria 2377
462 Ga0496126_0161083 3300048929 Bacteria 1917
463 Ga0501292_000022 3300049515 Bacteria 47432
464 Ga0501294_000093 3300049517 Bacteria 9905
465 Ga0501033_0046394 3300049570 Bacteria 3231
466 Ga0501034_0064209 3300049571 Bacteria 3686
467 Ga0501043_0086941 3300049579 Bacteria 2457
468 Ga0501073_0414312 3300049589 Bacteria 931
469 Ga0501198_006741 3300049649 Bacteria 1640
470 Ga0501202_227463 3300049652 Bacteria 518
471 Ga0501206_028555 3300049653 Bacteria 821
472 Ga0501222_000207 3300049662 Bacteria 10398
473 Ga0501223_000599 3300049663 Bacteria 8650
474 Ga0501223_000978 3300049663 Bacteria 6741
475 Ga0501224_000006 3300049664 Bacteria 149611
476 Ga0501224_000109 3300049664 Bacteria 8861
477 Ga0501227_021759 3300049665 Bacteria 1479
478 Ga0501233_000508 3300049668 Bacteria 6253
479 Ga0501233_083091 3300049668 Bacteria 827
480 Ga0501235_002784 3300049669 Bacteria 3764
481 Ga0501235_050002 3300049669 Bacteria 967
482 Ga0501236_043757 3300049670 Bacteria 749
483 Ga0501239_028127 3300049672 Bacteria 725
484 Ga0501259_000841 3300049688 Bacteria 5056
485 Ga0501261_000075 3300049690 Bacteria 17084
486 Ga0501225_0001785 3300049705 Bacteria 6734
487 Ga0501225_0001860 3300049705 Bacteria 6631
488 Ga0501229_076860 3300049706 Bacteria 530
489 Ga0501245_000635 3300049708 Bacteria 4325
490 Ga0501268_009369 3300049765 Bacteria 1504
491 Ga0501279_000012 3300049775 Bacteria 80359
492 Ga0501279_095680 3300049775 Bacteria 529
493 Ga0501280_000005 3300049776 Bacteria 85174
494 Ga0501281_00020 3300049777 Bacteria 19726
495 Ga0501282_000176 3300049778 Bacteria 7822
496 Ga0501044_0025435 3300049823 Bacteria 6274
497 Ga0501226_000355 3300049853 Bacteria 6688
498 nmdc:mga0qj67_824388_c1 3300050509 Bacteria 733
499 nmdc:mga06r32_53054_c1 3300050510 Bacteria 3884
500 Ga0500643_000121 3300053087 Bacteria 81461
501 Ga0500643_002760 3300053087 Bacteria 8790
502 Ga0500643_016369 3300053087 Bacteria 2513
503 Ga0500566_0079841 3300053094 Bacteria 1823
504 Ga0500641_0173514 3300053096 Bacteria 928
505 Ga0500562_081465 3300053108 Bacteria 876
506 Ga0500592_000224 3300053116 Bacteria 10279
507 Ga0500594_0005662 3300053118 Bacteria 2776
508 Ga0500608_133899 3300053122 Bacteria 1108
509 Ga0500658_0296373 3300053134 Bacteria 743
510 Ga0500559_0098159 3300053136 Bacteria 1347
511 Ga0500559_0289904 3300053136 Bacteria 769
512 Ga0500577_0098457 3300053142 Bacteria 1192
513 Ga0500604_0013225 3300053151 Bacteria 2234
514 Ga0500616_0007857 3300053153 Bacteria 6713
515 Ga0500616_0270272 3300053153 Bacteria 718
516 Ga0500624_000254 3300053157 Bacteria 18781
517 Ga0500627_0000272 3300053158 Bacteria 14690
518 Ga0500636_0006645 3300053177 Bacteria 6650
519 Ga0500587_011857 3300053739 Bacteria 1100

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026041 Ga0207639_11208503 Ga0207639_112085031 113
2 3300048906 Ga0496103_0158571 Ga0496103_0158571_16_399 113
3 3300032004 Ga0307414_10269538 Ga0307414_102695382 120
4 3300006847 Ga0075431_100009771 Ga0075431_1000097714 121
5 iso_pu_bacteria 2896429255 2896429262 122
6 3300005577 Ga0068857_100010280 Ga0068857_1000102802 123
7 3300005614 Ga0068856_102241729 Ga0068856_1022417291 123
8 3300005616 Ga0068852_102066655 Ga0068852_1020666552 123
9 3300005834 Ga0068851_10018450 Ga0068851_100184502 123
10 3300026078 Ga0207702_11846804 Ga0207702_118468041 123
11 3300053177 Ga0500636_0006645 Ga0500636_0006645_5660_6073 124
12 3300046453 Ga0495627_087003 Ga0495627_087003_149_580 125
13 3300048928 Ga0496125_0278917 Ga0496125_0278917_508_954 125
14 3300053087 Ga0500643_016369 Ga0500643_016369_763_1194 125
15 3300053153 Ga0500616_0270272 Ga0500616_0270272_16_405 125
16 3300053157 Ga0500624_000254 Ga0500624_000254_564_995 125
17 3300005577 Ga0068857_101107390 Ga0068857_1011073902 126
18 3300014326 Ga0157380_10932029 Ga0157380_109320292 126
19 3300031731 Ga0307405_11323257 Ga0307405_113232572 126
20 3300031852 Ga0307410_11226445 Ga0307410_112264452 126
21 3300032004 Ga0307414_10895018 Ga0307414_108950182 126
22 3300041413 Ga0439465_0127568 Ga0439465_0127568_14_403 126
23 3300044901 Ga0466960_0294412 Ga0466960_0294412_409_798 126
24 3300046539 Ga0495621_0005871 Ga0495621_0005871_1977_2366 126
25 3300046539 Ga0495621_0355868 Ga0495621_0355868_126_515 126
26 3300049652 Ga0501202_227463 Ga0501202_227463_12_401 126
27 3300049672 Ga0501239_028127 Ga0501239_028127_129_518 126
28 3300049765 Ga0501268_009369 Ga0501268_009369_821_1210 126
29 3300049775 Ga0501279_095680 Ga0501279_095680_98_487 126
30 3300050510 nmdc:mga06r32_53054_c1 nmdc:mga06r32_53054_c1_1735_2124 126
31 3300025931 Ga0207644_10666886 Ga0207644_106668862 127
32 3300025960 Ga0207651_10986718 Ga0207651_109867182 127
33 3300026095 Ga0207676_10123464 Ga0207676_101234641 127
34 3300032004 Ga0307414_10141905 Ga0307414_101419052 127
35 3300032005 Ga0307411_11568581 Ga0307411_115685812 127
36 3300046691 Ga0495670_0430653 Ga0495670_0430653_243_635 127
37 3300048912 Ga0496109_1087582 Ga0496109_1087582_136_528 127
38 3300053134 Ga0500658_0296373 Ga0500658_0296373_21_413 127
39 3300053094 Ga0500566_0079841 Ga0500566_0079841_968_1363 129
40 3300053122 Ga0500608_133899 Ga0500608_133899_456_851 129
41 3300046460 Ga0495638_0039054 Ga0495638_0039054_1672_2127 133
42 3300046692 Ga0495671_0048528 Ga0495671_0048528_1625_2089 133
43 3300053118 Ga0500594_0005662 Ga0500594_0005662_39_503 133
44 iso_pu_bacteria 2919709256 2919711202 133
45 3300005539 Ga0068853_100005064 Ga0068853_1000050646 134
46 3300005578 Ga0068854_101019087 Ga0068854_1010190871 134
47 3300025904 Ga0207647_10342559 Ga0207647_103425592 134
48 3300025981 Ga0207640_10040236 Ga0207640_100402362 134
49 3300026041 Ga0207639_10014011 Ga0207639_100140116 134
50 3300026116 Ga0207674_10000811 Ga0207674_1000081138 134
51 3300053739 Ga0500587_011857 Ga0500587_011857_196_669 134
52 iso_pu_bacteria 2808606401 2809065332 134
53 iso_pu_bacteria 2808606404 2809081276 134
54 iso_pu_bacteria 2808606405 2809085641 134
55 iso_pu_bacteria 2880518877 2880520824 134
56 3300025926 Ga0207659_10798266 Ga0207659_107982662 135
57 iso_pu_bacteria 2775507255 2778125494 135
58 3300004625 Ga0055543_1033865 Ga0055543_10338651 136
59 3300005262 Ga0065165_1074914 Ga0065165_10749142 136
60 3300009148 Ga0105243_10233911 Ga0105243_102339113 136
61 3300025944 Ga0207661_10642839 Ga0207661_106428392 136
62 3300032004 Ga0307414_12044263 Ga0307414_120442631 136
63 3300053087 Ga0500643_002760 Ga0500643_002760_7756_8238 136
64 iso_pu_bacteria 2885429604 2885432386 136
65 3300005331 Ga0070670_100004155 Ga0070670_1000041555 137
66 3300005335 Ga0070666_10000171 Ga0070666_1000017127 137
67 3300005347 Ga0070668_100064809 Ga0070668_1000648092 137
68 3300005353 Ga0070669_100000001 Ga0070669_10000000132 137
69 3300005355 Ga0070671_100000007 Ga0070671_100000007234 137
70 3300005367 Ga0070667_100075842 Ga0070667_1000758422 137
71 3300005468 Ga0070707_101022641 Ga0070707_1010226412 137
72 3300005548 Ga0070665_100026918 Ga0070665_1000269182 137
73 3300005617 Ga0068859_100000787 Ga0068859_10000078728 137
74 3300005617 Ga0068859_100010809 Ga0068859_10001080912 137
75 3300005618 Ga0068864_100000809 Ga0068864_10000080931 137
76 3300005618 Ga0068864_100576393 Ga0068864_1005763931 137
77 3300005719 Ga0068861_100000094 Ga0068861_10000009440 137
78 3300005719 Ga0068861_100002527 Ga0068861_10000252712 137
79 3300005841 Ga0068863_100008510 Ga0068863_1000085102 137
80 3300005843 Ga0068860_100018882 Ga0068860_1000188826 137
81 3300005844 Ga0068862_100000468 Ga0068862_10000046832 137
82 3300006931 Ga0097620_100000787 Ga0097620_10000078728 137
83 3300006931 Ga0097620_100010809 Ga0097620_10001080912 137
84 3300009101 Ga0105247_10002160 Ga0105247_100021605 137
85 3300009148 Ga0105243_10256761 Ga0105243_102567612 137
86 3300009177 Ga0105248_10000296 Ga0105248_1000029620 137
87 3300009177 Ga0105248_10108107 Ga0105248_101081074 137
88 3300009553 Ga0105249_10024855 Ga0105249_100248553 137
89 3300013306 Ga0163162_10016899 Ga0163162_100168997 137
90 3300014968 Ga0157379_10028314 Ga0157379_100283145 137
91 3300014968 Ga0157379_10228446 Ga0157379_102284462 137
92 3300017792 Ga0163161_10179163 Ga0163161_101791632 137
93 3300025290 Ga0207673_1003309 Ga0207673_10033092 137
94 3300025315 Ga0207697_10000442 Ga0207697_100004421 137
95 3300025900 Ga0207710_10005275 Ga0207710_100052757 137
96 3300025903 Ga0207680_10001461 Ga0207680_1000146112 137
97 3300025922 Ga0207646_10931621 Ga0207646_109316212 137
98 3300025923 Ga0207681_10000002 Ga0207681_10000002971 137
99 3300025925 Ga0207650_10015111 Ga0207650_100151113 137
100 3300025931 Ga0207644_10000002 Ga0207644_10000002909 137
101 3300025935 Ga0207709_10224778 Ga0207709_102247783 137
102 3300025941 Ga0207711_10000251 Ga0207711_1000025118 137
103 3300025941 Ga0207711_10122361 Ga0207711_101223614 137
104 3300025961 Ga0207712_10039787 Ga0207712_100397872 137
105 3300025972 Ga0207668_10001858 Ga0207668_100018584 137
106 3300025986 Ga0207658_10024359 Ga0207658_100243597 137
107 3300026088 Ga0207641_10048450 Ga0207641_100484502 137
108 3300026095 Ga0207676_10000383 Ga0207676_100003832 137
109 3300026118 Ga0207675_100000041 Ga0207675_10000004162 137
110 3300026118 Ga0207675_100005628 Ga0207675_10000562812 137
111 3300028379 Ga0268266_10019585 Ga0268266_100195858 137
112 3300028380 Ga0268265_10001875 Ga0268265_1000187521 137
113 3300028381 Ga0268264_10000071 Ga0268264_1000007112 137
114 3300028786 Ga0307517_10014909 Ga0307517_100149092 137
115 3300031251 Ga0265327_10055612 Ga0265327_100556123 137
116 3300031456 Ga0307513_10632148 Ga0307513_106321482 137
117 3300047472 Ga0495686_0000262 Ga0495686_0000262_85501_85935 137
118 3300048925 Ga0496122_0000306 Ga0496122_0000306_58064_58576 137
119 3300048926 Ga0496123_0001592 Ga0496123_0001592_22227_22739 137
120 3300048928 Ga0496125_0017748 Ga0496125_0017748_5537_6001 137
121 3300048928 Ga0496125_0473182 Ga0496125_0473182_141_653 137
122 3300048929 Ga0496126_0161083 Ga0496126_0161083_841_1353 137
123 3300050509 nmdc:mga0qj67_824388_c1 nmdc:mga0qj67_824388_c1_147_569 137
124 3300053136 Ga0500559_0289904 Ga0500559_0289904_193_705 137
125 3300053142 Ga0500577_0098457 Ga0500577_0098457_699_1133 137
126 3300002459 JGI24751J29686_10028971 JGI24751J29686_100289712 138
127 3300003773 Ga0055537_1001791 Ga0055537_10017915 138
128 3300003775 Ga0055524_1000118 Ga0055524_100011835 138
129 3300003791 Ga0055530_10017528 Ga0055530_100175282 138
130 3300003794 Ga0055531_10000073 Ga0055531_10000073108 138
131 3300003794 Ga0055531_10008805 Ga0055531_100088053 138
132 3300005262 Ga0065165_1030331 Ga0065165_10303313 138
133 3300005295 Ga0065707_10044766 Ga0065707_100447661 138
134 3300005331 Ga0070670_100036936 Ga0070670_1000369363 138
135 3300005353 Ga0070669_100012326 Ga0070669_1000123264 138
136 3300005353 Ga0070669_100040711 Ga0070669_1000407113 138
137 3300005355 Ga0070671_100067370 Ga0070671_1000673702 138
138 3300005466 Ga0070685_10057007 Ga0070685_100570072 138
139 3300005548 Ga0070665_100169873 Ga0070665_1001698731 138
140 3300005618 Ga0068864_101114098 Ga0068864_1011140982 138
141 3300005844 Ga0068862_100405747 Ga0068862_1004057472 138
142 3300005985 Ga0081539_10013701 Ga0081539_100137011 138
143 3300006948 Ga0099826_10353641 Ga0099826_103536411 138
144 3300025263 Ga0209565_1000011 Ga0209565_1000011463 138
145 3300025273 Ga0209673_1003868 Ga0209673_100386813 138
146 3300025297 Ga0209758_1008619 Ga0209758_10086197 138
147 3300025298 Ga0209050_1000209 Ga0209050_1000209132 138
148 3300025298 Ga0209050_1006138 Ga0209050_100613812 138
149 3300025299 Ga0209256_1000016 Ga0209256_1000016137 138
150 3300025304 Ga0209257_1000027 Ga0209257_1000027570 138
151 3300025304 Ga0209257_1006974 Ga0209257_100697410 138
152 3300025923 Ga0207681_10268125 Ga0207681_102681252 138
153 3300025925 Ga0207650_10036067 Ga0207650_100360673 138
154 3300026095 Ga0207676_10944673 Ga0207676_109446731 138
155 3300028380 Ga0268265_10099240 Ga0268265_100992402 138
156 3300031548 Ga0307408_100265169 Ga0307408_1002651692 138
157 3300031731 Ga0307405_10039398 Ga0307405_100393984 138
158 3300031824 Ga0307413_10238653 Ga0307413_102386532 138
159 3300031901 Ga0307406_10061761 Ga0307406_100617613 138
160 3300031903 Ga0307407_10194740 Ga0307407_101947402 138
161 3300031911 Ga0307412_10674097 Ga0307412_106740972 138
162 3300031995 Ga0307409_100064682 Ga0307409_1000646825 138
163 3300032002 Ga0307416_100045139 Ga0307416_1000451395 138
164 3300032004 Ga0307414_10155110 Ga0307414_101551102 138
165 3300032004 Ga0307414_10335293 Ga0307414_103352932 138
166 3300032004 Ga0307414_10783788 Ga0307414_107837881 138
167 3300032005 Ga0307411_10134325 Ga0307411_101343252 138
168 3300032126 Ga0307415_100125483 Ga0307415_1001254833 138
169 3300032126 Ga0307415_102073081 Ga0307415_1020730812 138
170 3300044765 Ga0466970_0785228 Ga0466970_0785228_37_474 138
171 3300049515 Ga0501292_000022 Ga0501292_000022_23263_23697 138
172 3300049517 Ga0501294_000093 Ga0501294_000093_7962_8396 138
173 3300049653 Ga0501206_028555 Ga0501206_028555_73_507 138
174 3300049662 Ga0501222_000207 Ga0501222_000207_3369_3803 138
175 3300049663 Ga0501223_000599 Ga0501223_000599_7932_8366 138
176 3300049664 Ga0501224_000109 Ga0501224_000109_7882_8316 138
177 3300049665 Ga0501227_021759 Ga0501227_021759_322_756 138
178 3300049668 Ga0501233_083091 Ga0501233_083091_124_558 138
179 3300049669 Ga0501235_002784 Ga0501235_002784_2810_3244 138
180 3300049670 Ga0501236_043757 Ga0501236_043757_112_546 138
181 3300049688 Ga0501259_000841 Ga0501259_000841_4104_4538 138
182 3300049690 Ga0501261_000075 Ga0501261_000075_9685_10119 138
183 3300049705 Ga0501225_0001860 Ga0501225_0001860_3427_3861 138
184 3300049706 Ga0501229_076860 Ga0501229_076860_57_491 138
185 3300049708 Ga0501245_000635 Ga0501245_000635_2706_3140 138
186 3300049775 Ga0501279_000012 Ga0501279_000012_46381_46815 138
187 3300049776 Ga0501280_000005 Ga0501280_000005_23047_23481 138
188 3300049777 Ga0501281_00020 Ga0501281_00020_6653_7087 138
189 3300049778 Ga0501282_000176 Ga0501282_000176_1404_1838 138
190 3300053096 Ga0500641_0173514 Ga0500641_0173514_115_552 138
191 iso_pu_bacteria 2984564862 2984565093 138
192 3300001979 JGI24740J21852_10131538 JGI24740J21852_101315381 139
193 3300001989 JGI24739J22299_10001913 JGI24739J22299_100019134 139
194 3300001989 JGI24739J22299_10052324 JGI24739J22299_100523242 139
195 3300001990 JGI24737J22298_10039902 JGI24737J22298_100399022 139
196 3300001990 JGI24737J22298_10100943 JGI24737J22298_101009432 139
197 3300002067 JGI24735J21928_10002676 JGI24735J21928_100026762 139
198 3300002067 JGI24735J21928_10040869 JGI24735J21928_100408692 139
199 3300002075 JGI24738J21930_10001021 JGI24738J21930_100010214 139
200 3300005289 Ga0065704_10244845 Ga0065704_102448452 139
201 3300005327 Ga0070658_10019979 Ga0070658_100199794 139
202 3300005329 Ga0070683_100234171 Ga0070683_1002341713 139
203 3300005344 Ga0070661_100313629 Ga0070661_1003136292 139
204 3300005347 Ga0070668_100010996 Ga0070668_1000109963 139
205 3300005366 Ga0070659_100036312 Ga0070659_1000363125 139
206 3300005455 Ga0070663_100005719 Ga0070663_1000057198 139
207 3300005548 Ga0070665_100064570 Ga0070665_1000645704 139
208 3300005578 Ga0068854_100336585 Ga0068854_1003365851 139
209 3300005616 Ga0068852_100250008 Ga0068852_1002500082 139
210 3300005834 Ga0068851_10022324 Ga0068851_100223244 139
211 3300013307 Ga0157372_11550593 Ga0157372_115505931 139
212 3300017792 Ga0163161_10020336 Ga0163161_100203365 139
213 3300021377 Ga0213874_10270176 Ga0213874_102701761 139
214 3300025321 Ga0207656_10009065 Ga0207656_100090654 139
215 3300025735 Ga0207713_1014992 Ga0207713_10149926 139
216 3300025924 Ga0207694_10549781 Ga0207694_105497812 139
217 3300025961 Ga0207712_10429354 Ga0207712_104293542 139
218 3300025981 Ga0207640_10247385 Ga0207640_102473852 139
219 3300026035 Ga0207703_10040742 Ga0207703_100407422 139
220 3300026067 Ga0207678_10000068 Ga0207678_1000006814 139
221 3300026142 Ga0207698_10258887 Ga0207698_102588872 139
222 3300026142 Ga0207698_10688419 Ga0207698_106884192 139
223 3300031548 Ga0307408_100011557 Ga0307408_1000115574 139
224 3300031548 Ga0307408_100051480 Ga0307408_1000514804 139
225 3300031548 Ga0307408_101078937 Ga0307408_1010789372 139
226 3300031731 Ga0307405_10023829 Ga0307405_100238294 139
227 3300031731 Ga0307405_10219714 Ga0307405_102197142 139
228 3300031731 Ga0307405_11559296 Ga0307405_115592961 139
229 3300031852 Ga0307410_10025503 Ga0307410_100255032 139
230 3300031901 Ga0307406_10036022 Ga0307406_100360225 139
231 3300031901 Ga0307406_10652952 Ga0307406_106529522 139
232 3300031901 Ga0307406_11326436 Ga0307406_113264361 139
233 3300031911 Ga0307412_10059289 Ga0307412_100592894 139
234 3300031911 Ga0307412_10084975 Ga0307412_100849753 139
235 3300031995 Ga0307409_100076623 Ga0307409_1000766232 139
236 3300031995 Ga0307409_101569545 Ga0307409_1015695452 139
237 3300032002 Ga0307416_100036866 Ga0307416_1000368665 139
238 3300032002 Ga0307416_100049966 Ga0307416_1000499662 139
239 3300032004 Ga0307414_10018974 Ga0307414_100189745 139
240 3300032005 Ga0307411_10050922 Ga0307411_100509223 139
241 3300032126 Ga0307415_100100707 Ga0307415_1001007074 139
242 3300037471 Ga0395905_0940862 Ga0395905_0940862_89_529 139
243 3300039450 Ga0436363_0627825 Ga0436363_0627825_132_572 139
244 3300046460 Ga0495638_0220978 Ga0495638_0220978_67_507 139
245 3300046471 Ga0495650_0247932 Ga0495650_0247932_17_457 139
246 3300047472 Ga0495686_0458241 Ga0495686_0458241_139_579 139
247 3300048920 Ga0496117_0030629 Ga0496117_0030629_624_1064 139
248 3300048921 Ga0496118_0037508 Ga0496118_0037508_2621_3061 139
249 iso_pu_bacteria 2885427238 2885427275 139
250 3300005293 Ga0065715_10115198 Ga0065715_101151983 140
251 3300005293 Ga0065715_10546941 Ga0065715_105469411 140
252 3300005336 Ga0070680_100107653 Ga0070680_1001076532 140
253 3300005353 Ga0070669_100429053 Ga0070669_1004290532 140
254 3300005355 Ga0070671_100232893 Ga0070671_1002328932 140
255 3300005458 Ga0070681_10216562 Ga0070681_102165622 140
256 3300005530 Ga0070679_100051356 Ga0070679_1000513564 140
257 3300005563 Ga0068855_100009733 Ga0068855_1000097335 140
258 3300005578 Ga0068854_100046585 Ga0068854_1000465853 140
259 3300005578 Ga0068854_100214226 Ga0068854_1002142262 140
260 3300005614 Ga0068856_101684453 Ga0068856_1016844531 140
261 3300006048 Ga0075363_100002692 Ga0075363_1000026926 140
262 3300006178 Ga0075367_10000051 Ga0075367_1000005114 140
263 3300006358 Ga0068871_100807870 Ga0068871_1008078702 140
264 3300009093 Ga0105240_10072045 Ga0105240_100720454 140
265 3300009174 Ga0105241_10473388 Ga0105241_104733882 140
266 3300010375 Ga0105239_11148465 Ga0105239_111484652 140
267 3300025909 Ga0207705_10376076 Ga0207705_103760762 140
268 3300025911 Ga0207654_10163870 Ga0207654_101638702 140
269 3300025912 Ga0207707_10327945 Ga0207707_103279452 140
270 3300025913 Ga0207695_10017242 Ga0207695_100172422 140
271 3300025919 Ga0207657_10331742 Ga0207657_103317422 140
272 3300025921 Ga0207652_10115191 Ga0207652_101151912 140
273 3300025925 Ga0207650_10197717 Ga0207650_101977172 140
274 3300025940 Ga0207691_10883584 Ga0207691_108835842 140
275 3300025944 Ga0207661_10410439 Ga0207661_104104392 140
276 3300025949 Ga0207667_10031117 Ga0207667_100311175 140
277 3300026078 Ga0207702_11476383 Ga0207702_114763832 140
278 3300027614 Ga0209970_1100606 Ga0209970_11006061 140
279 3300027866 Ga0209813_10000172 Ga0209813_100001722 140
280 3300027876 Ga0209974_10008028 Ga0209974_100080282 140
281 3300030731 Ga0316177_1010467 Ga0316177_10104672 140
282 3300030735 Ga0316178_1151566 Ga0316178_11515662 140
283 3300030736 Ga0316180_1187281 Ga0316180_11872813 140
284 3300030742 Ga0316183_1180393 Ga0316183_11803932 140
285 3300030745 Ga0316182_1153558 Ga0316182_11535582 140
286 3300031548 Ga0307408_100335925 Ga0307408_1003359252 140
287 3300031548 Ga0307408_100396029 Ga0307408_1003960292 140
288 3300031731 Ga0307405_10067552 Ga0307405_100675524 140
289 3300031731 Ga0307405_10114949 Ga0307405_101149492 140
290 3300031731 Ga0307405_10243906 Ga0307405_102439062 140
291 3300031824 Ga0307413_10009505 Ga0307413_100095056 140
292 3300031824 Ga0307413_10013310 Ga0307413_100133101 140
293 3300031824 Ga0307413_10060608 Ga0307413_100606084 140
294 3300031824 Ga0307413_10062284 Ga0307413_100622843 140
295 3300031824 Ga0307413_10784987 Ga0307413_107849871 140
296 3300031824 Ga0307413_11350426 Ga0307413_113504261 140
297 3300031824 Ga0307413_11437520 Ga0307413_114375202 140
298 3300031852 Ga0307410_10231238 Ga0307410_102312382 140
299 3300031852 Ga0307410_10247483 Ga0307410_102474832 140
300 3300031852 Ga0307410_10270282 Ga0307410_102702822 140
301 3300031852 Ga0307410_10485635 Ga0307410_104856352 140
302 3300031901 Ga0307406_10006284 Ga0307406_100062848 140
303 3300031901 Ga0307406_10181581 Ga0307406_101815812 140
304 3300031901 Ga0307406_10397440 Ga0307406_103974402 140
305 3300031903 Ga0307407_10003784 Ga0307407_100037847 140
306 3300031903 Ga0307407_10024854 Ga0307407_100248542 140
307 3300031903 Ga0307407_10111121 Ga0307407_101111212 140
308 3300031903 Ga0307407_10781101 Ga0307407_107811011 140
309 3300031911 Ga0307412_10046826 Ga0307412_100468263 140
310 3300031911 Ga0307412_10134960 Ga0307412_101349603 140
311 3300031911 Ga0307412_10163373 Ga0307412_101633732 140
312 3300031911 Ga0307412_10700166 Ga0307412_107001661 140
313 3300031911 Ga0307412_10842715 Ga0307412_108427152 140
314 3300031995 Ga0307409_100007148 Ga0307409_1000071488 140
315 3300031995 Ga0307409_100022526 Ga0307409_1000225265 140
316 3300031995 Ga0307409_100113522 Ga0307409_1001135222 140
317 3300031995 Ga0307409_101696636 Ga0307409_1016966362 140
318 3300032002 Ga0307416_100541482 Ga0307416_1005414822 140
319 3300032002 Ga0307416_100810385 Ga0307416_1008103852 140
320 3300032002 Ga0307416_100905187 Ga0307416_1009051871 140
321 3300032004 Ga0307414_10005443 Ga0307414_100054438 140
322 3300032004 Ga0307414_10020384 Ga0307414_100203842 140
323 3300032004 Ga0307414_10020899 Ga0307414_100208992 140
324 3300032004 Ga0307414_10215528 Ga0307414_102155282 140
325 3300032004 Ga0307414_10355085 Ga0307414_103550852 140
326 3300032004 Ga0307414_10443906 Ga0307414_104439061 140
327 3300032004 Ga0307414_11471032 Ga0307414_114710322 140
328 3300032005 Ga0307411_10000768 Ga0307411_100007682 140
329 3300032005 Ga0307411_10122066 Ga0307411_101220663 140
330 3300032126 Ga0307415_100102552 Ga0307415_1001025523 140
331 3300032126 Ga0307415_100659027 Ga0307415_1006590272 140
332 3300033180 Ga0307510_10197820 Ga0307510_101978203 140
333 3300041512 Ga0451853_2068090 Ga0451853_2068090_66_509 140
334 3300046471 Ga0495650_0138866 Ga0495650_0138866_90_557 140
335 3300046513 Ga0495616_0000007 Ga0495616_0000007_12087_12554 140
336 3300053087 Ga0500643_000121 Ga0500643_000121_46920_47360 140
337 3300053116 Ga0500592_000224 Ga0500592_000224_2274_2714 140
338 3300053136 Ga0500559_0098159 Ga0500559_0098159_139_582 140
339 3300053151 Ga0500604_0013225 Ga0500604_0013225_814_1254 140
340 3300053158 Ga0500627_0000272 Ga0500627_0000272_10340_10807 140
341 3300002239 JGI24034J26672_10099075 JGI24034J26672_100990751 141
342 3300005336 Ga0070680_100000487 Ga0070680_1000004873 141
343 3300005339 Ga0070660_100044177 Ga0070660_1000441772 141
344 3300005344 Ga0070661_100000113 Ga0070661_10000011343 141
345 3300005347 Ga0070668_100079005 Ga0070668_1000790054 141
346 3300005347 Ga0070668_100087160 Ga0070668_1000871604 141
347 3300005347 Ga0070668_100698168 Ga0070668_1006981682 141
348 3300005353 Ga0070669_100121793 Ga0070669_1001217934 141
349 3300005353 Ga0070669_100463785 Ga0070669_1004637852 141
350 3300005355 Ga0070671_100020058 Ga0070671_1000200587 141
351 3300005355 Ga0070671_100062130 Ga0070671_1000621303 141
352 3300005355 Ga0070671_100487221 Ga0070671_1004872212 141
353 3300005364 Ga0070673_101260357 Ga0070673_1012603572 141
354 3300005367 Ga0070667_101023944 Ga0070667_1010239442 141
355 3300005455 Ga0070663_101270522 Ga0070663_1012705222 141
356 3300005459 Ga0068867_100202170 Ga0068867_1002021702 141
357 3300005539 Ga0068853_100051458 Ga0068853_1000514582 141
358 3300005548 Ga0070665_100371492 Ga0070665_1003714922 141
359 3300005719 Ga0068861_100403221 Ga0068861_1004032212 141
360 3300005834 Ga0068851_10088195 Ga0068851_100881952 141
361 3300005844 Ga0068862_100135638 Ga0068862_1001356382 141
362 3300005844 Ga0068862_100187415 Ga0068862_1001874154 141
363 3300005844 Ga0068862_101309562 Ga0068862_1013095621 141
364 3300006237 Ga0097621_100046877 Ga0097621_1000468772 141
365 3300006358 Ga0068871_101018119 Ga0068871_1010181191 141
366 3300009011 Ga0105251_10014149 Ga0105251_100141496 141
367 3300009176 Ga0105242_10976958 Ga0105242_109769582 141
368 3300009177 Ga0105248_10246547 Ga0105248_102465473 141
369 3300009177 Ga0105248_10479692 Ga0105248_104796923 141
370 3300009545 Ga0105237_10024202 Ga0105237_100242023 141
371 3300009551 Ga0105238_11751391 Ga0105238_117513911 141
372 3300010375 Ga0105239_10002689 Ga0105239_1000268922 141
373 3300013306 Ga0163162_10007008 Ga0163162_100070083 141
374 3300013308 Ga0157375_10002847 Ga0157375_100028474 141
375 3300014325 Ga0163163_10608265 Ga0163163_106082651 141
376 3300017792 Ga0163161_10014669 Ga0163161_100146693 141
377 3300025913 Ga0207695_10202888 Ga0207695_102028883 141
378 3300025914 Ga0207671_10001440 Ga0207671_100014408 141
379 3300025919 Ga0207657_10054497 Ga0207657_100544974 141
380 3300025920 Ga0207649_10000089 Ga0207649_1000008946 141
381 3300025923 Ga0207681_10408175 Ga0207681_104081752 141
382 3300025924 Ga0207694_11111459 Ga0207694_111114591 141
383 3300025931 Ga0207644_10532757 Ga0207644_105327572 141
384 3300025931 Ga0207644_10669787 Ga0207644_106697872 141
385 3300025934 Ga0207686_10511013 Ga0207686_105110132 141
386 3300025940 Ga0207691_10125090 Ga0207691_101250902 141
387 3300025941 Ga0207711_10264875 Ga0207711_102648753 141
388 3300025941 Ga0207711_10278727 Ga0207711_102787273 141
389 3300025972 Ga0207668_10003466 Ga0207668_1000346614 141
390 3300025972 Ga0207668_10077524 Ga0207668_100775242 141
391 3300025986 Ga0207658_10435562 Ga0207658_104355622 141
392 3300026089 Ga0207648_10682826 Ga0207648_106828262 141
393 3300026118 Ga0207675_100312728 Ga0207675_1003127282 141
394 3300028379 Ga0268266_11132404 Ga0268266_111324041 141
395 3300028380 Ga0268265_10078398 Ga0268265_100783983 141
396 3300028380 Ga0268265_10128782 Ga0268265_101287823 141
397 3300028380 Ga0268265_10546329 Ga0268265_105463292 141
398 3300028380 Ga0268265_12490559 Ga0268265_124905591 141
399 3300031548 Ga0307408_100117628 Ga0307408_1001176282 141
400 3300031548 Ga0307408_101238090 Ga0307408_1012380902 141
401 3300031548 Ga0307408_101975026 Ga0307408_1019750262 141
402 3300031731 Ga0307405_10131803 Ga0307405_101318032 141
403 3300031731 Ga0307405_10298729 Ga0307405_102987292 141
404 3300031731 Ga0307405_10619945 Ga0307405_106199452 141
405 3300031824 Ga0307413_10295783 Ga0307413_102957832 141
406 3300031824 Ga0307413_10314509 Ga0307413_103145092 141
407 3300031824 Ga0307413_10344969 Ga0307413_103449692 141
408 3300031852 Ga0307410_10129911 Ga0307410_101299112 141
409 3300031852 Ga0307410_10394589 Ga0307410_103945892 141
410 3300031852 Ga0307410_10475997 Ga0307410_104759972 141
411 3300031901 Ga0307406_10132577 Ga0307406_101325773 141
412 3300031901 Ga0307406_10311608 Ga0307406_103116082 141
413 3300031901 Ga0307406_10441583 Ga0307406_104415832 141
414 3300031901 Ga0307406_10543634 Ga0307406_105436342 141
415 3300031903 Ga0307407_10118948 Ga0307407_101189483 141
416 3300031903 Ga0307407_10278637 Ga0307407_102786372 141
417 3300031911 Ga0307412_10001563 Ga0307412_100015633 141
418 3300031911 Ga0307412_10187660 Ga0307412_101876602 141
419 3300031995 Ga0307409_100877530 Ga0307409_1008775302 141
420 3300031995 Ga0307409_100950883 Ga0307409_1009508832 141
421 3300031995 Ga0307409_101039404 Ga0307409_1010394042 141
422 3300032002 Ga0307416_100037872 Ga0307416_1000378726 141
423 3300032002 Ga0307416_100721329 Ga0307416_1007213292 141
424 3300032002 Ga0307416_100904890 Ga0307416_1009048902 141
425 3300032002 Ga0307416_100997021 Ga0307416_1009970212 141
426 3300032002 Ga0307416_101560537 Ga0307416_1015605372 141
427 3300032004 Ga0307414_10000308 Ga0307414_1000030813 141
428 3300032004 Ga0307414_10128427 Ga0307414_101284274 141
429 3300032004 Ga0307414_10263575 Ga0307414_102635752 141
430 3300032004 Ga0307414_10314894 Ga0307414_103148942 141
431 3300032004 Ga0307414_10365094 Ga0307414_103650942 141
432 3300032004 Ga0307414_10899357 Ga0307414_108993572 141
433 3300032004 Ga0307414_10921993 Ga0307414_109219932 141
434 3300032004 Ga0307414_11553035 Ga0307414_115530352 141
435 3300032005 Ga0307411_10012845 Ga0307411_100128455 141
436 3300032005 Ga0307411_10040468 Ga0307411_100404684 141
437 3300032005 Ga0307411_10245497 Ga0307411_102454972 141
438 3300032005 Ga0307411_11421177 Ga0307411_114211771 141
439 3300032126 Ga0307415_100038354 Ga0307415_1000383543 141
440 3300042439 Ga0439464_0006676 Ga0439464_0006676_2009_2452 141
441 3300046457 Ga0495590_0364812 Ga0495590_0364812_65_508 141
442 3300046528 Ga0495642_0134181 Ga0495642_0134181_395_838 141
443 3300046684 Ga0495669_0008391 Ga0495669_0008391_1527_1970 141
444 3300047472 Ga0495686_0000834 Ga0495686_0000834_17789_18235 141
445 3300048910 Ga0496107_0081724 Ga0496107_0081724_1509_1952 141
446 3300048911 Ga0496108_0157347 Ga0496108_0157347_177_620 141
447 3300048911 Ga0496108_0380922 Ga0496108_0380922_21_545 141
448 3300048912 Ga0496109_0276936 Ga0496109_0276936_763_1206 141
449 3300048913 Ga0496110_0007823 Ga0496110_0007823_1250_1693 141
450 3300048914 Ga0496111_0054410 Ga0496111_0054410_1691_2134 141
451 3300048917 Ga0496114_0009716 Ga0496114_0009716_849_1292 141
452 3300048920 Ga0496117_0061445 Ga0496117_0061445_88_537 141
453 3300048921 Ga0496118_0001107 Ga0496118_0001107_18701_19150 141
454 3300048921 Ga0496118_0045558 Ga0496118_0045558_2257_2703 141
455 3300048924 Ga0496121_0001342 Ga0496121_0001342_21218_21664 141
456 3300048924 Ga0496121_0098057 Ga0496121_0098057_1078_1602 141
457 3300048924 Ga0496121_0126319 Ga0496121_0126319_1222_1671 141
458 3300048925 Ga0496122_0030304 Ga0496122_0030304_3356_3880 141
459 3300048927 Ga0496124_0077370 Ga0496124_0077370_1869_2318 141
460 3300048928 Ga0496125_0018638 Ga0496125_0018638_782_1306 141
461 3300048928 Ga0496125_0211088 Ga0496125_0211088_30_479 141
462 3300048929 Ga0496126_0111938 Ga0496126_0111938_1663_2109 141
463 3300049570 Ga0501033_0046394 Ga0501033_0046394_2563_3009 141
464 3300049571 Ga0501034_0064209 Ga0501034_0064209_900_1346 141
465 3300049579 Ga0501043_0086941 Ga0501043_0086941_1746_2192 141
466 3300049589 Ga0501073_0414312 Ga0501073_0414312_302_748 141
467 3300049649 Ga0501198_006741 Ga0501198_006741_361_807 141
468 3300049663 Ga0501223_000978 Ga0501223_000978_2795_3241 141
469 3300049664 Ga0501224_000006 Ga0501224_000006_136858_137304 141
470 3300049668 Ga0501233_000508 Ga0501233_000508_289_735 141
471 3300049669 Ga0501235_050002 Ga0501235_050002_145_591 141
472 3300049705 Ga0501225_0001785 Ga0501225_0001785_3546_3992 141
473 3300049823 Ga0501044_0025435 Ga0501044_0025435_2769_3215 141
474 3300049853 Ga0501226_000355 Ga0501226_000355_3459_3905 141
475 3300053153 Ga0500616_0007857 Ga0500616_0007857_4942_5382 141
476 3300053108 Ga0500562_081465 Ga0500562_081465_59_502 142
477 3300002239 JGI24034J26672_10024749 JGI24034J26672_100247492 143
478 3300005331 Ga0070670_100091031 Ga0070670_1000910313 143
479 3300005347 Ga0070668_100000021 Ga0070668_10000002131 143
480 3300005355 Ga0070671_100000114 Ga0070671_10000011429 143
481 3300005563 Ga0068855_101084729 Ga0068855_1010847291 143
482 3300005578 Ga0068854_100102525 Ga0068854_1001025252 143
483 3300005616 Ga0068852_100303983 Ga0068852_1003039832 143
484 3300005617 Ga0068859_100041916 Ga0068859_1000419162 143
485 3300005841 Ga0068863_100000043 Ga0068863_10000004332 143
486 3300005844 Ga0068862_100319331 Ga0068862_1003193312 143
487 3300006931 Ga0097620_100041917 Ga0097620_1000419172 143
488 3300025931 Ga0207644_10000077 Ga0207644_1000007730 143
489 3300025949 Ga0207667_10048527 Ga0207667_100485274 143
490 3300025961 Ga0207712_10092327 Ga0207712_100923272 143
491 3300025972 Ga0207668_10000068 Ga0207668_1000006831 143
492 3300025981 Ga0207640_10194062 Ga0207640_101940623 143
493 3300026088 Ga0207641_10000031 Ga0207641_1000003135 143
494 3300028380 Ga0268265_10058781 Ga0268265_100587811 143
495 3300028381 Ga0268264_10016671 Ga0268264_100166714 143
496 3300041460 Ga0451802_1555010 Ga0451802_1555010_97_543 143
497 3300042156 Ga0439446_0154201 Ga0439446_0154201_54_494 143
498 3300001976 JGI24752J21851_1010400 JGI24752J21851_10104001 146
499 3300005295 Ga0065707_10081805 Ga0065707_1008180521 146
500 3300005331 Ga0070670_100000030 Ga0070670_10000003044 146
501 3300005367 Ga0070667_100001586 Ga0070667_10000158612 146
502 3300005617 Ga0068859_100804469 Ga0068859_1008044692 146
503 3300005618 Ga0068864_100000041 Ga0068864_10000004144 146
504 3300005841 Ga0068863_100000035 Ga0068863_10000003544 146
505 3300005844 Ga0068862_100000042 Ga0068862_100000042131 146
506 3300006931 Ga0097620_100804447 Ga0097620_1008044472 146
507 3300009011 Ga0105251_10000180 Ga0105251_1000018044 146
508 3300009101 Ga0105247_10207779 Ga0105247_102077792 146
509 3300009177 Ga0105248_10000045 Ga0105248_1000004542 146
510 3300009553 Ga0105249_10000055 Ga0105249_10000055130 146
511 3300013306 Ga0163162_10019966 Ga0163162_100199662 146
512 3300014326 Ga0157380_10000606 Ga0157380_1000060621 146
513 3300014968 Ga0157379_10027204 Ga0157379_100272043 146
514 3300025735 Ga0207713_1001001 Ga0207713_100100116 146
515 3300025900 Ga0207710_10209148 Ga0207710_102091481 146
516 3300025925 Ga0207650_10000238 Ga0207650_1000023845 146
517 3300025941 Ga0207711_10000027 Ga0207711_10000027196 146
518 3300025961 Ga0207712_10000262 Ga0207712_1000026241 146
519 3300025986 Ga0207658_10000362 Ga0207658_100003623 146
520 3300026088 Ga0207641_10000041 Ga0207641_1000004143 146
521 3300026095 Ga0207676_10000039 Ga0207676_10000039134 146
522 3300028380 Ga0268265_10000061 Ga0268265_10000061109 146
523 3300048904 Ga0496101_0199974 Ga0496101_0199974_381_821 146
524 3300048905 Ga0496102_1006514 Ga0496102_1006514_225_665 146
525 3300048906 Ga0496103_0026623 Ga0496103_0026623_1465_1905 146
526 3300048919 Ga0496116_0170115 Ga0496116_0170115_403_843 146
527 3300048920 Ga0496117_0005718 Ga0496117_0005718_4114_4554 146
528 3300048921 Ga0496118_0000493 Ga0496118_0000493_38033_38473 146
529 3300048924 Ga0496121_0463062 Ga0496121_0463062_103_543 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

33

162

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8681 65 138
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8465 65 138
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.7397 90 137
1dqw-assembly1.cif.gz_A crystal structure of orotidine 5'-phosphate decarboxylase 0.706 108 139
8pek-assembly1.cif.gz_B structure of the dimeric, periplasmic domain of exbd 0.7043 48 138
ID Description Score Start End Superfamily
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7813 66 137 3.30.420.270
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7722 66 137 3.30.420.270
af_Q55DS6_13_159_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7652 106 140 3.30.420.40
af_Q0JPY3_361_453_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7542 106 139 3.80.10.10
af_Q8IN10_6_181_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7258 104 139 3.40.50.2300
ID Description Score Start End GO Terms
AF-F0CAJ8-F1-model_v4 deleted 0.9406 66 138
AF-F0CAJ8-F1-model_v4 deleted 0.8836 66 138
AF-A0A0S7X6Y9-F1-model_v4 Biopolymer transporter ExbD 0.8814 61 141 GO:0005886
GO:0015031
GO:0022857
AF-A0A7Z2ZJG0-F1-model_v4 Biopolymer transporter ExbD 0.8541 48 138 GO:0005886
GO:0015031
GO:0022857
AF-A0A3M1K2I6-F1-model_v4 Protein TolR 0.8444 69 146 GO:0005886
GO:0015031
GO:0022857

Feature Viewer

pLDDT pTM Quality
74.14 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map