metagRoot

F459768

General Info

Members	Datasets	Scaffolds	Average Seq Length
529	278	512	434

Family's Representative Sequence

Representative Sequence	3300005356\|Ga0070674_100002137\|Ga0070674_1000021373
Length	496
Sequence	MLYQLYESQRALLSPFSEFASASSKLYNHPLSPFTHTPLAHRVSAGLELMHRLAKEYEKPEFNIHSVRVDNVDVAVQQRIAMEKPFCRLLRFKRFTDDLPMLTKMKDQPTVLVVAPLSGHHSTLLRETVRELLRDHKVFVTDWTDARMVPLQAGPFHLKDYVAYVQEFIRHIGPDVNVISVCQPTVPVLAAVALMATNGEPTPLTMTMMGGPIDARKSPTAVNNLATNKSLGWFASNVIYRVPTNYPGAGRRVYPGFLQHSGFIAMNPDRHLKSHYDYFLNLVRGDGDNADFHREFYDEYNAVLDMPAEYYLDTIKVVFQDFALVNGTWDIDGQPVRPQDIKTTALLTIEGELDDISGAGQTKAAHALCTGVPASRQFHYDVAGAGHYGIFSGRRWREKVYPRMRDFIASHQADIREAKAVVRVKSAPNVKRKAKAPANHRALEMNGRVVAAAALNGAAGGKARRGANGIDHARAGQAADDAVRVGRTSARAAKRR

Samples

	Sample ID	Description	Type	Environment
1	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
2	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
3	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
4	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
5	2643221544	Pelomonas sp. Root1444	Isolate	Unclassified
6	2643221585	Pelomonas sp. Root662	Isolate	Unclassified
7	2643221592	Rhizobacter sp. Root16D2	Isolate	Unclassified
8	2643221625	Rhizobacter sp. Root29	Isolate	Unclassified
9	2643221639	Pelomonas sp. Root1217	Isolate	Unclassified
10	2643221646	Pelomonas sp. Root1237	Isolate	Unclassified
11	2643221648	Rhizobacter sp. Root1238	Isolate	Unclassified
12	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
13	2643221656	Pelomonas sp. Root405	Isolate	Unclassified
14	2643221660	Methylibium sp. Root1272	Isolate	Unclassified
15	2738541337	Pelomonas sp. BT06	Isolate	Unclassified
16	2831864461	Roseateles noduli HZ7	Isolate	Nodule
17	2886848708	Mitsuaria sp. TWR114	Isolate	Rhizosphere
18	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
19	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
20	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
21	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
22	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
23	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
24	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
25	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
26	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
27	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
28	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
29	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
30	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
31	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
32	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
33	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
34	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
35	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
36	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
37	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
38	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
39	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
40	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
41	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
42	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
43	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
44	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
45	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
46	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
47	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
48	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
49	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
50	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
51	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
52	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
53	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
54	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
55	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
56	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
57	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
58	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
59	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
60	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
61	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
62	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
63	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
64	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
65	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
66	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
67	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
68	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
69	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
70	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
71	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
72	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
73	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
74	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
75	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
76	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
77	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
78	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
79	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
80	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
81	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
82	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
83	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
84	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
85	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
86	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
87	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
88	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
89	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
90	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
91	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
92	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
93	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
94	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
95	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
96	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
97	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
98	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
99	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
100	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
101	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
102	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
103	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
104	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
105	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
106	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
107	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
108	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
109	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
110	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
111	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
157	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
158	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
168	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
169	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
170	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
171	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
172	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
173	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
174	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
175	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
176	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
177	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
178	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
179	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
180	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
181	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
182	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
183	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
184	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
185	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
186	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
187	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
188	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
189	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
190	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
191	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
192	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
193	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
194	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
195	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
196	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
197	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
198	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
199	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
200	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
201	3300042129	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95	Metagenome	Rhizosphere
202	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
203	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
204	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
205	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
206	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
207	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
208	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
209	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
210	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
211	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
212	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
213	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
214	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
215	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
216	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
217	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
218	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
219	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
220	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
221	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
222	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
223	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
224	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
225	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
226	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
227	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
228	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
229	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
230	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
231	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
232	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
233	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
234	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
235	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
236	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
237	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
238	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
239	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
240	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
241	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
242	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
243	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
244	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
245	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
246	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
247	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
248	3300049528	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
249	3300049531	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
250	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
251	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
252	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
253	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
254	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
255	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
256	3300049658	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought	Metagenome	Rhizosphere
257	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
258	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
259	3300049687	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought	Metagenome	Rhizosphere
260	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
261	3300049706	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control	Metagenome	Rhizosphere
262	3300049769	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought	Metagenome	Rhizosphere
263	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
264	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
265	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
266	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
267	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
268	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
269	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
270	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
271	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
272	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
273	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
274	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
275	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
276	3300053724	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere	Metagenome	Endosphere
277	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
278	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	96.41
Metatranscriptomes	0.38
Isolates	3.21

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	18.9
Nodule	0.95
Rhizoplane	3.59
Rhizosphere	67.86
Stem	0
Stem Tuber	0
Unclassified	8.7

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25152J39213_1000849	3300002773	Bacteria	15165
2	JGI25153J46596_10002525	3300003215	Bacteria	10497
3	rootL2_10008667	3300003322	Bacteria	9480
4	Ga0055525_1000011	3300003759	Bacteria	503124
5	Ga0055526_1001549	3300003771	Bacteria	16265
6	Ga0055524_1000080	3300003775	Bacteria	120203
7	Ga0055524_1008226	3300003775	Bacteria	4352
8	Ga0055530_10007232	3300003791	Bacteria	4727
9	Ga0055540_1000002	3300003792	Bacteria	436954
10	Ga0055531_10000078	3300003794	Bacteria	105599
11	Ga0055531_10011352	3300003794	Bacteria	4310
12	Ga0055531_10011505	3300003794	Bacteria	4257
13	Ga0065165_1000613	3300005262	Bacteria	51836
14	Ga0065165_1000652	3300005262	Bacteria	50081
15	Ga0065165_1004114	3300005262	Bacteria	9364
16	Ga0065715_10106343	3300005293	Bacteria	2814
17	Ga0065707_10081939	3300005295	Bacteria	28637
18	Ga0070676_10003923	3300005328	Bacteria	7807
19	Ga0070676_10015489	3300005328	Bacteria	4206
20	Ga0070690_100005597	3300005330	Bacteria	7070
21	Ga0070670_100001125	3300005331	Bacteria	21269
22	Ga0070670_100050668	3300005331	Bacteria	3567
23	Ga0070670_100129638	3300005331	Bacteria	2177
24	Ga0070677_10001963	3300005333	Bacteria	6527
25	Ga0070677_10010175	3300005333	Bacteria	3211
26	Ga0068869_100001634	3300005334	Bacteria	13365
27	Ga0068869_100005104	3300005334	Bacteria	8234
28	Ga0068869_100011586	3300005334	Bacteria	5789
29	Ga0070666_10012274	3300005335	Bacteria	5398
30	Ga0070666_10034159	3300005335	Bacteria	3370
31	Ga0070680_100006075	3300005336	Bacteria	9146
32	Ga0068868_100003010	3300005338	Bacteria	11717
33	Ga0068868_100015324	3300005338	Bacteria	5667
34	Ga0068868_100036371	3300005338	Bacteria	3811
35	Ga0070660_100139159	3300005339	Bacteria	1946
36	Ga0070661_100052423	3300005344	Bacteria	2986
37	Ga0070668_100038093	3300005347	Bacteria	3673
38	Ga0070669_100001839	3300005353	Bacteria	15305
39	Ga0070669_100022631	3300005353	Bacteria	4494
40	Ga0070669_100043541	3300005353	Bacteria	3270
41	Ga0070675_100000735	3300005354	Bacteria	22835
42	Ga0070675_100001277	3300005354	Bacteria	18401
43	Ga0070675_100050288	3300005354	Bacteria	3422
44	Ga0070671_100061141	3300005355	Bacteria	3137
45	Ga0070671_100061288	3300005355	Bacteria	3133
46	Ga0070671_100092653	3300005355	Bacteria	2532
47	Ga0070674_100002137	3300005356	Bacteria	10855
48	Ga0070674_100027566	3300005356	Bacteria	3724
49	Ga0070674_100066179	3300005356	Bacteria	2538
50	Ga0070674_100110614	3300005356	Bacteria	2016
51	Ga0070673_100001843	3300005364	Bacteria	12677
52	Ga0070673_100025175	3300005364	Bacteria	4375
53	Ga0070659_100001486	3300005366	Bacteria	16875
54	Ga0070667_100006821	3300005367	Bacteria	9485
55	Ga0070667_100007382	3300005367	Bacteria	9129
56	Ga0070667_100031167	3300005367	Bacteria	4445
57	Ga0070667_100045593	3300005367	Bacteria	3687
58	Ga0070663_100000131	3300005455	Bacteria	35664
59	Ga0070663_100039977	3300005455	Bacteria	3281
60	Ga0070663_100054226	3300005455	Bacteria	2865
61	Ga0070678_100002726	3300005456	Bacteria	9747
62	Ga0070678_100009020	3300005456	Bacteria	6009
63	Ga0070678_100011743	3300005456	Bacteria	5416
64	Ga0070678_100052302	3300005456	Bacteria	2965
65	Ga0070662_100003017	3300005457	Bacteria	10471
66	Ga0070662_100004955	3300005457	Bacteria	8457
67	Ga0070662_100007720	3300005457	Bacteria	6982
68	Ga0070662_100031821	3300005457	Bacteria	3705
69	Ga0070662_100131056	3300005457	Bacteria	1933
70	Ga0070662_100131400	3300005457	Bacteria	1931
71	Ga0068867_100000085	3300005459	Bacteria	58473
72	Ga0068867_100002069	3300005459	Bacteria	14069
73	Ga0068867_100002456	3300005459	Bacteria	13025
74	Ga0068867_100010602	3300005459	Bacteria	6501
75	Ga0068867_100017291	3300005459	Bacteria	5121
76	Ga0068867_100033462	3300005459	Bacteria	3723
77	Ga0068867_100036779	3300005459	Bacteria	3556
78	Ga0070679_100006077	3300005530	Bacteria	11233
79	Ga0070684_100012112	3300005535	Bacteria	6898
80	Ga0068853_100047115	3300005539	Bacteria	3699
81	Ga0070672_100012049	3300005543	Bacteria	6051
82	Ga0070672_100019914	3300005543	Bacteria	4882
83	Ga0070672_100021781	3300005543	Bacteria	4694
84	Ga0070672_100031886	3300005543	Bacteria	3971
85	Ga0070672_100076002	3300005543	Bacteria	2682
86	Ga0070665_100070051	3300005548	Bacteria	3513
87	Ga0070665_100137024	3300005548	Bacteria	2451
88	Ga0070665_100207776	3300005548	Bacteria	1958
89	Ga0070664_100002283	3300005564	Bacteria	15409
90	Ga0070664_100011471	3300005564	Bacteria	7193
91	Ga0070664_100034357	3300005564	Bacteria	4253
92	Ga0070664_100053655	3300005564	Bacteria	3418
93	Ga0070664_100250332	3300005564	Bacteria	1593
94	Ga0068856_100079423	3300005614	Bacteria	3253
95	Ga0068852_100024044	3300005616	Bacteria	4917
96	Ga0068852_100074839	3300005616	Bacteria	2984
97	Ga0068852_100150393	3300005616	Bacteria	2164
98	Ga0068859_100027187	3300005617	Bacteria	5740
99	Ga0068864_100004588	3300005618	Bacteria	11333
100	Ga0068864_100019471	3300005618	Bacteria	5675
101	Ga0068864_100087450	3300005618	Bacteria	2743
102	Ga0068864_100122424	3300005618	Bacteria	2327
103	Ga0068861_100000582	3300005719	Bacteria	21639
104	Ga0068861_100000677	3300005719	Bacteria	20324
105	Ga0068851_10075514	3300005834	Bacteria	1751
106	Ga0068858_100006635	3300005842	Bacteria	11254
107	Ga0068858_100045840	3300005842	Bacteria	4053
108	Ga0068860_100001910	3300005843	Bacteria	22116
109	Ga0068860_100015787	3300005843	Bacteria	7373
110	Ga0068860_100039151	3300005843	Bacteria	4535
111	Ga0068860_100042020	3300005843	Bacteria	4368
112	Ga0068860_100167938	3300005843	Bacteria	2119
113	Ga0068862_100096083	3300005844	Bacteria	2586
114	Ga0081455_10052449	3300005937	Bacteria	3491
115	Ga0075363_100005882	3300006048	Bacteria	5520
116	Ga0075363_100019158	3300006048	Bacteria	3418
117	Ga0075363_100044554	3300006048	Bacteria	2350
118	Ga0075362_10027147	3300006177	Bacteria	2449
119	Ga0075362_10029710	3300006177	Bacteria	2357
120	Ga0075367_10015770	3300006178	Bacteria	4115
121	Ga0075367_10025059	3300006178	Bacteria	3369
122	Ga0075369_10017275	3300006186	Bacteria	2921
123	Ga0075366_10000825	3300006195	Bacteria	14880
124	Ga0075366_10006399	3300006195	Bacteria	6453
125	Ga0075366_10009563	3300006195	Bacteria	5416
126	Ga0075366_10013243	3300006195	Bacteria	4691
127	Ga0075366_10014320	3300006195	Bacteria	4529
128	Ga0075366_10018641	3300006195	Bacteria	4009
129	Ga0075366_10039868	3300006195	Bacteria	2776
130	Ga0075366_10041887	3300006195	Bacteria	2711
131	Ga0075366_10045951	3300006195	Bacteria	2587
132	Ga0075366_10046313	3300006195	Bacteria	2577
133	Ga0075366_10055795	3300006195	Bacteria	2346
134	Ga0075366_10056956	3300006195	Bacteria	2322
135	Ga0075366_10109945	3300006195	Bacteria	1657
136	Ga0075370_10000124	3300006353	Bacteria	25565
137	Ga0075370_10001135	3300006353	Bacteria	11181
138	Ga0075370_10003217	3300006353	Bacteria	7726
139	Ga0075370_10007514	3300006353	Bacteria	5554
140	Ga0075370_10013959	3300006353	Bacteria	4276
141	Ga0075370_10016614	3300006353	Bacteria	3962
142	Ga0075370_10024208	3300006353	Bacteria	3352
143	Ga0075370_10045620	3300006353	Bacteria	2479
144	Ga0075370_10062634	3300006353	Bacteria	2119
145	Ga0068871_100037531	3300006358	Bacteria	3865
146	Ga0068865_100001694	3300006881	Bacteria	12918
147	Ga0068865_100021263	3300006881	Bacteria	4217
148	Ga0097620_100027186	3300006931	Bacteria	5740
149	Ga0099823_1013693	3300006944	Bacteria	8145
150	Ga0079104_1000017	3300006946	Bacteria	313784
151	Ga0105240_10040252	3300009093	Bacteria	5979
152	Ga0105243_10061870	3300009148	Bacteria	2995
153	Ga0105243_10135554	3300009148	Bacteria	2094
154	Ga0105248_10000445	3300009177	Bacteria	46980
155	Ga0105248_10055246	3300009177	Bacteria	4453
156	Ga0105248_10312223	3300009177	Bacteria	1771
157	Ga0105237_10000548	3300009545	Bacteria	52739
158	Ga0105238_10023940	3300009551	Bacteria	6225
159	Ga0105238_10082689	3300009551	Bacteria	3200
160	Ga0105249_10009940	3300009553	Bacteria	8344
161	Ga0105249_10034913	3300009553	Bacteria	4558
162	Ga0105239_10051481	3300010375	Bacteria	4514
163	Ga0105246_10167667	3300011119	Bacteria	1679
164	Ga0157319_1000006	3300012497	Bacteria	361506
165	Ga0157373_10059192	3300013100	Bacteria	2714
166	Ga0157374_10024816	3300013296	Bacteria	5377
167	Ga0157374_10040462	3300013296	Bacteria	4293
168	Ga0157374_10045052	3300013296	Bacteria	4081
169	Ga0157378_10000558	3300013297	Bacteria	35454
170	Ga0163162_10002211	3300013306	Bacteria	18267
171	Ga0163162_10034195	3300013306	Bacteria	5056
172	Ga0163162_10076955	3300013306	Bacteria	3399
173	Ga0157372_10013601	3300013307	Bacteria	8698
174	Ga0157375_10012805	3300013308	Bacteria	7448
175	Ga0157375_10049383	3300013308	Bacteria	4122
176	Ga0163163_10243368	3300014325	Bacteria	1849
177	Ga0157380_10037794	3300014326	Bacteria	3743
178	Ga0157380_10159830	3300014326	Bacteria	1957
179	Ga0157377_10000028	3300014745	Bacteria	134810
180	Ga0157379_10035744	3300014968	Bacteria	4429
181	Ga0157379_10054003	3300014968	Bacteria	3590
182	Ga0157379_10099189	3300014968	Bacteria	2615
183	Ga0157376_10014738	3300014969	Bacteria	5880
184	Ga0163161_10049300	3300017792	Bacteria	3043
185	Ga0213872_10000011	3300021361	Bacteria	194139
186	Ga0213872_10000013	3300021361	Bacteria	182866
187	Ga0213872_10000043	3300021361	Bacteria	117678
188	Ga0213872_10000172	3300021361	Bacteria	58334
189	Ga0209563_100005	3300025230	Bacteria	1774893
190	Ga0207425_1001503	3300025245	Bacteria	9645
191	Ga0209129_1000468	3300025258	Bacteria	29705
192	Ga0209673_1004857	3300025273	Bacteria	7022
193	Ga0209673_1006161	3300025273	Bacteria	5873
194	Ga0209564_1000003	3300025295	Bacteria	1585848
195	Ga0209564_1000046	3300025295	Bacteria	373787
196	Ga0209758_1000369	3300025297	Bacteria	79541
197	Ga0209758_1000709	3300025297	Bacteria	49238
198	Ga0209050_1000651	3300025298	Bacteria	53742
199	Ga0209050_1001823	3300025298	Bacteria	20745
200	Ga0209050_1002123	3300025298	Bacteria	18059
201	Ga0209256_1000011	3300025299	Bacteria	865309
202	Ga0209256_1001979	3300025299	Bacteria	18465
203	Ga0209256_1005905	3300025299	Bacteria	6770
204	Ga0209051_1000024	3300025303	Bacteria	437007
205	Ga0209051_1003875	3300025303	Bacteria	9554
206	Ga0209051_1004008	3300025303	Bacteria	9332
207	Ga0209051_1021773	3300025303	Bacteria	2717
208	Ga0209257_1000032	3300025304	Bacteria	680354
209	Ga0209257_1002360	3300025304	Bacteria	18953
210	Ga0209257_1009881	3300025304	Bacteria	4980
211	Ga0207697_10008278	3300025315	Bacteria	4566
212	Ga0207656_10015015	3300025321	Bacteria	2993
213	Ga0207656_10028511	3300025321	Bacteria	2292
214	Ga0207682_10005941	3300025893	Bacteria	4938
215	Ga0207682_10014037	3300025893	Bacteria	3121
216	Ga0207680_10070562	3300025903	Bacteria	2163
217	Ga0207645_10003308	3300025907	Bacteria	12298
218	Ga0207645_10003470	3300025907	Bacteria	11954
219	Ga0207645_10007379	3300025907	Bacteria	7776
220	Ga0207705_10057122	3300025909	Bacteria	2815
221	Ga0207684_10002530	3300025910	Bacteria	18373
222	Ga0207695_10058388	3300025913	Bacteria	4005
223	Ga0207671_10013052	3300025914	Bacteria	6642
224	Ga0207671_10072376	3300025914	Bacteria	2573
225	Ga0207671_10232853	3300025914	Bacteria	1445
226	Ga0207660_10138453	3300025917	Bacteria	1859
227	Ga0207657_10061574	3300025919	Bacteria	3217
228	Ga0207649_10000532	3300025920	Bacteria	26476
229	Ga0207649_10026350	3300025920	Bacteria	3400
230	Ga0207649_10163289	3300025920	Bacteria	1545
231	Ga0207652_10020904	3300025921	Bacteria	5396
232	Ga0207681_10012181	3300025923	Bacteria	5301
233	Ga0207681_10028238	3300025923	Bacteria	3633
234	Ga0207694_10026082	3300025924	Bacteria	4444
235	Ga0207650_10004032	3300025925	Bacteria	10044
236	Ga0207650_10009529	3300025925	Bacteria	6637
237	Ga0207650_10066335	3300025925	Bacteria	2706
238	Ga0207659_10002382	3300025926	Bacteria	11196
239	Ga0207644_10001974	3300025931	Bacteria	13260
240	Ga0207644_10041972	3300025931	Bacteria	3239
241	Ga0207644_10051954	3300025931	Bacteria	2944
242	Ga0207644_10096765	3300025931	Bacteria	2210
243	Ga0207690_10001103	3300025932	Bacteria	17214
244	Ga0207706_10001856	3300025933	Bacteria	20689
245	Ga0207706_10005010	3300025933	Bacteria	12370
246	Ga0207706_10005382	3300025933	Bacteria	11930
247	Ga0207706_10013469	3300025933	Bacteria	7431
248	Ga0207706_10043591	3300025933	Bacteria	3975
249	Ga0207706_10082354	3300025933	Bacteria	2828
250	Ga0207709_10000556	3300025935	Bacteria	31885
251	Ga0207709_10035232	3300025935	Bacteria	2957
252	Ga0207709_10041145	3300025935	Bacteria	2772
253	Ga0207670_10029647	3300025936	Bacteria	3488
254	Ga0207669_10002106	3300025937	Bacteria	8436
255	Ga0207669_10020351	3300025937	Bacteria	3478
256	Ga0207669_10029640	3300025937	Bacteria	3029
257	Ga0207704_10076082	3300025938	Bacteria	2149
258	Ga0207691_10004533	3300025940	Bacteria	13439
259	Ga0207691_10032636	3300025940	Bacteria	4854
260	Ga0207691_10036329	3300025940	Bacteria	4564
261	Ga0207691_10037652	3300025940	Bacteria	4479
262	Ga0207691_10042459	3300025940	Bacteria	4192
263	Ga0207691_10066379	3300025940	Bacteria	3264
264	Ga0207711_10054939	3300025941	Bacteria	3418
265	Ga0207711_10057147	3300025941	Bacteria	3354
266	Ga0207689_10003643	3300025942	Bacteria	14068
267	Ga0207689_10008045	3300025942	Bacteria	9202
268	Ga0207689_10014268	3300025942	Bacteria	6761
269	Ga0207689_10111830	3300025942	Bacteria	2245
270	Ga0207679_10000368	3300025945	Bacteria	32625
271	Ga0207667_10043068	3300025949	Bacteria	4792
272	Ga0207651_10011398	3300025960	Bacteria	4977
273	Ga0207651_10022117	3300025960	Bacteria	3880
274	Ga0207651_10030102	3300025960	Bacteria	3451
275	Ga0207712_10045536	3300025961	Bacteria	3038
276	Ga0207668_10022010	3300025972	Bacteria	4073
277	Ga0207640_10043990	3300025981	Bacteria	2858
278	Ga0207658_10002328	3300025986	Bacteria	13956
279	Ga0207658_10006006	3300025986	Bacteria	8293
280	Ga0207658_10176227	3300025986	Bacteria	1766
281	Ga0207677_10001461	3300026023	Bacteria	12514
282	Ga0207677_10036367	3300026023	Bacteria	3209
283	Ga0207703_10005642	3300026035	Bacteria	10052
284	Ga0207703_10021237	3300026035	Bacteria	5082
285	Ga0207678_10000500	3300026067	Bacteria	35694
286	Ga0207678_10041215	3300026067	Bacteria	4003
287	Ga0207678_10066410	3300026067	Bacteria	3098
288	Ga0207702_10102075	3300026078	Bacteria	2534
289	Ga0207641_10004758	3300026088	Bacteria	11701
290	Ga0207641_10006760	3300026088	Bacteria	9611
291	Ga0207641_10022505	3300026088	Bacteria	5186
292	Ga0207648_10000146	3300026089	Bacteria	70573
293	Ga0207648_10001822	3300026089	Bacteria	23296
294	Ga0207648_10003244	3300026089	Bacteria	17114
295	Ga0207648_10006202	3300026089	Bacteria	11909
296	Ga0207648_10007954	3300026089	Bacteria	10341
297	Ga0207648_10021691	3300026089	Bacteria	5771
298	Ga0207648_10038704	3300026089	Bacteria	4195
299	Ga0207648_10063471	3300026089	Bacteria	3219
300	Ga0207676_10001778	3300026095	Bacteria	15798
301	Ga0207676_10028868	3300026095	Bacteria	4149
302	Ga0207676_10043745	3300026095	Bacteria	3450
303	Ga0207674_10010215	3300026116	Bacteria	10663
304	Ga0207675_100000857	3300026118	Bacteria	30347
305	Ga0207675_100009279	3300026118	Bacteria	9227
306	Ga0207675_100024784	3300026118	Bacteria	5582
307	Ga0207675_100060605	3300026118	Bacteria	3533
308	Ga0207675_100280373	3300026118	Bacteria	1619
309	Ga0207683_10006427	3300026121	Bacteria	10062
310	Ga0207683_10022397	3300026121	Bacteria	5423
311	Ga0207683_10055659	3300026121	Bacteria	3469
312	Ga0207683_10096691	3300026121	Bacteria	2633
313	Ga0207683_10236997	3300026121	Bacteria	1664
314	Ga0207698_10181333	3300026142	Bacteria	1865
315	Ga0207698_10272564	3300026142	Bacteria	1561
316	Ga0207698_10293212	3300026142	Bacteria	1510
317	Ga0209281_1000042	3300027111	Bacteria	344748
318	Ga0209389_1041446	3300027296	Bacteria	3518
319	Ga0209981_1003831	3300027378	Bacteria	1959
320	Ga0209995_1009364	3300027471	Bacteria	1583
321	Ga0209968_1008527	3300027526	Bacteria	1563
322	Ga0209999_1008398	3300027543	Bacteria	1861
323	Ga0209966_1000001	3300027695	Bacteria	139125
324	Ga0209974_10005133	3300027876	Bacteria	4625
325	Ga0268266_10236896	3300028379	Bacteria	1683
326	Ga0268265_10014338	3300028380	Bacteria	5398
327	Ga0268265_10033535	3300028380	Bacteria	3734
328	Ga0268264_10004254	3300028381	Bacteria	12219
329	Ga0268264_10102230	3300028381	Bacteria	2494
330	Ga0307517_10000805	3300028786	Bacteria	53822
331	Ga0307515_10000020	3300028794	Bacteria	411735
332	Ga0307515_10000053	3300028794	Bacteria	266512
333	Ga0307515_10001342	3300028794	Bacteria	55698
334	Ga0307515_10002612	3300028794	Bacteria	38796
335	Ga0307515_10005265	3300028794	Bacteria	26299
336	Ga0307515_10009508	3300028794	Bacteria	18788
337	Ga0307515_10013171	3300028794	Bacteria	15473
338	Ga0307515_10031150	3300028794	Bacteria	8906
339	Ga0307515_10121128	3300028794	Bacteria	2962
340	Ga0307515_10156505	3300028794	Bacteria	2349
341	Ga0307512_10023178	3300030522	Bacteria	5552
342	Ga0307512_10053074	3300030522	Bacteria	3227
343	Ga0265328_10003934	3300031239	Bacteria	6533
344	Ga0265327_10000158	3300031251	Bacteria	145905
345	Ga0265327_10000355	3300031251	Bacteria	87181
346	Ga0265316_10000026	3300031344	Bacteria	165508
347	Ga0307513_10032738	3300031456	Bacteria	5856
348	Ga0307509_10002654	3300031507	Bacteria	28588
349	Ga0307509_10006788	3300031507	Bacteria	15234
350	Ga0307509_10010188	3300031507	Bacteria	11562
351	Ga0307509_10012003	3300031507	Bacteria	10403
352	Ga0307509_10023532	3300031507	Bacteria	6913
353	Ga0307408_100000150	3300031548	Bacteria	77682
354	Ga0307508_10000004	3300031616	Bacteria	287547
355	Ga0307508_10000078	3300031616	Bacteria	113416
356	Ga0307508_10003819	3300031616	Bacteria	15025
357	Ga0307514_10003397	3300031649	Bacteria	15360
358	Ga0307514_10041889	3300031649	Bacteria	3604
359	Ga0307514_10105240	3300031649	Bacteria	2016
360	Ga0307516_10000426	3300031730	Bacteria	55262
361	Ga0307516_10001023	3300031730	Bacteria	38802
362	Ga0307516_10007358	3300031730	Bacteria	12672
363	Ga0307410_10010512	3300031852	Bacteria	5248
364	Ga0307409_100000086	3300031995	Bacteria	33256
365	Ga0307416_100008651	3300032002	Bacteria	6589
366	Ga0307416_100415572	3300032002	Bacteria	1387
367	Ga0307414_10029622	3300032004	Bacteria	3565
368	Ga0307414_10159932	3300032004	Bacteria	1788
369	Ga0307411_10000910	3300032005	Bacteria	11236
370	Ga0307415_100000361	3300032126	Bacteria	19367
371	Ga0307507_10083368	3300033179	Bacteria	2796
372	Ga0307510_10028856	3300033180	Bacteria	6329
373	Ga0307510_10098931	3300033180	Bacteria	2718
374	Ga0373929_0010677	3300035085	Bacteria	1720
375	Ga0373932_0007674	3300035112	Bacteria	2574
376	Ga0373960_0002906	3300035121	Bacteria	3873
377	Ga0373931_0000200	3300035691	Bacteria	25528
378	Ga0373931_0006552	3300035691	Bacteria	5445
379	Ga0373937_0102105	3300036401	Bacteria	2662
380	Ga0373925_0002396	3300037068	Bacteria	15029
381	Ga0373925_0029184	3300037068	Bacteria	4046
382	Ga0395900_0000109	3300037418	Bacteria	146053
383	Ga0395898_0000868	3300037466	Bacteria	49428
384	Ga0395905_0000488	3300037471	Bacteria	54703
385	Ga0395905_0002212	3300037471	Bacteria	21946
386	Ga0395905_0004339	3300037471	Bacteria	14769
387	Ga0395905_0031352	3300037471	Bacteria	5004
388	Ga0395905_0067555	3300037471	Bacteria	3348
389	Ga0395905_0120402	3300037471	Bacteria	2467
390	Ga0395905_0158189	3300037471	Bacteria	2130
391	Ga0436361_0010737	3300039447	Bacteria	3021
392	Ga0436361_0167979	3300039447	Bacteria	86419
393	Ga0436361_0217332	3300039447	Bacteria	23737
394	Ga0436361_0236342	3300039447	Bacteria	16847
395	Ga0436361_0359670	3300039447	Bacteria	47250
396	Ga0451795_0104790	3300041456	Bacteria	1498
397	Ga0451802_0223057	3300041460	Bacteria	1412
398	Ga0451802_0427285	3300041460	Bacteria	1874
399	Ga0439449_0010362	3300042007	Bacteria	3519
400	Ga0450888_001209	3300042126	Bacteria	2467
401	Ga0450891_000220	3300042129	Bacteria	5753
402	Ga0450889_000187	3300042144	Bacteria	6760
403	Ga0439459_0001185	3300042438	Bacteria	3795
404	Ga0450893_0002556	3300042532	Bacteria	2842
405	Ga0451577_0000714	3300042876	Bacteria	51609
406	Ga0451577_0002068	3300042876	Bacteria	24786
407	Ga0466969_0000395	3300044656	Bacteria	23961
408	Ga0466972_0006534	3300044658	Bacteria	5858
409	Ga0453683_0099818	3300044673	Bacteria	1823
410	Ga0466966_0005482	3300044684	Bacteria	8338
411	Ga0466961_0058174	3300044693	Bacteria	2459
412	Ga0466963_0019955	3300044694	Bacteria	4211
413	Ga0466964_0006962	3300044706	Bacteria	4226
414	Ga0453684_0012158	3300044712	Bacteria	14280
415	Ga0453684_0024040	3300044712	Bacteria	8932
416	Ga0466971_0040111	3300044719	Bacteria	2102
417	Ga0466968_0028027	3300044735	Bacteria	2320
418	Ga0466970_0030505	3300044765	Bacteria	2843
419	Ga0466957_0016859	3300044842	Bacteria	4274
420	Ga0466960_0030629	3300044901	Bacteria	2477
421	Ga0466959_0012699	3300045049	Bacteria	6092
422	Ga0451576_0027382	3300045051	Bacteria	6122
423	Ga0451576_0095936	3300045051	Bacteria	3084
424	Ga0451576_0142279	3300045051	Bacteria	2501
425	Ga0466967_0067943	3300045976	Bacteria	3180
426	Ga0495592_0000028	3300046454	Bacteria	132590
427	Ga0495590_0003270	3300046457	Bacteria	6627
428	Ga0495629_0106894	3300046459	Bacteria	1952
429	Ga0495610_0062598	3300046512	Bacteria	1764
430	Ga0495632_0006432	3300046519	Bacteria	7554
431	Ga0495586_0063814	3300046535	Bacteria	2007
432	Ga0495597_0051548	3300046542	Bacteria	1814
433	Ga0495625_0010038	3300046660	Bacteria	7870
434	Ga0495625_0135339	3300046660	Bacteria	1666
435	Ga0495658_0021737	3300046683	Bacteria	3386
436	Ga0495658_0060734	3300046683	Bacteria	2168
437	Ga0495649_0015414	3300046694	Bacteria	4351
438	Ga0495687_000599	3300047443	Bacteria	42066
439	Ga0495687_010824	3300047443	Bacteria	4960
440	Ga0496102_0077689	3300048905	Bacteria	3055
441	Ga0496102_0106330	3300048905	Bacteria	2611
442	Ga0496104_0166058	3300048907	Bacteria	2117
443	Ga0496105_0066137	3300048908	Bacteria	2984
444	Ga0496105_0252901	3300048908	Bacteria	1427
445	Ga0496107_0027976	3300048910	Bacteria	4005
446	Ga0496108_0024028	3300048911	Bacteria	5018
447	Ga0496108_0029716	3300048911	Bacteria	4528
448	Ga0496109_0008335	3300048912	Bacteria	8802
449	Ga0496109_0116384	3300048912	Bacteria	2488
450	Ga0496110_0032221	3300048913	Bacteria	4525
451	Ga0496110_0238283	3300048913	Bacteria	1655
452	Ga0496111_0041819	3300048914	Bacteria	3290
453	Ga0496112_0018147	3300048915	Bacteria	6621
454	Ga0496113_0099134	3300048916	Bacteria	2256
455	Ga0496115_0011501	3300048918	Bacteria	6636
456	Ga0496124_0002660	3300048927	Bacteria	22924
457	Ga0496124_0186622	3300048927	Bacteria	1591
458	Ga0496125_0005283	3300048928	Bacteria	14458
459	Ga0501298_002673	3300049521	Bacteria	2717
460	Ga0501300_006322	3300049523	Bacteria	1745
461	Ga0501312_006826	3300049528	Bacteria	1440
462	Ga0501315_003622	3300049531	Bacteria	1558
463	Ga0501034_0072235	3300049571	Bacteria	3459
464	Ga0501043_0000023	3300049579	Bacteria	154331
465	Ga0501046_0000018	3300049580	Bacteria	220589
466	Ga0501047_0000020	3300049581	Bacteria	259377
467	Ga0501048_0001064	3300049582	Bacteria	20552
468	Ga0501198_000006	3300049649	Bacteria	129954
469	Ga0501211_001337	3300049658	Bacteria	2633
470	Ga0501222_000007	3300049662	Bacteria	126703
471	Ga0501222_000386	3300049662	Bacteria	6737
472	Ga0501227_004808	3300049665	Bacteria	2896
473	Ga0501258_002313	3300049687	Bacteria	1659
474	Ga0501221_002674	3300049704	Bacteria	2933
475	Ga0501229_001195	3300049706	Bacteria	3020
476	Ga0501272_000443	3300049769	Bacteria	3617
477	Ga0501280_006884	3300049776	Bacteria	1597
478	nmdc:mga03n38_25646_c1	3300050490	Bacteria	2424
479	nmdc:mga03n38_52504_c1	3300050490	Bacteria	1825
480	nmdc:mga0k408_10031_c1	3300050493	Bacteria	5115
481	nmdc:mga0k408_106292_c1	3300050493	Bacteria	1658
482	nmdc:mga0k408_1409_c1	3300050493	Bacteria	3503
483	nmdc:mga0k408_184_c1	3300050493	Bacteria	32850
484	nmdc:mga0k408_203_c2	3300050493	Bacteria	31214
485	nmdc:mga0k408_21076_c1	3300050493	Bacteria	3657
486	nmdc:mga0k408_2607_c1	3300050493	Bacteria	9575
487	nmdc:mga0k408_431_c1	3300050493	Bacteria	14862
488	nmdc:mga0k408_4791_c1	3300050493	Bacteria	7176
489	nmdc:mga06z11_91536_c1	3300050494	Bacteria	1652
490	nmdc:mga07m45_1438_c1	3300050496	Bacteria	10919
491	nmdc:mga07m45_1548_c1	3300050496	Bacteria	10583
492	nmdc:mga07m45_22183_c1	3300050496	Bacteria	3465
493	nmdc:mga07m45_222_c1	3300050496	Bacteria	22600
494	nmdc:mga07m45_3927_c2	3300050496	Bacteria	6505
495	nmdc:mga07m45_4604_c1	3300050496	Bacteria	6759
496	nmdc:mga07m45_48954_c1	3300050496	Bacteria	2378
497	nmdc:mga07m45_63_c1	3300050496	Bacteria	41859
498	nmdc:mga07m45_89_c1	3300050496	Bacteria	34943
499	Ga0500578_0002162	3300053086	Bacteria	17242
500	Ga0500644_0019251	3300053088	Bacteria	2012
501	Ga0500593_000236	3300053117	Bacteria	22651
502	Ga0500652_000307	3300053131	Bacteria	17714
503	Ga0500559_0000191	3300053136	Bacteria	49243
504	Ga0500568_0007902	3300053139	Bacteria	5177
505	Ga0500568_0028524	3300053139	Bacteria	2326
506	Ga0500619_000076	3300053154	Bacteria	27517
507	Ga0500622_0000160	3300053156	Bacteria	70774
508	Ga0500622_0001454	3300053156	Bacteria	18928
509	Ga0500622_0001554	3300053156	Bacteria	18138
510	Ga0500570_031871	3300053724	Bacteria	2841
511	Ga0500645_005872	3300053730	Bacteria	4454
512	Ga0590071_006056	3300059421	Bacteria	2890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300011119	Ga0105246_10167667	Ga0105246_101676672	401
2	3300005262	Ga0065165_1000652	Ga0065165_100065234	403
3	3300031344	Ga0265316_10000026	Ga0265316_1000002610	404
4	iso_pu_bacteria	2643221660	2644341260	408
5	3300046512	Ga0495610_0062598	Ga0495610_0062598_381_1619	410
6	3300005355	Ga0070671_100061141	Ga0070671_1000611412	412
7	3300009148	Ga0105243_10135554	Ga0105243_101355541	412
8	3300009177	Ga0105248_10000445	Ga0105248_1000044534	412
9	3300025931	Ga0207644_10041972	Ga0207644_100419722	412
10	3300025941	Ga0207711_10057147	Ga0207711_100571472	412
11	3300027378	Ga0209981_1003831	Ga0209981_10038312	412
12	3300027471	Ga0209995_1009364	Ga0209995_10093641	412
13	3300027526	Ga0209968_1008527	Ga0209968_10085271	412
14	3300027543	Ga0209999_1008398	Ga0209999_10083981	412
15	3300027695	Ga0209966_1000001	Ga0209966_100000134	412
16	3300031239	Ga0265328_10003934	Ga0265328_100039344	412
17	3300031251	Ga0265327_10000158	Ga0265327_1000015859	412
18	3300031730	Ga0307516_10000426	Ga0307516_1000042630	412
19	3300037471	Ga0395905_0000488	Ga0395905_0000488_49971_51227	412
20	3300041460	Ga0451802_0427285	Ga0451802_0427285_534_1778	412
21	3300048907	Ga0496104_0166058	Ga0496104_0166058_385_1626	412
22	3300048908	Ga0496105_0252901	Ga0496105_0252901_143_1384	412
23	3300048911	Ga0496108_0029716	Ga0496108_0029716_2432_3673	412
24	3300048912	Ga0496109_0116384	Ga0496109_0116384_1233_2474	412
25	3300048913	Ga0496110_0238283	Ga0496110_0238283_371_1627	412
26	3300048915	Ga0496112_0018147	Ga0496112_0018147_3140_4381	412
27	3300049571	Ga0501034_0072235	Ga0501034_0072235_1719_2981	412
28	3300059421	Ga0590071_006056	Ga0590071_006056_1493_2737	412
29	3300003791	Ga0055530_10007232	Ga0055530_100072326	413
30	3300003792	Ga0055540_1000002	Ga0055540_1000002311	413
31	3300025298	Ga0209050_1000651	Ga0209050_100065127	413
32	3300025303	Ga0209051_1000024	Ga0209051_1000024313	413
33	3300025920	Ga0207649_10163289	Ga0207649_101632891	413
34	3300031730	Ga0307516_10001023	Ga0307516_1000102334	413
35	3300005353	Ga0070669_100022631	Ga0070669_1000226312	414
36	3300005719	Ga0068861_100000582	Ga0068861_10000058213	414
37	3300005843	Ga0068860_100001910	Ga0068860_1000019106	414
38	3300006881	Ga0068865_100001694	Ga0068865_1000016943	414
39	3300013306	Ga0163162_10002211	Ga0163162_1000221114	414
40	3300025923	Ga0207681_10012181	Ga0207681_100121813	414
41	3300025938	Ga0207704_10076082	Ga0207704_100760823	414
42	3300026118	Ga0207675_100009279	Ga0207675_10000927913	414
43	3300028380	Ga0268265_10014338	Ga0268265_100143382	414
44	3300028381	Ga0268264_10004254	Ga0268264_100042542	414
45	3300028794	Ga0307515_10002612	Ga0307515_1000261211	414
46	3300033179	Ga0307507_10083368	Ga0307507_100833684	414
47	3300006195	Ga0075366_10006399	Ga0075366_100063993	415
48	3300021361	Ga0213872_10000172	Ga0213872_1000017240	415
49	3300028794	Ga0307515_10000020	Ga0307515_10000020327	415
50	3300028794	Ga0307515_10000053	Ga0307515_10000053126	415
51	3300028794	Ga0307515_10121128	Ga0307515_101211282	415
52	3300039447	Ga0436361_0217332	Ga0436361_0217332_2048_3355	415
53	3300044901	Ga0466960_0030629	Ga0466960_0030629_851_2170	415
54	3300046535	Ga0495586_0063814	Ga0495586_0063814_428_1735	415
55	3300046683	Ga0495658_0060734	Ga0495658_0060734_418_1725	415
56	3300050493	nmdc:mga0k408_4791_c1	nmdc:mga0k408_4791_c1_2570_3889	415
57	3300035112	Ga0373932_0007674	Ga0373932_0007674_1248_2558	416
58	3300037471	Ga0395905_0031352	Ga0395905_0031352_1215_2528	416
59	3300053730	Ga0500645_005872	Ga0500645_005872_471_1832	416
60	3300005367	Ga0070667_100007382	Ga0070667_1000073823	417
61	3300005455	Ga0070663_100054226	Ga0070663_1000542263	417
62	3300005459	Ga0068867_100002456	Ga0068867_1000024565	417
63	3300006195	Ga0075366_10041887	Ga0075366_100418872	417
64	3300006353	Ga0075370_10045620	Ga0075370_100456202	417
65	3300014968	Ga0157379_10054003	Ga0157379_100540034	417
66	3300025986	Ga0207658_10006006	Ga0207658_100060065	417
67	3300026067	Ga0207678_10066410	Ga0207678_100664102	417
68	3300026089	Ga0207648_10001822	Ga0207648_100018227	417
69	3300031507	Ga0307509_10002654	Ga0307509_1000265419	417
70	3300031507	Ga0307509_10006788	Ga0307509_1000678815	417
71	3300045051	Ga0451576_0095936	Ga0451576_0095936_950_2269	417
72	3300046660	Ga0495625_0010038	Ga0495625_0010038_6335_7654	417
73	3300050496	nmdc:mga07m45_222_c1	nmdc:mga07m45_222_c1_9749_11074	417
74	3300053117	Ga0500593_000236	Ga0500593_000236_20644_21963	417
75	3300053139	Ga0500568_0028524	Ga0500568_0028524_706_2055	417
76	3300013297	Ga0157378_10000558	Ga0157378_1000055826	418
77	3300030522	Ga0307512_10053074	Ga0307512_100530742	418
78	3300031616	Ga0307508_10000004	Ga0307508_1000000494	418
79	3300031616	Ga0307508_10000078	Ga0307508_1000007817	418
80	3300031649	Ga0307514_10105240	Ga0307514_101052402	418
81	3300042876	Ga0451577_0002068	Ga0451577_0002068_1915_3201	418
82	3300048927	Ga0496124_0186622	Ga0496124_0186622_108_1439	418
83	3300028786	Ga0307517_10000805	Ga0307517_1000080517	419
84	3300028794	Ga0307515_10001342	Ga0307515_1000134223	419
85	3300028794	Ga0307515_10009508	Ga0307515_1000950822	419
86	3300031616	Ga0307508_10003819	Ga0307508_1000381913	419
87	3300031649	Ga0307514_10041889	Ga0307514_100418892	419
88	3300033180	Ga0307510_10098931	Ga0307510_100989313	419
89	3300053088	Ga0500644_0019251	Ga0500644_0019251_173_1483	419
90	3300053131	Ga0500652_000307	Ga0500652_000307_3240_4547	419
91	3300053136	Ga0500559_0000191	Ga0500559_0000191_27047_28357	419
92	3300053156	Ga0500622_0001454	Ga0500622_0001454_13079_14389	419
93	3300053724	Ga0500570_031871	Ga0500570_031871_582_1889	419
94	iso_pu_bacteria	2643221544	2643745489	419
95	3300003775	Ga0055524_1008226	Ga0055524_10082262	420
96	3300003794	Ga0055531_10000078	Ga0055531_1000007885	420
97	3300003794	Ga0055531_10011352	Ga0055531_100113522	420
98	3300006195	Ga0075366_10013243	Ga0075366_100132432	420
99	3300006353	Ga0075370_10003217	Ga0075370_100032177	420
100	3300012497	Ga0157319_1000006	Ga0157319_100000621	420
101	3300025299	Ga0209256_1001979	Ga0209256_10019792	420
102	3300025299	Ga0209256_1005905	Ga0209256_10059055	420
103	3300025303	Ga0209051_1003875	Ga0209051_10038755	420
104	3300025304	Ga0209257_1000032	Ga0209257_1000032271	420
105	3300025304	Ga0209257_1009881	Ga0209257_10098812	420
106	3300030522	Ga0307512_10023178	Ga0307512_100231782	420
107	3300031507	Ga0307509_10010188	Ga0307509_1001018811	420
108	3300031649	Ga0307514_10003397	Ga0307514_1000339715	420
109	3300033180	Ga0307510_10028856	Ga0307510_100288563	420
110	3300035121	Ga0373960_0002906	Ga0373960_0002906_2406_3737	420
111	3300035691	Ga0373931_0000200	Ga0373931_0000200_1026_2357	420
112	3300042438	Ga0439459_0001185	Ga0439459_0001185_1199_2515	420
113	3300045051	Ga0451576_0142279	Ga0451576_0142279_486_1814	420
114	3300046454	Ga0495592_0000028	Ga0495592_0000028_5679_6989	420
115	3300050496	nmdc:mga07m45_1438_c1	nmdc:mga07m45_1438_c1_6771_8087	420
116	3300005459	Ga0068867_100036779	Ga0068867_1000367792	421
117	3300005616	Ga0068852_100024044	Ga0068852_1000240444	421
118	3300006195	Ga0075366_10045951	Ga0075366_100459512	421
119	3300006195	Ga0075366_10056956	Ga0075366_100569562	421
120	3300006195	Ga0075366_10109945	Ga0075366_101099452	421
121	3300006353	Ga0075370_10007514	Ga0075370_100075144	421
122	3300028794	Ga0307515_10156505	Ga0307515_101565052	421
123	3300031507	Ga0307509_10012003	Ga0307509_100120033	421
124	3300031548	Ga0307408_100000150	Ga0307408_10000015024	421
125	3300036401	Ga0373937_0102105	Ga0373937_0102105_522_1814	421
126	3300037418	Ga0395900_0000109	Ga0395900_0000109_116100_117572	421
127	3300037466	Ga0395898_0000868	Ga0395898_0000868_6961_8433	421
128	3300044712	Ga0453684_0024040	Ga0453684_0024040_6085_7362	421
129	3300044735	Ga0466968_0028027	Ga0466968_0028027_275_1564	421
130	3300049523	Ga0501300_006322	Ga0501300_006322_255_1574	421
131	3300049658	Ga0501211_001337	Ga0501211_001337_414_1733	421
132	3300049662	Ga0501222_000386	Ga0501222_000386_4700_6019	421
133	3300049687	Ga0501258_002313	Ga0501258_002313_38_1357	421
134	3300049704	Ga0501221_002674	Ga0501221_002674_1001_2320	421
135	3300049706	Ga0501229_001195	Ga0501229_001195_1135_2454	421
136	3300049769	Ga0501272_000443	Ga0501272_000443_1667_2986	421
137	3300050496	nmdc:mga07m45_48954_c1	nmdc:mga07m45_48954_c1_743_2086	421
138	iso_pu_bacteria	2643221585	2643935889	421
139	iso_pu_bacteria	2643221639	2644221350	421
140	iso_pu_bacteria	2643221646	2644257892	421
141	iso_pu_bacteria	2643221656	2644317672	421
142	iso_pu_bacteria	2886848708	2886852124	421
143	3300003759	Ga0055525_1000011	Ga0055525_100001129	422
144	3300005328	Ga0070676_10015489	Ga0070676_100154892	422
145	3300005330	Ga0070690_100005597	Ga0070690_1000055972	422
146	3300005331	Ga0070670_100050668	Ga0070670_1000506685	422
147	3300005331	Ga0070670_100129638	Ga0070670_1001296382	422
148	3300005334	Ga0068869_100001634	Ga0068869_10000163413	422
149	3300005334	Ga0068869_100005104	Ga0068869_1000051047	422
150	3300005335	Ga0070666_10012274	Ga0070666_100122744	422
151	3300005336	Ga0070680_100006075	Ga0070680_1000060752	422
152	3300005338	Ga0068868_100015324	Ga0068868_1000153245	422
153	3300005339	Ga0070660_100139159	Ga0070660_1001391592	422
154	3300005344	Ga0070661_100052423	Ga0070661_1000524232	422
155	3300005347	Ga0070668_100038093	Ga0070668_1000380933	422
156	3300005353	Ga0070669_100001839	Ga0070669_1000018398	422
157	3300005354	Ga0070675_100050288	Ga0070675_1000502883	422
158	3300005355	Ga0070671_100092653	Ga0070671_1000926532	422
159	3300005356	Ga0070674_100110614	Ga0070674_1001106142	422
160	3300005364	Ga0070673_100025175	Ga0070673_1000251753	422
161	3300005367	Ga0070667_100031167	Ga0070667_1000311673	422
162	3300005455	Ga0070663_100039977	Ga0070663_1000399772	422
163	3300005456	Ga0070678_100009020	Ga0070678_1000090203	422
164	3300005456	Ga0070678_100052302	Ga0070678_1000523022	422
165	3300005457	Ga0070662_100004955	Ga0070662_1000049553	422
166	3300005457	Ga0070662_100031821	Ga0070662_1000318213	422
167	3300005457	Ga0070662_100131400	Ga0070662_1001314002	422
168	3300005459	Ga0068867_100002069	Ga0068867_1000020699	422
169	3300005530	Ga0070679_100006077	Ga0070679_1000060773	422
170	3300005535	Ga0070684_100012112	Ga0070684_1000121127	422
171	3300005539	Ga0068853_100047115	Ga0068853_1000471153	422
172	3300005543	Ga0070672_100019914	Ga0070672_1000199143	422
173	3300005543	Ga0070672_100031886	Ga0070672_1000318865	422
174	3300005543	Ga0070672_100076002	Ga0070672_1000760023	422
175	3300005564	Ga0070664_100034357	Ga0070664_1000343572	422
176	3300005564	Ga0070664_100250332	Ga0070664_1002503322	422
177	3300005614	Ga0068856_100079423	Ga0068856_1000794234	422
178	3300005616	Ga0068852_100074839	Ga0068852_1000748393	422
179	3300005616	Ga0068852_100150393	Ga0068852_1001503933	422
180	3300005618	Ga0068864_100019471	Ga0068864_1000194715	422
181	3300005618	Ga0068864_100087450	Ga0068864_1000874503	422
182	3300005618	Ga0068864_100122424	Ga0068864_1001224243	422
183	3300005719	Ga0068861_100000677	Ga0068861_10000067712	422
184	3300005834	Ga0068851_10075514	Ga0068851_100755142	422
185	3300005842	Ga0068858_100045840	Ga0068858_1000458403	422
186	3300005843	Ga0068860_100015787	Ga0068860_1000157875	422
187	3300005843	Ga0068860_100042020	Ga0068860_1000420202	422
188	3300005843	Ga0068860_100167938	Ga0068860_1001679382	422
189	3300006353	Ga0075370_10001135	Ga0075370_100011353	422
190	3300006358	Ga0068871_100037531	Ga0068871_1000375314	422
191	3300006881	Ga0068865_100021263	Ga0068865_1000212633	422
192	3300009177	Ga0105248_10055246	Ga0105248_100552462	422
193	3300009177	Ga0105248_10312223	Ga0105248_103122232	422
194	3300009551	Ga0105238_10082689	Ga0105238_100826892	422
195	3300009553	Ga0105249_10034913	Ga0105249_100349134	422
196	3300013100	Ga0157373_10059192	Ga0157373_100591922	422
197	3300013296	Ga0157374_10045052	Ga0157374_100450523	422
198	3300013306	Ga0163162_10034195	Ga0163162_100341954	422
199	3300013306	Ga0163162_10076955	Ga0163162_100769553	422
200	3300013307	Ga0157372_10013601	Ga0157372_100136012	422
201	3300013308	Ga0157375_10012805	Ga0157375_100128055	422
202	3300014326	Ga0157380_10037794	Ga0157380_100377941	422
203	3300014326	Ga0157380_10159830	Ga0157380_101598302	422
204	3300014968	Ga0157379_10035744	Ga0157379_100357443	422
205	3300014969	Ga0157376_10014738	Ga0157376_100147382	422
206	3300017792	Ga0163161_10049300	Ga0163161_100493003	422
207	3300021361	Ga0213872_10000043	Ga0213872_10000043102	422
208	3300025230	Ga0209563_100005	Ga0209563_100005354	422
209	3300025295	Ga0209564_1000003	Ga0209564_10000031244	422
210	3300025321	Ga0207656_10015015	Ga0207656_100150153	422
211	3300025321	Ga0207656_10028511	Ga0207656_100285112	422
212	3300025893	Ga0207682_10014037	Ga0207682_100140372	422
213	3300025907	Ga0207645_10003308	Ga0207645_1000330811	422
214	3300025907	Ga0207645_10003470	Ga0207645_1000347013	422
215	3300025907	Ga0207645_10007379	Ga0207645_100073795	422
216	3300025909	Ga0207705_10057122	Ga0207705_100571222	422
217	3300025914	Ga0207671_10232853	Ga0207671_102328532	422
218	3300025917	Ga0207660_10138453	Ga0207660_101384532	422
219	3300025919	Ga0207657_10061574	Ga0207657_100615744	422
220	3300025920	Ga0207649_10026350	Ga0207649_100263502	422
221	3300025921	Ga0207652_10020904	Ga0207652_100209043	422
222	3300025925	Ga0207650_10009529	Ga0207650_100095291	422
223	3300025925	Ga0207650_10066335	Ga0207650_100663351	422
224	3300025931	Ga0207644_10001974	Ga0207644_100019742	422
225	3300025931	Ga0207644_10051954	Ga0207644_100519542	422
226	3300025933	Ga0207706_10005010	Ga0207706_1000501011	422
227	3300025933	Ga0207706_10005382	Ga0207706_1000538212	422
228	3300025933	Ga0207706_10082354	Ga0207706_100823542	422
229	3300025937	Ga0207669_10029640	Ga0207669_100296402	422
230	3300025940	Ga0207691_10032636	Ga0207691_100326364	422
231	3300025940	Ga0207691_10036329	Ga0207691_100363295	422
232	3300025940	Ga0207691_10037652	Ga0207691_100376523	422
233	3300025941	Ga0207711_10054939	Ga0207711_100549392	422
234	3300025942	Ga0207689_10003643	Ga0207689_100036433	422
235	3300025942	Ga0207689_10008045	Ga0207689_100080457	422
236	3300025949	Ga0207667_10043068	Ga0207667_100430682	422
237	3300025960	Ga0207651_10022117	Ga0207651_100221173	422
238	3300025961	Ga0207712_10045536	Ga0207712_100455362	422
239	3300025972	Ga0207668_10022010	Ga0207668_100220103	422
240	3300025981	Ga0207640_10043990	Ga0207640_100439902	422
241	3300025986	Ga0207658_10002328	Ga0207658_100023286	422
242	3300026023	Ga0207677_10001461	Ga0207677_1000146112	422
243	3300026035	Ga0207703_10021237	Ga0207703_100212373	422
244	3300026067	Ga0207678_10041215	Ga0207678_100412153	422
245	3300026078	Ga0207702_10102075	Ga0207702_101020752	422
246	3300026088	Ga0207641_10022505	Ga0207641_100225053	422
247	3300026089	Ga0207648_10007954	Ga0207648_100079543	422
248	3300026089	Ga0207648_10021691	Ga0207648_100216911	422
249	3300026095	Ga0207676_10028868	Ga0207676_100288683	422
250	3300026095	Ga0207676_10043745	Ga0207676_100437453	422
251	3300026118	Ga0207675_100000857	Ga0207675_10000085723	422
252	3300026118	Ga0207675_100060605	Ga0207675_1000606051	422
253	3300026121	Ga0207683_10055659	Ga0207683_100556592	422
254	3300026121	Ga0207683_10096691	Ga0207683_100966912	422
255	3300026121	Ga0207683_10236997	Ga0207683_102369972	422
256	3300026142	Ga0207698_10181333	Ga0207698_101813332	422
257	3300026142	Ga0207698_10293212	Ga0207698_102932121	422
258	3300028379	Ga0268266_10236896	Ga0268266_102368962	422
259	3300028381	Ga0268264_10102230	Ga0268264_101022302	422
260	3300031251	Ga0265327_10000355	Ga0265327_1000035525	422
261	3300031995	Ga0307409_100000086	Ga0307409_10000008619	422
262	3300032002	Ga0307416_100008651	Ga0307416_1000086513	422
263	3300032004	Ga0307414_10159932	Ga0307414_101599322	422
264	3300032126	Ga0307415_100000361	Ga0307415_10000036115	422
265	3300035085	Ga0373929_0010677	Ga0373929_0010677_143_1435	422
266	3300035691	Ga0373931_0006552	Ga0373931_0006552_3274_4563	422
267	3300037068	Ga0373925_0029184	Ga0373925_0029184_1240_2568	422
268	3300037471	Ga0395905_0067555	Ga0395905_0067555_255_1565	422
269	3300039447	Ga0436361_0359670	Ga0436361_0359670_17644_18939	422
270	3300042876	Ga0451577_0000714	Ga0451577_0000714_7100_8407	422
271	3300044673	Ga0453683_0099818	Ga0453683_0099818_289_1587	422
272	3300045051	Ga0451576_0027382	Ga0451576_0027382_3137_4435	422
273	3300046459	Ga0495629_0106894	Ga0495629_0106894_491_1786	422
274	3300048905	Ga0496102_0077689	Ga0496102_0077689_516_1808	422
275	3300048908	Ga0496105_0066137	Ga0496105_0066137_1471_2763	422
276	3300048910	Ga0496107_0027976	Ga0496107_0027976_688_1980	422
277	3300048911	Ga0496108_0024028	Ga0496108_0024028_1253_2545	422
278	3300048912	Ga0496109_0008335	Ga0496109_0008335_1949_3241	422
279	3300048913	Ga0496110_0032221	Ga0496110_0032221_666_1958	422
280	3300048914	Ga0496111_0041819	Ga0496111_0041819_647_1936	422
281	3300048916	Ga0496113_0099134	Ga0496113_0099134_881_2173	422
282	3300048918	Ga0496115_0011501	Ga0496115_0011501_4759_6051	422
283	3300050496	nmdc:mga07m45_4604_c1	nmdc:mga07m45_4604_c1_4396_5706	422
284	3300053156	Ga0500622_0001554	Ga0500622_0001554_4136_5458	422
285	iso_pu_bacteria	2738541337	2739057855	422
286	3300003775	Ga0055524_1000080	Ga0055524_10000808	423
287	3300006195	Ga0075366_10009563	Ga0075366_100095632	423
288	3300006195	Ga0075366_10039868	Ga0075366_100398682	423
289	3300006195	Ga0075366_10046313	Ga0075366_100463132	423
290	3300021361	Ga0213872_10000011	Ga0213872_10000011101	423
291	3300028794	Ga0307515_10005265	Ga0307515_1000526522	423
292	3300032004	Ga0307414_10029622	Ga0307414_100296223	423
293	3300032005	Ga0307411_10000910	Ga0307411_100009103	423
294	3300037471	Ga0395905_0120402	Ga0395905_0120402_228_1526	423
295	3300039447	Ga0436361_0010737	Ga0436361_0010737_1672_2979	423
296	3300039447	Ga0436361_0167979	Ga0436361_0167979_13461_14768	423
297	3300042126	Ga0450888_001209	Ga0450888_001209_784_2088	423
298	3300042129	Ga0450891_000220	Ga0450891_000220_2294_3598	423
299	3300042144	Ga0450889_000187	Ga0450889_000187_333_1637	423
300	3300042532	Ga0450893_0002556	Ga0450893_0002556_66_1370	423
301	3300049528	Ga0501312_006826	Ga0501312_006826_75_1379	423
302	3300049531	Ga0501315_003622	Ga0501315_003622_120_1424	423
303	3300049665	Ga0501227_004808	Ga0501227_004808_1429_2733	423
304	3300049776	Ga0501280_006884	Ga0501280_006884_187_1491	423
305	3300050493	nmdc:mga0k408_21076_c1	nmdc:mga0k408_21076_c1_1900_3189	423
306	3300053154	Ga0500619_000076	Ga0500619_000076_21092_22465	423
307	iso_pu_bacteria	2831864461	2831870077	423
308	3300005459	Ga0068867_100000085	Ga0068867_10000008519	424
309	3300014745	Ga0157377_10000028	Ga0157377_1000002844	424
310	3300025299	Ga0209256_1000011	Ga0209256_1000011574	424
311	3300025935	Ga0207709_10000556	Ga0207709_1000055613	424
312	3300026089	Ga0207648_10000146	Ga0207648_1000014628	424
313	3300027876	Ga0209974_10005133	Ga0209974_100051333	424
314	3300028794	Ga0307515_10031150	Ga0307515_100311502	424
315	3300053086	Ga0500578_0002162	Ga0500578_0002162_1430_2737	424
316	3300003322	rootL2_10008667	rootL2_100086672	425
317	3300005295	Ga0065707_10081939	Ga0065707_1008193917	425
318	3300005843	Ga0068860_100039151	Ga0068860_1000391515	425
319	3300006195	Ga0075366_10055795	Ga0075366_100557952	425
320	3300009553	Ga0105249_10009940	Ga0105249_100099404	425
321	3300014968	Ga0157379_10099189	Ga0157379_100991892	425
322	3300025940	Ga0207691_10066379	Ga0207691_100663792	425
323	3300026089	Ga0207648_10038704	Ga0207648_100387044	425
324	3300026118	Ga0207675_100024784	Ga0207675_1000247843	425
325	3300032002	Ga0307416_100415572	Ga0307416_1004155721	425
326	3300046519	Ga0495632_0006432	Ga0495632_0006432_4414_5715	425
327	3300046542	Ga0495597_0051548	Ga0495597_0051548_344_1645	425
328	3300046694	Ga0495649_0015414	Ga0495649_0015414_1013_2314	425
329	3300047443	Ga0495687_010824	Ga0495687_010824_2270_3571	425
330	3300049521	Ga0501298_002673	Ga0501298_002673_893_2197	425
331	3300003794	Ga0055531_10011505	Ga0055531_100115055	426
332	3300005262	Ga0065165_1000613	Ga0065165_100061315	426
333	3300005937	Ga0081455_10052449	Ga0081455_100524493	426
334	3300006944	Ga0099823_1013693	Ga0099823_101369311	426
335	3300021361	Ga0213872_10000013	Ga0213872_10000013107	426
336	3300025273	Ga0209673_1004857	Ga0209673_10048578	426
337	3300025298	Ga0209050_1002123	Ga0209050_100212310	426
338	3300025303	Ga0209051_1004008	Ga0209051_10040087	426
339	3300025304	Ga0209257_1002360	Ga0209257_100236021	426
340	3300025935	Ga0207709_10035232	Ga0207709_100352323	426
341	3300026118	Ga0207675_100280373	Ga0207675_1002803732	426
342	3300027296	Ga0209389_1041446	Ga0209389_10414463	426
343	3300037068	Ga0373925_0002396	Ga0373925_0002396_4868_6184	426
344	3300037471	Ga0395905_0002212	Ga0395905_0002212_19806_21134	426
345	3300039447	Ga0436361_0236342	Ga0436361_0236342_11601_12980	426
346	3300044656	Ga0466969_0000395	Ga0466969_0000395_7726_9030	426
347	3300044658	Ga0466972_0006534	Ga0466972_0006534_2194_3525	426
348	3300045049	Ga0466959_0012699	Ga0466959_0012699_2422_3726	426
349	3300046457	Ga0495590_0003270	Ga0495590_0003270_3615_4955	426
350	3300046660	Ga0495625_0135339	Ga0495625_0135339_196_1530	426
351	3300048927	Ga0496124_0002660	Ga0496124_0002660_11754_13076	426
352	3300048928	Ga0496125_0005283	Ga0496125_0005283_11392_12714	426
353	3300050493	nmdc:mga0k408_203_c2	nmdc:mga0k408_203_c2_11505_12812	426
354	iso_pu_bacteria	2585428062	2587755883	426
355	3300005333	Ga0070677_10010175	Ga0070677_100101753	427
356	3300005335	Ga0070666_10034159	Ga0070666_100341592	427
357	3300005338	Ga0068868_100003010	Ga0068868_10000301011	427
358	3300005354	Ga0070675_100001277	Ga0070675_1000012773	427
359	3300005356	Ga0070674_100066179	Ga0070674_1000661792	427
360	3300005367	Ga0070667_100006821	Ga0070667_1000068217	427
361	3300005455	Ga0070663_100000131	Ga0070663_10000013116	427
362	3300005456	Ga0070678_100002726	Ga0070678_1000027267	427
363	3300005457	Ga0070662_100003017	Ga0070662_1000030171	427
364	3300005548	Ga0070665_100137024	Ga0070665_1001370242	427
365	3300005617	Ga0068859_100027187	Ga0068859_1000271872	427
366	3300005618	Ga0068864_100004588	Ga0068864_1000045887	427
367	3300005842	Ga0068858_100006635	Ga0068858_10000663511	427
368	3300005844	Ga0068862_100096083	Ga0068862_1000960832	427
369	3300006931	Ga0097620_100027186	Ga0097620_1000271862	427
370	3300009093	Ga0105240_10040252	Ga0105240_100402523	427
371	3300009545	Ga0105237_10000548	Ga0105237_100005489	427
372	3300009551	Ga0105238_10023940	Ga0105238_100239404	427
373	3300013296	Ga0157374_10040462	Ga0157374_100404623	427
374	3300014325	Ga0163163_10243368	Ga0163163_102433681	427
375	3300025903	Ga0207680_10070562	Ga0207680_100705622	427
376	3300025913	Ga0207695_10058388	Ga0207695_100583883	427
377	3300025914	Ga0207671_10013052	Ga0207671_100130522	427
378	3300025924	Ga0207694_10026082	Ga0207694_100260825	427
379	3300025926	Ga0207659_10002382	Ga0207659_100023824	427
380	3300025931	Ga0207644_10096765	Ga0207644_100967652	427
381	3300025933	Ga0207706_10013469	Ga0207706_100134692	427
382	3300025935	Ga0207709_10041145	Ga0207709_100411452	427
383	3300025936	Ga0207670_10029647	Ga0207670_100296472	427
384	3300025960	Ga0207651_10011398	Ga0207651_100113984	427
385	3300026023	Ga0207677_10036367	Ga0207677_100363672	427
386	3300026035	Ga0207703_10005642	Ga0207703_100056429	427
387	3300026067	Ga0207678_10000500	Ga0207678_1000050015	427
388	3300026088	Ga0207641_10004758	Ga0207641_100047583	427
389	3300026095	Ga0207676_10001778	Ga0207676_100017785	427
390	3300026121	Ga0207683_10006427	Ga0207683_100064273	427
391	3300028380	Ga0268265_10033535	Ga0268265_100335352	427
392	3300037471	Ga0395905_0004339	Ga0395905_0004339_2688_4031	427
393	3300048905	Ga0496102_0106330	Ga0496102_0106330_585_1886	427
394	iso_pu_bacteria	2585428057	2587730431	427
395	iso_pu_bacteria	2585428058	2587733192	427
396	iso_pu_bacteria	2588253510	2588294386	427
397	iso_pu_bacteria	2643221592	2643968993	427
398	iso_pu_bacteria	2643221625	2644144124	427
399	iso_pu_bacteria	2643221648	2644273244	427
400	3300031730	Ga0307516_10007358	Ga0307516_1000735812	428
401	3300049649	Ga0501198_000006	Ga0501198_000006_106772_108082	428
402	3300049662	Ga0501222_000007	Ga0501222_000007_66747_68057	428
403	iso_pu_bacteria	2643221654	2644304319	428
404	3300006195	Ga0075366_10018641	Ga0075366_100186412	429
405	3300013296	Ga0157374_10024816	Ga0157374_100248163	429
406	3300037471	Ga0395905_0158189	Ga0395905_0158189_383_1732	429
407	3300041460	Ga0451802_0223057	Ga0451802_0223057_27_1343	429
408	3300042007	Ga0439449_0010362	Ga0439449_0010362_168_1493	429
409	3300049579	Ga0501043_0000023	Ga0501043_0000023_120265_121587	429
410	3300049580	Ga0501046_0000018	Ga0501046_0000018_98975_100297	429
411	3300049581	Ga0501047_0000020	Ga0501047_0000020_137784_139106	429
412	3300049582	Ga0501048_0001064	Ga0501048_0001064_7343_8665	429
413	3300050493	nmdc:mga0k408_1409_c1	nmdc:mga0k408_1409_c1_151_1470	429
414	3300005548	Ga0070665_100070051	Ga0070665_1000700514	430
415	3300006353	Ga0075370_10062634	Ga0075370_100626342	430
416	3300013308	Ga0157375_10049383	Ga0157375_100493834	430
417	3300026088	Ga0207641_10006760	Ga0207641_100067602	430
418	3300028794	Ga0307515_10013171	Ga0307515_1001317110	430
419	3300031507	Ga0307509_10023532	Ga0307509_100235323	430
420	3300050496	nmdc:mga07m45_22183_c1	nmdc:mga07m45_22183_c1_100_1428	430
421	3300005262	Ga0065165_1004114	Ga0065165_10041142	431
422	3300005356	Ga0070674_100002137	Ga0070674_1000021373	431
423	3300006048	Ga0075363_100019158	Ga0075363_1000191584	431
424	3300006048	Ga0075363_100044554	Ga0075363_1000445542	431
425	3300006178	Ga0075367_10025059	Ga0075367_100250593	431
426	3300006353	Ga0075370_10013959	Ga0075370_100139593	431
427	3300006353	Ga0075370_10016614	Ga0075370_100166144	431
428	3300025273	Ga0209673_1006161	Ga0209673_10061617	431
429	3300025297	Ga0209758_1000369	Ga0209758_100036935	431
430	3300025298	Ga0209050_1001823	Ga0209050_100182314	431
431	3300025303	Ga0209051_1021773	Ga0209051_10217733	431
432	3300025910	Ga0207684_10002530	Ga0207684_1000253015	431
433	3300025937	Ga0207669_10002106	Ga0207669_100021062	431
434	3300031456	Ga0307513_10032738	Ga0307513_100327384	431
435	3300041456	Ga0451795_0104790	Ga0451795_0104790_97_1404	431
436	3300044684	Ga0466966_0005482	Ga0466966_0005482_505_1845	431
437	3300044693	Ga0466961_0058174	Ga0466961_0058174_505_1845	431
438	3300044694	Ga0466963_0019955	Ga0466963_0019955_2240_3580	431
439	3300044706	Ga0466964_0006962	Ga0466964_0006962_1775_3115	431
440	3300044719	Ga0466971_0040111	Ga0466971_0040111_126_1466	431
441	3300044765	Ga0466970_0030505	Ga0466970_0030505_328_1668	431
442	3300044842	Ga0466957_0016859	Ga0466957_0016859_130_1470	431
443	3300045976	Ga0466967_0067943	Ga0466967_0067943_401_1741	431
444	3300050493	nmdc:mga0k408_106292_c1	nmdc:mga0k408_106292_c1_277_1593	431
445	3300050494	nmdc:mga06z11_91536_c1	nmdc:mga06z11_91536_c1_160_1509	431
446	3300050496	nmdc:mga07m45_1548_c1	nmdc:mga07m45_1548_c1_3870_5186	431
447	3300050496	nmdc:mga07m45_3927_c2	nmdc:mga07m45_3927_c2_1880_3175	431
448	3300053139	Ga0500568_0007902	Ga0500568_0007902_3390_4685	431
449	3300053156	Ga0500622_0000160	Ga0500622_0000160_21964_23271	431
450	3300002773	JGI25152J39213_1000849	JGI25152J39213_10008499	432
451	3300003215	JGI25153J46596_10002525	JGI25153J46596_1000252511	432
452	3300003771	Ga0055526_1001549	Ga0055526_10015499	432
453	3300005293	Ga0065715_10106343	Ga0065715_101063431	432
454	3300005328	Ga0070676_10003923	Ga0070676_100039237	432
455	3300005331	Ga0070670_100001125	Ga0070670_10000112519	432
456	3300005333	Ga0070677_10001963	Ga0070677_100019637	432
457	3300005334	Ga0068869_100011586	Ga0068869_1000115867	432
458	3300005338	Ga0068868_100036371	Ga0068868_1000363713	432
459	3300005353	Ga0070669_100043541	Ga0070669_1000435412	432
460	3300005354	Ga0070675_100000735	Ga0070675_10000073512	432
461	3300005355	Ga0070671_100061288	Ga0070671_1000612883	432
462	3300005356	Ga0070674_100027566	Ga0070674_1000275662	432
463	3300005364	Ga0070673_100001843	Ga0070673_1000018433	432
464	3300005366	Ga0070659_100001486	Ga0070659_1000014868	432
465	3300005367	Ga0070667_100045593	Ga0070667_1000455932	432
466	3300005456	Ga0070678_100011743	Ga0070678_1000117433	432
467	3300005457	Ga0070662_100007720	Ga0070662_1000077205	432
468	3300005457	Ga0070662_100131056	Ga0070662_1001310562	432
469	3300005459	Ga0068867_100010602	Ga0068867_1000106026	432
470	3300005459	Ga0068867_100017291	Ga0068867_1000172914	432
471	3300005459	Ga0068867_100033462	Ga0068867_1000334621	432
472	3300005543	Ga0070672_100012049	Ga0070672_1000120493	432
473	3300005543	Ga0070672_100021781	Ga0070672_1000217813	432
474	3300005548	Ga0070665_100207776	Ga0070665_1002077762	432
475	3300005564	Ga0070664_100002283	Ga0070664_10000228311	432
476	3300005564	Ga0070664_100011471	Ga0070664_1000114716	432
477	3300005564	Ga0070664_100053655	Ga0070664_1000536552	432
478	3300006048	Ga0075363_100005882	Ga0075363_1000058825	432
479	3300006177	Ga0075362_10027147	Ga0075362_100271472	432
480	3300006177	Ga0075362_10029710	Ga0075362_100297102	432
481	3300006178	Ga0075367_10015770	Ga0075367_100157702	432
482	3300006186	Ga0075369_10017275	Ga0075369_100172753	432
483	3300006195	Ga0075366_10000825	Ga0075366_100008252	432
484	3300006195	Ga0075366_10014320	Ga0075366_100143204	432
485	3300006353	Ga0075370_10000124	Ga0075370_1000012420	432
486	3300006353	Ga0075370_10024208	Ga0075370_100242084	432
487	3300006946	Ga0079104_1000017	Ga0079104_1000017135	432
488	3300009148	Ga0105243_10061870	Ga0105243_100618703	432
489	3300010375	Ga0105239_10051481	Ga0105239_100514816	432
490	3300025245	Ga0207425_1001503	Ga0207425_10015037	432
491	3300025258	Ga0209129_1000468	Ga0209129_10004683	432
492	3300025295	Ga0209564_1000046	Ga0209564_1000046138	432
493	3300025297	Ga0209758_1000709	Ga0209758_100070938	432
494	3300025315	Ga0207697_10008278	Ga0207697_100082782	432
495	3300025893	Ga0207682_10005941	Ga0207682_100059412	432
496	3300025914	Ga0207671_10072376	Ga0207671_100723762	432
497	3300025920	Ga0207649_10000532	Ga0207649_100005325	432
498	3300025923	Ga0207681_10028238	Ga0207681_100282383	432
499	3300025925	Ga0207650_10004032	Ga0207650_100040328	432
500	3300025932	Ga0207690_10001103	Ga0207690_100011038	432
501	3300025933	Ga0207706_10001856	Ga0207706_1000185616	432
502	3300025933	Ga0207706_10043591	Ga0207706_100435912	432
503	3300025937	Ga0207669_10020351	Ga0207669_100203514	432
504	3300025940	Ga0207691_10004533	Ga0207691_1000453312	432
505	3300025940	Ga0207691_10042459	Ga0207691_100424593	432
506	3300025942	Ga0207689_10014268	Ga0207689_100142688	432
507	3300025942	Ga0207689_10111830	Ga0207689_101118302	432
508	3300025945	Ga0207679_10000368	Ga0207679_1000036826	432
509	3300025960	Ga0207651_10030102	Ga0207651_100301023	432
510	3300025986	Ga0207658_10176227	Ga0207658_101762271	432
511	3300026089	Ga0207648_10003244	Ga0207648_1000324412	432
512	3300026089	Ga0207648_10006202	Ga0207648_100062023	432
513	3300026089	Ga0207648_10063471	Ga0207648_100634713	432
514	3300026116	Ga0207674_10010215	Ga0207674_100102155	432
515	3300026121	Ga0207683_10022397	Ga0207683_100223973	432
516	3300026142	Ga0207698_10272564	Ga0207698_102725642	432
517	3300027111	Ga0209281_1000042	Ga0209281_1000042212	432
518	3300031852	Ga0307410_10010512	Ga0307410_100105125	432
519	3300044712	Ga0453684_0012158	Ga0453684_0012158_11308_12633	432
520	3300046683	Ga0495658_0021737	Ga0495658_0021737_1477_2838	432
521	3300047443	Ga0495687_000599	Ga0495687_000599_5081_6400	432
522	3300050490	nmdc:mga03n38_25646_c1	nmdc:mga03n38_25646_c1_97_1416	432
523	3300050490	nmdc:mga03n38_52504_c1	nmdc:mga03n38_52504_c1_341_1660	432
524	3300050493	nmdc:mga0k408_10031_c1	nmdc:mga0k408_10031_c1_228_1550	432
525	3300050493	nmdc:mga0k408_184_c1	nmdc:mga0k408_184_c1_19940_21259	432
526	3300050493	nmdc:mga0k408_2607_c1	nmdc:mga0k408_2607_c1_994_2313	432
527	3300050493	nmdc:mga0k408_431_c1	nmdc:mga0k408_431_c1_2501_3820	432
528	3300050496	nmdc:mga07m45_63_c1	nmdc:mga07m45_63_c1_24241_25563	432
529	3300050496	nmdc:mga07m45_89_c1	nmdc:mga07m45_89_c1_21359_22678	432

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06850

PHB_depo_C

PHB de-polymerase C-terminus

210

412

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5xav-assembly1.cif.gz_B	structure of phac from chromobacterium sp. usm2	0.7634	78	392
5xav-assembly1.cif.gz_A	structure of phac from chromobacterium sp. usm2	0.7609	80	392
6k3c-assembly1.cif.gz_A	crystal structure of class i pha synthase (phac) mutant from chromobacterium sp. usm2 bound to coenzyme a.	0.7516	78	388
6k3c-assembly1.cif.gz_B	crystal structure of class i pha synthase (phac) mutant from chromobacterium sp. usm2 bound to coenzyme a.	0.6847	74	385
5jd6-assembly1.cif.gz_A	crystal structure of mgs-mche2, an alpha/beta hydrolase enzyme from the metagenome of sediments from the lagoon of mar chica, morocco	0.6804	79	410

ID	Description	Score	Start	End	Superfamily
af_Q23044_81_232_3.10.129.10	Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase	0.7514	71	97	3.10.129.10
af_D4A328_4_184_3.40.50.1820	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.7455	344	412	3.40.50.1820
af_O33185_49_361_3.40.50.1820	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.7408	76	409	3.40.50.1820
af_O33185_49_361_3.40.50.1820	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.7343	76	409	3.40.50.1820
af_Q54PU4_55_149_2.60.40.290	Mainly Beta;Sandwich;Immunoglobulin-like;	0.6959	74	96	2.60.40.290

ID	Description	Score	Start	End
AF-A0A6S7B7R7-F1-model_v4	PHB de-polymerase C-terminal domain-containing protein	0.9852	306	411
AF-A0A2M7ELU1-F1-model_v4	Polyhydroxyalkanoate depolymerase	0.9757	329	411
AF-A0A522Y052-F1-model_v4	Polyhydroxyalkanoate depolymerase	0.9749	341	410
AF-A0A0S6X284-F1-model_v4	PHB de-polymerase C-terminal domain-containing protein	0.9733	306	411
AF-J7JCE8-F1-model_v4	deleted	0.9728	300	413

Feature Viewer

pLDDT	pTM	Quality
79.89	0.8	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F459768

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF06850

PHB_depo_C

PHB de-polymerase C-terminus

210

412

0.99

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map