F459594

General Info

Members Datasets Scaffolds Average Seq Length
527 312 1054 143

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0366259|Ga0501039_0366259_60_569
Length 169
Sequence MREPAMARVEDGSFARHPNDVRNSLMPYNPALVAPMRDEMVRLGAQELRTVQEVDAALGDQRGTMLVFVNSVCGCAAGNARPALKLALAHSVLPEQVVTVFAGQDVEATARARQYFAEYQPSSPSMALLRDGEVVHFVHRHQIEGRSPQSIAGDLTKAFDKHFGAGAAA

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
161 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
230 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
231 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
232 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
233 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
234 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
235 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
236 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
237 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
238 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
239 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
245 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
246 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
247 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
248 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
249 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
250 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
274 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
275 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
276 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
277 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
278 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
279 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
280 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
281 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
282 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
283 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
284 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
285 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
286 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
287 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
288 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
289 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
290 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
291 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
292 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
293 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
294 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
295 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
296 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
297 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
298 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
299 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
300 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
301 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
302 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
303 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
304 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
305 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
306 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
307 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
308 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
309 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
310 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
311 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
312 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.94
Metatranscriptomes 2.66
Isolates 7.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 5.31
Rhizosphere 85.58
Stem 0
Stem Tuber 0
Unclassified 13.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0366259 3300049575 Bacteria 1132
2 MBSR1b_contig_3072695 2162886012 Unclassified 1065
3 rootL2_10045982 3300003322 Bacteria 1648
4 Ga0058863_11514378 3300004799 Bacteria 507
5 Ga0058863_11602864 3300004799 Bacteria 1227
6 Ga0058861_12009754 3300004800 Bacteria 1654
7 Ga0058862_10040995 3300004803 Bacteria 1462
8 Ga0070690_100060005 3300005330 Bacteria 2447
9 Ga0070670_100548412 3300005331 Bacteria 1031
10 Ga0068869_100012510 3300005334 Bacteria 5612
11 Ga0070666_10006434 3300005335 Bacteria 7220
12 Ga0068868_101633180 3300005338 Bacteria 606
13 Ga0070660_100931035 3300005339 Unclassified 733
14 Ga0070687_100109615 3300005343 Bacteria 1560
15 Ga0070661_100243952 3300005344 Bacteria 1384
16 Ga0070668_100516446 3300005347 Unclassified 1036
17 Ga0070669_100463423 3300005353 Unclassified 1046
18 Ga0070675_100437566 3300005354 Unclassified 1171
19 Ga0070671_100421785 3300005355 Bacteria 1143
20 Ga0070674_100000031 3300005356 Bacteria 67745
21 Ga0070673_100008731 3300005364 Bacteria 6764
22 Ga0070659_100018110 3300005366 Bacteria 5311
23 Ga0070659_100545849 3300005366 Unclassified 992
24 Ga0070705_100047501 3300005440 Bacteria 2482
25 Ga0070705_100128269 3300005440 Unclassified 1650
26 Ga0070700_100314512 3300005441 Unclassified 1148
27 Ga0070700_100360430 3300005441 Bacteria 1081
28 Ga0070694_100130465 3300005444 Unclassified 1815
29 Ga0070694_100207639 3300005444 Bacteria 1463
30 Ga0070708_100007933 3300005445 Bacteria 8502
31 Ga0070708_100032226 3300005445 Unclassified 4544
32 Ga0070708_100426976 3300005445 Bacteria 1250
33 Ga0070708_100480754 3300005445 Bacteria 1172
34 Ga0070663_100253373 3300005455 Bacteria 1394
35 Ga0070678_100018444 3300005456 Bacteria 4522
36 Ga0070662_100000206 3300005457 Bacteria 34279
37 Ga0070662_100332322 3300005457 Unclassified 1242
38 Ga0070681_10150252 3300005458 Bacteria 2256
39 Ga0068867_100000341 3300005459 Bacteria 30850
40 Ga0068867_101471842 3300005459 Unclassified 633
41 Ga0070706_100000287 3300005467 Bacteria 61228
42 Ga0070706_100018198 3300005467 Bacteria 6481
43 Ga0070706_100564990 3300005467 Bacteria 1058
44 Ga0070706_101165229 3300005467 Bacteria 709
45 Ga0070707_100000408 3300005468 Bacteria 42503
46 Ga0070707_100011626 3300005468 Bacteria 8214
47 Ga0070707_100394126 3300005468 Bacteria 1344
48 Ga0070707_100419382 3300005468 Bacteria 1299
49 Ga0070707_100656328 3300005468 Bacteria 1012
50 Ga0070707_100890265 3300005468 Bacteria 854
51 Ga0070707_102228293 3300005468 Unclassified 515
52 Ga0070698_100000016 3300005471 Bacteria 110961
53 Ga0070698_100021938 3300005471 Bacteria 6685
54 Ga0070698_100066650 3300005471 Unclassified 3623
55 Ga0070698_100159216 3300005471 Bacteria 2202
56 Ga0070698_100856329 3300005471 Unclassified 854
57 Ga0070698_102021133 3300005471 Bacteria 530
58 Ga0070699_100000112 3300005518 Bacteria 75499
59 Ga0070699_100013415 3300005518 Bacteria 7059
60 Ga0070699_100015910 3300005518 Bacteria 6458
61 Ga0070699_100584442 3300005518 Bacteria 1018
62 Ga0070679_100028632 3300005530 Bacteria 5494
63 Ga0070679_100242163 3300005530 Bacteria 1761
64 Ga0070684_100248482 3300005535 Bacteria 1626
65 Ga0070697_100006712 3300005536 Bacteria 8928
66 Ga0070697_100025066 3300005536 Bacteria 4754
67 Ga0070697_100204743 3300005536 Bacteria 1678
68 Ga0070697_100576505 3300005536 Bacteria 988
69 Ga0070697_100612360 3300005536 Bacteria 957
70 Ga0068853_100154686 3300005539 Bacteria 2066
71 Ga0068853_101717729 3300005539 Unclassified 608
72 Ga0070672_100172552 3300005543 Bacteria 1799
73 Ga0070686_100004210 3300005544 Bacteria 7920
74 Ga0070695_100010146 3300005545 Bacteria 5616
75 Ga0070695_100171037 3300005545 Unclassified 1533
76 Ga0070696_100002649 3300005546 Bacteria 11868
77 Ga0070696_100006413 3300005546 Bacteria 7877
78 Ga0070696_100029464 3300005546 Bacteria 3752
79 Ga0070696_100267926 3300005546 Bacteria 1298
80 Ga0070696_100727247 3300005546 Bacteria 811
81 Ga0070693_100078305 3300005547 Bacteria 1964
82 Ga0070665_100389644 3300005548 Bacteria 1401
83 Ga0070704_100011771 3300005549 Bacteria 5378
84 Ga0068855_100352860 3300005563 Bacteria 1620
85 Ga0070664_100004954 3300005564 Bacteria 10667
86 Ga0070664_100390030 3300005564 Unclassified 1272
87 Ga0070664_100456419 3300005564 Unclassified 1174
88 Ga0068857_100398827 3300005577 Bacteria 1280
89 Ga0068854_100007149 3300005578 Bacteria 7130
90 Ga0068856_100361453 3300005614 Bacteria 1470
91 Ga0068856_101213734 3300005614 Unclassified 770
92 Ga0070702_100008842 3300005615 Bacteria 4899
93 Ga0070702_100172838 3300005615 Unclassified 1407
94 Ga0070702_101032540 3300005615 Unclassified 653
95 Ga0068859_100087143 3300005617 Bacteria 3169
96 Ga0068859_101271945 3300005617 Unclassified 811
97 Ga0068864_100327560 3300005618 Bacteria 1440
98 Ga0068866_10000048 3300005718 Bacteria 46904
99 Ga0068861_100009043 3300005719 Bacteria 6867
100 Ga0068870_10267693 3300005840 Bacteria 1066
101 Ga0068870_10598012 3300005840 Unclassified 749
102 Ga0068863_100330894 3300005841 Unclassified 1481
103 Ga0068863_100409208 3300005841 Bacteria 1328
104 Ga0068858_100075921 3300005842 Bacteria 3122
105 Ga0068858_100544471 3300005842 Bacteria 1123
106 Ga0068860_100019327 3300005843 Bacteria 6609
107 Ga0068860_101346603 3300005843 Unclassified 735
108 Ga0068862_101399502 3300005844 Unclassified 703
109 Ga0070715_10073648 3300006163 Bacteria 1532
110 Ga0070716_100473190 3300006173 Bacteria 918
111 Ga0070712_100901375 3300006175 Unclassified 762
112 Ga0097621_100307863 3300006237 Bacteria 1401
113 Ga0097621_100361426 3300006237 Unclassified 1293
114 Ga0068871_101814916 3300006358 Unclassified 579
115 Ga0075428_100043042 3300006844 Bacteria 4966
116 Ga0075430_100343457 3300006846 Unclassified 1233
117 Ga0075431_100285957 3300006847 Bacteria 1669
118 Ga0075431_101360155 3300006847 Unclassified 670
119 Ga0075433_10138725 3300006852 Bacteria 2161
120 Ga0075433_10150500 3300006852 Bacteria 2070
121 Ga0075433_10353688 3300006852 Bacteria 1298
122 Ga0075433_10986104 3300006852 Unclassified 734
123 Ga0075434_100062490 3300006871 Bacteria 3707
124 Ga0075434_100119145 3300006871 Bacteria 2653
125 Ga0075434_100150659 3300006871 Bacteria 2346
126 Ga0075429_100229707 3300006880 Bacteria 1625
127 Ga0068865_100001170 3300006881 Bacteria 15241
128 Ga0097620_100087143 3300006931 Bacteria 3169
129 Ga0097620_101271885 3300006931 Unclassified 811
130 Ga0075435_100140899 3300007076 Unclassified 2023
131 Ga0075435_100268087 3300007076 Unclassified 1456
132 Ga0075435_100553831 3300007076 Bacteria 996
133 Ga0075435_100651897 3300007076 Bacteria 914
134 Ga0105251_10011948 3300009011 Bacteria 4932
135 Ga0105244_10011532 3300009036 Bacteria 5289
136 Ga0111539_10194232 3300009094 Bacteria 2368
137 Ga0114129_10002744 3300009147 Bacteria 24542
138 Ga0114129_10055906 3300009147 Bacteria 5531
139 Ga0114129_10074829 3300009147 Bacteria 4716
140 Ga0105243_11372666 3300009148 Unclassified 726
141 Ga0105248_10053107 3300009177 Bacteria 4547
142 Ga0105237_10420915 3300009545 Bacteria 1341
143 Ga0105239_10004067 3300010375 Bacteria 17658
144 Ga0105246_10002601 3300011119 Bacteria 10922
145 Ga0105246_10620363 3300011119 Bacteria 937
146 Ga0157375_10771187 3300013308 Unclassified 1112
147 Ga0163163_10087075 3300014325 Bacteria 3134
148 Ga0163161_10010019 3300017792 Bacteria 6561
149 Ga0209566_107296 3300025225 Bacteria 1250
150 Ga0207655_1019089 3300025728 Bacteria 3603
151 Ga0207713_1031147 3300025735 Bacteria 2362
152 Ga0207642_10005154 3300025899 Bacteria 4253
153 Ga0207680_10047393 3300025903 Bacteria 2547
154 Ga0207647_10234857 3300025904 Unclassified 1054
155 Ga0207645_10001078 3300025907 Bacteria 22569
156 Ga0207643_10258720 3300025908 Bacteria 1074
157 Ga0207643_10450868 3300025908 Unclassified 818
158 Ga0207684_10005296 3300025910 Bacteria 11962
159 Ga0207684_10065305 3300025910 Bacteria 3090
160 Ga0207684_10215186 3300025910 Bacteria 1658
161 Ga0207684_10343014 3300025910 Bacteria 1286
162 Ga0207684_11165699 3300025910 Unclassified 639
163 Ga0207654_10036734 3300025911 Bacteria 2739
164 Ga0207707_10308544 3300025912 Bacteria 1367
165 Ga0207671_10364253 3300025914 Bacteria 1147
166 Ga0207693_10178003 3300025915 Bacteria 1673
167 Ga0207663_10136657 3300025916 Unclassified 1702
168 Ga0207660_10050833 3300025917 Bacteria 2945
169 Ga0207662_11080286 3300025918 Unclassified 570
170 Ga0207657_10342840 3300025919 Bacteria 1179
171 Ga0207652_10087211 3300025921 Bacteria 2737
172 Ga0207652_10199027 3300025921 Bacteria 1803
173 Ga0207652_11803101 3300025921 Unclassified 517
174 Ga0207646_10003839 3300025922 Bacteria 16695
175 Ga0207646_10084548 3300025922 Bacteria 2839
176 Ga0207646_10107734 3300025922 Bacteria 2500
177 Ga0207646_10173490 3300025922 Bacteria 1947
178 Ga0207646_10526388 3300025922 Bacteria 1064
179 Ga0207646_10637065 3300025922 Bacteria 955
180 Ga0207681_10373041 3300025923 Unclassified 1147
181 Ga0207659_10536898 3300025926 Bacteria 993
182 Ga0207687_10147541 3300025927 Bacteria 1791
183 Ga0207700_10343574 3300025928 Bacteria 1298
184 Ga0207644_10382323 3300025931 Bacteria 1148
185 Ga0207690_10091879 3300025932 Bacteria 2146
186 Ga0207690_10644499 3300025932 Unclassified 868
187 Ga0207706_10000096 3300025933 Bacteria 92125
188 Ga0207706_10540561 3300025933 Bacteria 1004
189 Ga0207686_10000112 3300025934 Bacteria 65154
190 Ga0207709_10001243 3300025935 Bacteria 18298
191 Ga0207669_10001730 3300025937 Bacteria 9271
192 Ga0207704_10001104 3300025938 Bacteria 12007
193 Ga0207665_10186352 3300025939 Bacteria 1506
194 Ga0207691_10025542 3300025940 Bacteria 5544
195 Ga0207691_10269046 3300025940 Bacteria 1468
196 Ga0207711_10028313 3300025941 Bacteria 4714
197 Ga0207689_10000911 3300025942 Bacteria 28348
198 Ga0207679_10017088 3300025945 Bacteria 4829
199 Ga0207679_10676118 3300025945 Unclassified 935
200 Ga0207667_10219097 3300025949 Bacteria 1950
201 Ga0207651_10684750 3300025960 Bacteria 902
202 Ga0207668_11707214 3300025972 Unclassified 568
203 Ga0207640_10032470 3300025981 Bacteria 3238
204 Ga0207703_10098675 3300026035 Bacteria 2471
205 Ga0207703_10613162 3300026035 Unclassified 1030
206 Ga0207639_10113688 3300026041 Bacteria 2211
207 Ga0207639_11591885 3300026041 Unclassified 613
208 Ga0207639_11773965 3300026041 Unclassified 578
209 Ga0207678_10096128 3300026067 Bacteria 2531
210 Ga0207678_10236241 3300026067 Bacteria 1565
211 Ga0207708_10111541 3300026075 Bacteria 2123
212 Ga0207708_10187806 3300026075 Bacteria 1643
213 Ga0207702_10929029 3300026078 Unclassified 862
214 Ga0207702_11254364 3300026078 Unclassified 735
215 Ga0207641_10130201 3300026088 Bacteria 2258
216 Ga0207641_10403949 3300026088 Bacteria 1312
217 Ga0207648_10000043 3300026089 Bacteria 113682
218 Ga0207676_10198852 3300026095 Bacteria 1769
219 Ga0207676_11079381 3300026095 Bacteria 793
220 Ga0207674_11442997 3300026116 Bacteria 657
221 Ga0207675_100009301 3300026118 Bacteria 9216
222 Ga0207683_10003314 3300026121 Bacteria 14037
223 Ga0207698_11367339 3300026142 Bacteria 723
224 Ga0209971_1052094 3300027682 Bacteria 989
225 Ga0209966_1023377 3300027695 Bacteria 1214
226 Ga0209974_10059952 3300027876 Bacteria 1287
227 Ga0268265_10891056 3300028380 Bacteria 873
228 Ga0268264_10033356 3300028381 Bacteria 4228
229 Ga0265325_10259421 3300031241 Bacteria 785
230 Ga0265340_10182700 3300031247 Bacteria 947
231 Ga0265331_10456038 3300031250 Bacteria 574
232 Ga0265316_10050222 3300031344 Bacteria 3281
233 Ga0307408_100104069 3300031548 Bacteria 2168
234 Ga0307408_101350152 3300031548 Bacteria 670
235 Ga0265342_10039647 3300031712 Bacteria 2861
236 Ga0316576_10917462 3300031727 Bacteria 627
237 Ga0307413_10001012 3300031824 Bacteria 10160
238 Ga0307410_10015549 3300031852 Bacteria 4517
239 Ga0307410_10094778 3300031852 Bacteria 2127
240 Ga0307410_10312183 3300031852 Bacteria 1244
241 Ga0307406_10009981 3300031901 Bacteria 5341
242 Ga0307406_10042759 3300031901 Bacteria 2830
243 Ga0307406_10057047 3300031901 Bacteria 2504
244 Ga0307406_10064069 3300031901 Bacteria 2384
245 Ga0307406_11231511 3300031901 Bacteria 651
246 Ga0307407_10025422 3300031903 Bacteria 3120
247 Ga0307407_10062132 3300031903 Bacteria 2186
248 Ga0307407_10070217 3300031903 Bacteria 2081
249 Ga0307412_10060041 3300031911 Bacteria 2551
250 Ga0307409_100032484 3300031995 Bacteria 3785
251 Ga0307409_100567713 3300031995 Bacteria 1116
252 Ga0307409_100893702 3300031995 Bacteria 901
253 Ga0307416_100000378 3300032002 Bacteria 23099
254 Ga0307416_100058747 3300032002 Bacteria 3121
255 Ga0307416_100109249 3300032002 Bacteria 2432
256 Ga0307416_101744070 3300032002 Unclassified 727
257 Ga0307414_10005549 3300032004 Bacteria 6959
258 Ga0307414_10010696 3300032004 Bacteria 5342
259 Ga0307414_10015499 3300032004 Bacteria 4601
260 Ga0307414_10015654 3300032004 Bacteria 4584
261 Ga0307414_10191282 3300032004 Bacteria 1656
262 Ga0307411_10020620 3300032005 Bacteria 3838
263 Ga0307411_10035649 3300032005 Bacteria 3109
264 Ga0307411_10292836 3300032005 Bacteria 1301
265 Ga0307411_10366263 3300032005 Bacteria 1180
266 Ga0307411_10728142 3300032005 Bacteria 867
267 Ga0307411_11897108 3300032005 Bacteria 554
268 Ga0307415_100000254 3300032126 Bacteria 23073
269 Ga0307415_101750208 3300032126 Bacteria 600
270 Ga0373959_0069437 3300034820 Bacteria 794
271 Ga0373929_0020166 3300035085 Unclassified 1342
272 Ga0373929_0139578 3300035085 Unclassified 642
273 Ga0373932_0437977 3300035112 Bacteria 511
274 Ga0373931_0120779 3300035691 Unclassified 1497
275 Ga0395905_0198375 3300037471 Bacteria 1882
276 Ga0395901_1346167 3300038443 Bacteria 674
277 Ga0439453_0131929 3300041408 Bacteria 581
278 Ga0439448_0002597 3300042005 Bacteria 4921
279 Ga0439449_0043990 3300042007 Bacteria 1656
280 Ga0439457_034227 3300042014 Bacteria 1129
281 Ga0439462_0018213 3300042015 Bacteria 1823
282 Ga0439462_0100573 3300042015 Bacteria 797
283 Ga0439463_048732 3300042016 Bacteria 1080
284 Ga0439446_0215594 3300042156 Unclassified 652
285 Ga0466960_0487490 3300044901 Bacteria 721
286 Ga0495591_031698 3300046458 Bacteria 1583
287 Ga0495580_0061313 3300046472 Bacteria 2641
288 Ga0495631_0272394 3300046518 Bacteria 721
289 Ga0495637_0052033 3300046520 Bacteria 1711
290 Ga0495661_0103586 3300046665 Bacteria 1597
291 Ga0495588_0038886 3300046674 Bacteria 2422
292 Ga0495647_0033695 3300046681 Bacteria 1915
293 Ga0495649_0201378 3300046694 Bacteria 1034
294 Ga0495649_0257769 3300046694 Bacteria 895
295 Ga0495681_0197554 3300047470 Bacteria 817
296 Ga0495626_0027221 3300048091 Bacteria 2781
297 Ga0496101_0062119 3300048904 Bacteria 2715
298 Ga0496102_0005289 3300048905 Bacteria 10958
299 Ga0496102_0073221 3300048905 Bacteria 3149
300 Ga0496102_0080155 3300048905 Bacteria 3007
301 Ga0496102_0165909 3300048905 Bacteria 2078
302 Ga0496103_0004479 3300048906 Bacteria 8467
303 Ga0496103_0147080 3300048906 Bacteria 1508
304 Ga0496104_0114317 3300048907 Bacteria 2588
305 Ga0496104_0762331 3300048907 Unclassified 874
306 Ga0496104_1098041 3300048907 Bacteria 699
307 Ga0496105_0195111 3300048908 Unclassified 1654
308 Ga0496106_0016304 3300048909 Bacteria 5497
309 Ga0496106_0047576 3300048909 Bacteria 3229
310 Ga0496106_0415127 3300048909 Unclassified 1082
311 Ga0496107_0121983 3300048910 Bacteria 1920
312 Ga0496108_0011352 3300048911 Bacteria 7241
313 Ga0496108_0115816 3300048911 Bacteria 2295
314 Ga0496109_0007240 3300048912 Bacteria 9382
315 Ga0496109_0160222 3300048912 Bacteria 2108
316 Ga0496109_0250538 3300048912 Bacteria 1668
317 Ga0496110_0007674 3300048913 Bacteria 8633
318 Ga0496110_0188633 3300048913 Bacteria 1872
319 Ga0496110_0318306 3300048913 Bacteria 1417
320 Ga0496111_0018790 3300048914 Bacteria 4791
321 Ga0496112_0000557 3300048915 Bacteria 25556
322 Ga0496113_0020862 3300048916 Bacteria 4614
323 Ga0496114_0083745 3300048917 Bacteria 2699
324 Ga0496116_0009641 3300048919 Bacteria 8214
325 Ga0496116_0016398 3300048919 Bacteria 5797
326 Ga0496116_0062775 3300048919 Bacteria 2397
327 Ga0496116_0068538 3300048919 Bacteria 2260
328 Ga0496117_0027697 3300048920 Bacteria 4407
329 Ga0496117_0036091 3300048920 Bacteria 3703
330 Ga0496118_0197303 3300048921 Bacteria 1196
331 Ga0496119_0017244 3300048922 Bacteria 5442
332 Ga0496119_0118862 3300048922 Bacteria 1456
333 Ga0496120_0004456 3300048923 Bacteria 11736
334 Ga0496120_0018270 3300048923 Bacteria 4525
335 Ga0496121_0047859 3300048924 Bacteria 3643
336 Ga0496121_0170118 3300048924 Bacteria 1584
337 Ga0496121_0174654 3300048924 Bacteria 1557
338 Ga0496121_0278131 3300048924 Bacteria 1146
339 Ga0496122_0009110 3300048925 Bacteria 10520
340 Ga0496122_0009482 3300048925 Bacteria 10248
341 Ga0496122_0017761 3300048925 Bacteria 6622
342 Ga0496122_0035838 3300048925 Bacteria 4027
343 Ga0496122_0045448 3300048925 Bacteria 3413
344 Ga0496123_0006478 3300048926 Bacteria 11331
345 Ga0496123_0028360 3300048926 Bacteria 4146
346 Ga0496123_0202166 3300048926 Bacteria 1017
347 Ga0496123_0241809 3300048926 Bacteria 896
348 Ga0496124_0000128 3300048927 Bacteria 157194
349 Ga0496124_0020895 3300048927 Bacteria 6040
350 Ga0496124_0162515 3300048927 Bacteria 1739
351 Ga0496125_0001304 3300048928 Bacteria 36984
352 Ga0496125_0005510 3300048928 Bacteria 14031
353 Ga0496125_0019970 3300048928 Bacteria 6300
354 Ga0496125_0221202 3300048928 Bacteria 1220
355 Ga0496125_0445746 3300048928 Bacteria 743
356 Ga0496126_0001983 3300048929 Bacteria 29007
357 Ga0496126_0002184 3300048929 Bacteria 27192
358 Ga0496126_0004419 3300048929 Bacteria 16826
359 Ga0501305_054824 3300049161 Bacteria 676
360 Ga0501300_048365 3300049523 Bacteria 652
361 Ga0501031_0164851 3300049568 Bacteria 1449
362 Ga0501031_0264544 3300049568 Unclassified 1117
363 Ga0501036_0186646 3300049572 Bacteria 1745
364 Ga0501036_0384671 3300049572 Bacteria 1171
365 Ga0501036_0456602 3300049572 Bacteria 1064
366 Ga0501038_0114123 3300049574 Bacteria 2235
367 Ga0501038_0184414 3300049574 Bacteria 1682
368 Ga0501038_1059295 3300049574 Bacteria 593
369 Ga0501040_0031114 3300049576 Bacteria 3605
370 Ga0501040_0065976 3300049576 Bacteria 2494
371 Ga0501040_0172607 3300049576 Bacteria 1531
372 Ga0501040_0371068 3300049576 Bacteria 1026
373 Ga0501041_0220321 3300049577 Bacteria 1191
374 Ga0501041_0324610 3300049577 Unclassified 971
375 Ga0501042_0054866 3300049578 Bacteria 2843
376 Ga0501042_0435179 3300049578 Bacteria 951
377 Ga0501042_1037320 3300049578 Bacteria 598
378 Ga0501042_1191830 3300049578 Unclassified 555
379 Ga0501043_0265481 3300049579 Bacteria 1319
380 Ga0501046_0243252 3300049580 Bacteria 1326
381 Ga0501048_0020693 3300049582 Bacteria 4823
382 Ga0501048_0035690 3300049582 Bacteria 3578
383 Ga0501048_0369694 3300049582 Bacteria 1023
384 Ga0501048_0826766 3300049582 Bacteria 666
385 Ga0501068_0191896 3300049584 Bacteria 1294
386 Ga0501068_0354765 3300049584 Bacteria 943
387 Ga0501069_0150444 3300049585 Bacteria 1337
388 Ga0501070_0047845 3300049586 Bacteria 3553
389 Ga0501070_0356620 3300049586 Bacteria 1187
390 Ga0501071_0094625 3300049587 Bacteria 2198
391 Ga0501071_0098904 3300049587 Bacteria 2149
392 Ga0501071_0313767 3300049587 Bacteria 1190
393 Ga0501071_0453120 3300049587 Unclassified 982
394 Ga0501072_0165182 3300049588 Bacteria 1766
395 Ga0501072_0186850 3300049588 Bacteria 1653
396 Ga0501072_0187539 3300049588 Bacteria 1650
397 Ga0501072_0902623 3300049588 Bacteria 690
398 Ga0501074_0064392 3300049590 Bacteria 2639
399 Ga0501074_0146448 3300049590 Bacteria 1689
400 Ga0501075_0037312 3300049591 Bacteria 3630
401 Ga0501075_0352060 3300049591 Bacteria 1122
402 Ga0501075_1061051 3300049591 Bacteria 615
403 Ga0501076_0032233 3300049592 Bacteria 4089
404 Ga0501076_0129942 3300049592 Bacteria 2043
405 Ga0501076_0216899 3300049592 Bacteria 1564
406 Ga0501076_0388388 3300049592 Bacteria 1147
407 Ga0501077_0000355 3300049593 Bacteria 27126
408 Ga0501077_0004664 3300049593 Bacteria 8331
409 Ga0501077_0007824 3300049593 Bacteria 6599
410 Ga0501199_003296 3300049650 Bacteria 1543
411 Ga0501209_000108 3300049656 Bacteria 8554
412 Ga0501216_007286 3300049660 Bacteria 1718
413 Ga0501247_010624 3300049677 Bacteria 1099
414 Ga0501249_003036 3300049679 Bacteria 3375
415 Ga0501250_012166 3300049680 Bacteria 1013
416 Ga0501257_126199 3300049686 Bacteria 689
417 Ga0501258_076541 3300049687 Bacteria 504
418 Ga0501259_054681 3300049688 Bacteria 819
419 Ga0501225_0003685 3300049705 Bacteria 4611
420 Ga0501234_006959 3300049707 Bacteria 1770
421 Ga0501079_0019362 3300049741 Bacteria 5197
422 Ga0501079_0078288 3300049741 Bacteria 2557
423 Ga0501079_0320825 3300049741 Bacteria 1213
424 Ga0501079_0500590 3300049741 Unclassified 955
425 Ga0501079_0771086 3300049741 Bacteria 757
426 Ga0501079_0924675 3300049741 Bacteria 687
427 Ga0501080_0051042 3300049742 Bacteria 3848
428 Ga0501080_0134983 3300049742 Bacteria 2284
429 Ga0501081_0147456 3300049743 Bacteria 1689
430 Ga0501081_0433349 3300049743 Bacteria 975
431 Ga0501081_0523571 3300049743 Bacteria 884
432 Ga0501081_1254660 3300049743 Bacteria 562
433 Ga0501083_0195400 3300049744 Bacteria 1320
434 Ga0501083_0975376 3300049744 Bacteria 551
435 Ga0501263_003114 3300049760 Bacteria 1748
436 Ga0501267_001028 3300049764 Bacteria 2312
437 Ga0501268_002268 3300049765 Bacteria 2521
438 Ga0501270_000819 3300049767 Bacteria 2794
439 Ga0501271_005268 3300049768 Bacteria 1255
440 Ga0501272_001847 3300049769 Bacteria 2062
441 Ga0501273_000273 3300049770 Bacteria 3935
442 Ga0501035_0331067 3300049822 Unclassified 1278
443 Ga0501044_1648874 3300049823 Bacteria 506
444 Ga0501045_0035063 3300049824 Bacteria 3643
445 Ga0501045_0049894 3300049824 Bacteria 3053
446 Ga0501045_0063581 3300049824 Bacteria 2709
447 Ga0501212_000664 3300049851 Bacteria 3477
448 nmdc:mga05p37_11709_c1 3300050507 Bacteria 10454
449 nmdc:mga05p37_368206_c1 3300050507 Bacteria 1687
450 nmdc:mga05p37_59814_c1 3300050507 Bacteria 4691
451 nmdc:mga05p37_78009_c1 3300050507 Bacteria 4078
452 nmdc:mga09592_109503_c1 3300050508 Bacteria 2369
453 nmdc:mga0qj67_339918_c1 3300050509 Unclassified 1214
454 nmdc:mga06r32_1254203_c1 3300050510 Unclassified 686
455 nmdc:mga06r32_2043169_c1 3300050510 Bacteria 506
456 nmdc:mga06r32_279269_c1 3300050510 Bacteria 1657
457 nmdc:mga0n895_124572_c1 3300050512 Bacteria 2600
458 nmdc:mga0n895_70851_c1 3300050512 Bacteria 3455
459 nmdc:mga0rr50_261902_c1 3300050513 Unclassified 1439
460 nmdc:mga0rr50_881341_c1 3300050513 Bacteria 763
461 nmdc:mga0a205_1097596_c1 3300050515 Unclassified 643
462 nmdc:mga0a205_179131_c1 3300050515 Bacteria 2014
463 nmdc:mga0a205_40276_c1 3300050515 Bacteria 1338
464 Ga0501084_0037025 3300054114 Bacteria 4076
465 Ga0501084_0163478 3300054114 Bacteria 1878
466 Ga0501084_0234843 3300054114 Bacteria 1548
467 Ga0501084_0334321 3300054114 Bacteria 1279
468 Ga0501084_1405863 3300054114 Bacteria 584
469 Ga0590071_000097 3300059421 Bacteria 24550
470 Ga0590071_007309 3300059421 Bacteria 2614
471 Ga0590075_011166 3300059424 Bacteria 2168
472 Ga0590077_010358 3300059426 Bacteria 1917
473 Ga0587073_0270298 3300059492 Bacteria 541
474 Ga0587077_090468 3300059493 Bacteria 718
475 Ga0587077_111443 3300059493 Bacteria 671
476 Ga0587082_001784 3300059504 Bacteria 2313
477 Ga0587088_004111 3300059508 Bacteria 1818
478 Ga0587094_002273 3300059513 Bacteria 1971
479 Ga0587067_014874 3300059640 Bacteria 1253
480 Ga0587067_021711 3300059640 Bacteria 1110
481 Ga0587067_061753 3300059640 Bacteria 787
482 Ga0501082_0051858 3300060353 Bacteria 3536
483 Ga0501082_0138499 3300060353 Bacteria 2112
484 Ga0501082_0240217 3300060353 Bacteria 1576
485 Ga0501082_0551105 3300060353 Unclassified 1008
486 Ga0530510_0020543 3300061734 Bacteria 4696
487 Ga0530510_0026830 3300061734 Bacteria 4126
488 Ga0530510_0164422 3300061734 Bacteria 1642
489 2571529819 2571042143 Bacteria 6986194
490 2595319184 2593339198 Bacteria 7267884
491 2601641607 2600255286 Bacteria 5390125
492 2643738585 2643221543 Bacteria 6628015
493 2723602116 2721755693 Bacteria 6126117
494 2728531074 2728368933 Bacteria 7044283
495 2730138182 2728369359 Bacteria 5621728
496 2753812350 2751185905 Bacteria 6142767
497 2793184997 2791355222 Bacteria 5898266
498 2802439921 2802428803 Bacteria 5806948
499 2865004924 2865002811 Bacteria 6333767
500 2885528529 2885526491 Bacteria 7164189
501 2888580250 2888578766 Bacteria 6743310
502 2889043177 2889042446 Bacteria 7618936
503 2889051071 2889049205 Bacteria 7524325
504 2889278185 2889276214 Bacteria 5979355
505 2889299637 2889295896 Bacteria 4704906
506 2904117143 2904113452 Bacteria 7796941
507 2904168445 2904162308 Bacteria 7086713
508 2904496763 2904490793 Bacteria 7046938
509 2904598114 2904595352 Bacteria 6124848
510 2919166101 2919160200 Bacteria 6929020
511 2931386639 2931384279 Bacteria 7299545
512 2938651175 2938649242 Bacteria 7118381
513 2939684941 2939679117 Bacteria 6921672
514 2939707342 2939702853 Bacteria 5139229
515 2945994751 2945991243 Bacteria 7008369
516 2946057546 2946053406 Bacteria 6978655
517 2968563107 2968558590 Bacteria 6956864
518 2971405446 2971403814 Bacteria 7370929
519 2981288744 2981284811 Bacteria 4641497
520 2981293564 2981289755 Bacteria 4641509
521 2981984200 2981980479 Bacteria 4641628
522 2981989280 2981985349 Bacteria 4641497
523 2988225709 2988225383 Bacteria 7221625
524 2996637314 2996632988 Bacteria 6921523
525 2996710851 2996706504 Bacteria 5757485
526 648168620 648028048 Bacteria 5394884
527 8046993603 8046991243 Bacteria 8497463
528 Ga0501039_0366259
529 MBSR1b_contig_3072695
530 rootL2_10045982
531 Ga0058863_11514378
532 Ga0058863_11602864
533 Ga0058861_12009754
534 Ga0058862_10040995
535 Ga0070690_100060005
536 Ga0070670_100548412
537 Ga0068869_100012510
538 Ga0070666_10006434
539 Ga0068868_101633180
540 Ga0070660_100931035
541 Ga0070687_100109615
542 Ga0070661_100243952
543 Ga0070668_100516446
544 Ga0070669_100463423
545 Ga0070675_100437566
546 Ga0070671_100421785
547 Ga0070674_100000031
548 Ga0070673_100008731
549 Ga0070659_100018110
550 Ga0070659_100545849
551 Ga0070705_100047501
552 Ga0070705_100128269
553 Ga0070700_100314512
554 Ga0070700_100360430
555 Ga0070694_100130465
556 Ga0070694_100207639
557 Ga0070708_100007933
558 Ga0070708_100032226
559 Ga0070708_100426976
560 Ga0070708_100480754
561 Ga0070663_100253373
562 Ga0070678_100018444
563 Ga0070662_100000206
564 Ga0070662_100332322
565 Ga0070681_10150252
566 Ga0068867_100000341
567 Ga0068867_101471842
568 Ga0070706_100000287
569 Ga0070706_100018198
570 Ga0070706_100564990
571 Ga0070706_101165229
572 Ga0070707_100000408
573 Ga0070707_100011626
574 Ga0070707_100394126
575 Ga0070707_100419382
576 Ga0070707_100656328
577 Ga0070707_100890265
578 Ga0070707_102228293
579 Ga0070698_100000016
580 Ga0070698_100021938
581 Ga0070698_100066650
582 Ga0070698_100159216
583 Ga0070698_100856329
584 Ga0070698_102021133
585 Ga0070699_100000112
586 Ga0070699_100013415
587 Ga0070699_100015910
588 Ga0070699_100584442
589 Ga0070679_100028632
590 Ga0070679_100242163
591 Ga0070684_100248482
592 Ga0070697_100006712
593 Ga0070697_100025066
594 Ga0070697_100204743
595 Ga0070697_100576505
596 Ga0070697_100612360
597 Ga0068853_100154686
598 Ga0068853_101717729
599 Ga0070672_100172552
600 Ga0070686_100004210
601 Ga0070695_100010146
602 Ga0070695_100171037
603 Ga0070696_100002649
604 Ga0070696_100006413
605 Ga0070696_100029464
606 Ga0070696_100267926
607 Ga0070696_100727247
608 Ga0070693_100078305
609 Ga0070665_100389644
610 Ga0070704_100011771
611 Ga0068855_100352860
612 Ga0070664_100004954
613 Ga0070664_100390030
614 Ga0070664_100456419
615 Ga0068857_100398827
616 Ga0068854_100007149
617 Ga0068856_100361453
618 Ga0068856_101213734
619 Ga0070702_100008842
620 Ga0070702_100172838
621 Ga0070702_101032540
622 Ga0068859_100087143
623 Ga0068859_101271945
624 Ga0068864_100327560
625 Ga0068866_10000048
626 Ga0068861_100009043
627 Ga0068870_10267693
628 Ga0068870_10598012
629 Ga0068863_100330894
630 Ga0068863_100409208
631 Ga0068858_100075921
632 Ga0068858_100544471
633 Ga0068860_100019327
634 Ga0068860_101346603
635 Ga0068862_101399502
636 Ga0070715_10073648
637 Ga0070716_100473190
638 Ga0070712_100901375
639 Ga0097621_100307863
640 Ga0097621_100361426
641 Ga0068871_101814916
642 Ga0075428_100043042
643 Ga0075430_100343457
644 Ga0075431_100285957
645 Ga0075431_101360155
646 Ga0075433_10138725
647 Ga0075433_10150500
648 Ga0075433_10353688
649 Ga0075433_10986104
650 Ga0075434_100062490
651 Ga0075434_100119145
652 Ga0075434_100150659
653 Ga0075429_100229707
654 Ga0068865_100001170
655 Ga0097620_100087143
656 Ga0097620_101271885
657 Ga0075435_100140899
658 Ga0075435_100268087
659 Ga0075435_100553831
660 Ga0075435_100651897
661 Ga0105251_10011948
662 Ga0105244_10011532
663 Ga0111539_10194232
664 Ga0114129_10002744
665 Ga0114129_10055906
666 Ga0114129_10074829
667 Ga0105243_11372666
668 Ga0105248_10053107
669 Ga0105237_10420915
670 Ga0105239_10004067
671 Ga0105246_10002601
672 Ga0105246_10620363
673 Ga0157375_10771187
674 Ga0163163_10087075
675 Ga0163161_10010019
676 Ga0209566_107296
677 Ga0207655_1019089
678 Ga0207713_1031147
679 Ga0207642_10005154
680 Ga0207680_10047393
681 Ga0207647_10234857
682 Ga0207645_10001078
683 Ga0207643_10258720
684 Ga0207643_10450868
685 Ga0207684_10005296
686 Ga0207684_10065305
687 Ga0207684_10215186
688 Ga0207684_10343014
689 Ga0207684_11165699
690 Ga0207654_10036734
691 Ga0207707_10308544
692 Ga0207671_10364253
693 Ga0207693_10178003
694 Ga0207663_10136657
695 Ga0207660_10050833
696 Ga0207662_11080286
697 Ga0207657_10342840
698 Ga0207652_10087211
699 Ga0207652_10199027
700 Ga0207652_11803101
701 Ga0207646_10003839
702 Ga0207646_10084548
703 Ga0207646_10107734
704 Ga0207646_10173490
705 Ga0207646_10526388
706 Ga0207646_10637065
707 Ga0207681_10373041
708 Ga0207659_10536898
709 Ga0207687_10147541
710 Ga0207700_10343574
711 Ga0207644_10382323
712 Ga0207690_10091879
713 Ga0207690_10644499
714 Ga0207706_10000096
715 Ga0207706_10540561
716 Ga0207686_10000112
717 Ga0207709_10001243
718 Ga0207669_10001730
719 Ga0207704_10001104
720 Ga0207665_10186352
721 Ga0207691_10025542
722 Ga0207691_10269046
723 Ga0207711_10028313
724 Ga0207689_10000911
725 Ga0207679_10017088
726 Ga0207679_10676118
727 Ga0207667_10219097
728 Ga0207651_10684750
729 Ga0207668_11707214
730 Ga0207640_10032470
731 Ga0207703_10098675
732 Ga0207703_10613162
733 Ga0207639_10113688
734 Ga0207639_11591885
735 Ga0207639_11773965
736 Ga0207678_10096128
737 Ga0207678_10236241
738 Ga0207708_10111541
739 Ga0207708_10187806
740 Ga0207702_10929029
741 Ga0207702_11254364
742 Ga0207641_10130201
743 Ga0207641_10403949
744 Ga0207648_10000043
745 Ga0207676_10198852
746 Ga0207676_11079381
747 Ga0207674_11442997
748 Ga0207675_100009301
749 Ga0207683_10003314
750 Ga0207698_11367339
751 Ga0209971_1052094
752 Ga0209966_1023377
753 Ga0209974_10059952
754 Ga0268265_10891056
755 Ga0268264_10033356
756 Ga0265325_10259421
757 Ga0265340_10182700
758 Ga0265331_10456038
759 Ga0265316_10050222
760 Ga0307408_100104069
761 Ga0307408_101350152
762 Ga0265342_10039647
763 Ga0316576_10917462
764 Ga0307413_10001012
765 Ga0307410_10015549
766 Ga0307410_10094778
767 Ga0307410_10312183
768 Ga0307406_10009981
769 Ga0307406_10042759
770 Ga0307406_10057047
771 Ga0307406_10064069
772 Ga0307406_11231511
773 Ga0307407_10025422
774 Ga0307407_10062132
775 Ga0307407_10070217
776 Ga0307412_10060041
777 Ga0307409_100032484
778 Ga0307409_100567713
779 Ga0307409_100893702
780 Ga0307416_100000378
781 Ga0307416_100058747
782 Ga0307416_100109249
783 Ga0307416_101744070
784 Ga0307414_10005549
785 Ga0307414_10010696
786 Ga0307414_10015499
787 Ga0307414_10015654
788 Ga0307414_10191282
789 Ga0307411_10020620
790 Ga0307411_10035649
791 Ga0307411_10292836
792 Ga0307411_10366263
793 Ga0307411_10728142
794 Ga0307411_11897108
795 Ga0307415_100000254
796 Ga0307415_101750208
797 Ga0373959_0069437
798 Ga0373929_0020166
799 Ga0373929_0139578
800 Ga0373932_0437977
801 Ga0373931_0120779
802 Ga0395905_0198375
803 Ga0395901_1346167
804 Ga0439453_0131929
805 Ga0439448_0002597
806 Ga0439449_0043990
807 Ga0439457_034227
808 Ga0439462_0018213
809 Ga0439462_0100573
810 Ga0439463_048732
811 Ga0439446_0215594
812 Ga0466960_0487490
813 Ga0495591_031698
814 Ga0495580_0061313
815 Ga0495631_0272394
816 Ga0495637_0052033
817 Ga0495661_0103586
818 Ga0495588_0038886
819 Ga0495647_0033695
820 Ga0495649_0201378
821 Ga0495649_0257769
822 Ga0495681_0197554
823 Ga0495626_0027221
824 Ga0496101_0062119
825 Ga0496102_0005289
826 Ga0496102_0073221
827 Ga0496102_0080155
828 Ga0496102_0165909
829 Ga0496103_0004479
830 Ga0496103_0147080
831 Ga0496104_0114317
832 Ga0496104_0762331
833 Ga0496104_1098041
834 Ga0496105_0195111
835 Ga0496106_0016304
836 Ga0496106_0047576
837 Ga0496106_0415127
838 Ga0496107_0121983
839 Ga0496108_0011352
840 Ga0496108_0115816
841 Ga0496109_0007240
842 Ga0496109_0160222
843 Ga0496109_0250538
844 Ga0496110_0007674
845 Ga0496110_0188633
846 Ga0496110_0318306
847 Ga0496111_0018790
848 Ga0496112_0000557
849 Ga0496113_0020862
850 Ga0496114_0083745
851 Ga0496116_0009641
852 Ga0496116_0016398
853 Ga0496116_0062775
854 Ga0496116_0068538
855 Ga0496117_0027697
856 Ga0496117_0036091
857 Ga0496118_0197303
858 Ga0496119_0017244
859 Ga0496119_0118862
860 Ga0496120_0004456
861 Ga0496120_0018270
862 Ga0496121_0047859
863 Ga0496121_0170118
864 Ga0496121_0174654
865 Ga0496121_0278131
866 Ga0496122_0009110
867 Ga0496122_0009482
868 Ga0496122_0017761
869 Ga0496122_0035838
870 Ga0496122_0045448
871 Ga0496123_0006478
872 Ga0496123_0028360
873 Ga0496123_0202166
874 Ga0496123_0241809
875 Ga0496124_0000128
876 Ga0496124_0020895
877 Ga0496124_0162515
878 Ga0496125_0001304
879 Ga0496125_0005510
880 Ga0496125_0019970
881 Ga0496125_0221202
882 Ga0496125_0445746
883 Ga0496126_0001983
884 Ga0496126_0002184
885 Ga0496126_0004419
886 Ga0501305_054824
887 Ga0501300_048365
888 Ga0501031_0164851
889 Ga0501031_0264544
890 Ga0501036_0186646
891 Ga0501036_0384671
892 Ga0501036_0456602
893 Ga0501038_0114123
894 Ga0501038_0184414
895 Ga0501038_1059295
896 Ga0501040_0031114
897 Ga0501040_0065976
898 Ga0501040_0172607
899 Ga0501040_0371068
900 Ga0501041_0220321
901 Ga0501041_0324610
902 Ga0501042_0054866
903 Ga0501042_0435179
904 Ga0501042_1037320
905 Ga0501042_1191830
906 Ga0501043_0265481
907 Ga0501046_0243252
908 Ga0501048_0020693
909 Ga0501048_0035690
910 Ga0501048_0369694
911 Ga0501048_0826766
912 Ga0501068_0191896
913 Ga0501068_0354765
914 Ga0501069_0150444
915 Ga0501070_0047845
916 Ga0501070_0356620
917 Ga0501071_0094625
918 Ga0501071_0098904
919 Ga0501071_0313767
920 Ga0501071_0453120
921 Ga0501072_0165182
922 Ga0501072_0186850
923 Ga0501072_0187539
924 Ga0501072_0902623
925 Ga0501074_0064392
926 Ga0501074_0146448
927 Ga0501075_0037312
928 Ga0501075_0352060
929 Ga0501075_1061051
930 Ga0501076_0032233
931 Ga0501076_0129942
932 Ga0501076_0216899
933 Ga0501076_0388388
934 Ga0501077_0000355
935 Ga0501077_0004664
936 Ga0501077_0007824
937 Ga0501199_003296
938 Ga0501209_000108
939 Ga0501216_007286
940 Ga0501247_010624
941 Ga0501249_003036
942 Ga0501250_012166
943 Ga0501257_126199
944 Ga0501258_076541
945 Ga0501259_054681
946 Ga0501225_0003685
947 Ga0501234_006959
948 Ga0501079_0019362
949 Ga0501079_0078288
950 Ga0501079_0320825
951 Ga0501079_0500590
952 Ga0501079_0771086
953 Ga0501079_0924675
954 Ga0501080_0051042
955 Ga0501080_0134983
956 Ga0501081_0147456
957 Ga0501081_0433349
958 Ga0501081_0523571
959 Ga0501081_1254660
960 Ga0501083_0195400
961 Ga0501083_0975376
962 Ga0501263_003114
963 Ga0501267_001028
964 Ga0501268_002268
965 Ga0501270_000819
966 Ga0501271_005268
967 Ga0501272_001847
968 Ga0501273_000273
969 Ga0501035_0331067
970 Ga0501044_1648874
971 Ga0501045_0035063
972 Ga0501045_0049894
973 Ga0501045_0063581
974 Ga0501212_000664
975 nmdc:mga05p37_11709_c1
976 nmdc:mga05p37_368206_c1
977 nmdc:mga05p37_59814_c1
978 nmdc:mga05p37_78009_c1
979 nmdc:mga09592_109503_c1
980 nmdc:mga0qj67_339918_c1
981 nmdc:mga06r32_1254203_c1
982 nmdc:mga06r32_2043169_c1
983 nmdc:mga06r32_279269_c1
984 nmdc:mga0n895_124572_c1
985 nmdc:mga0n895_70851_c1
986 nmdc:mga0rr50_261902_c1
987 nmdc:mga0rr50_881341_c1
988 nmdc:mga0a205_1097596_c1
989 nmdc:mga0a205_179131_c1
990 nmdc:mga0a205_40276_c1
991 Ga0501084_0037025
992 Ga0501084_0163478
993 Ga0501084_0234843
994 Ga0501084_0334321
995 Ga0501084_1405863
996 Ga0590071_000097
997 Ga0590071_007309
998 Ga0590075_011166
999 Ga0590077_010358
1000 Ga0587073_0270298
1001 Ga0587077_090468
1002 Ga0587077_111443
1003 Ga0587082_001784
1004 Ga0587088_004111
1005 Ga0587094_002273
1006 Ga0587067_014874
1007 Ga0587067_021711
1008 Ga0587067_061753
1009 Ga0501082_0051858
1010 Ga0501082_0138499
1011 Ga0501082_0240217
1012 Ga0501082_0551105
1013 Ga0530510_0020543
1014 Ga0530510_0026830
1015 Ga0530510_0164422
1016 2571529819
1017 2595319184
1018 2601641607
1019 2643738585
1020 2723602116
1021 2728531074
1022 2730138182
1023 2753812350
1024 2793184997
1025 2802439921
1026 2865004924
1027 2885528529
1028 2888580250
1029 2889043177
1030 2889051071
1031 2889278185
1032 2889299637
1033 2904117143
1034 2904168445
1035 2904496763
1036 2904598114
1037 2919166101
1038 2931386639
1039 2938651175
1040 2939684941
1041 2939707342
1042 2945994751
1043 2946057546
1044 2968563107
1045 2971405446
1046 2981288744
1047 2981293564
1048 2981984200
1049 2981989280
1050 2988225709
1051 2996637314
1052 2996710851
1053 648168620
1054 8046993603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06491

Disulph_isomer

Disulphide isomerase

28

163

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fhk-assembly1.cif.gz_A crystal structure of apc1446, b.subtilis yphp disulfide isomerase 0.9553 6 138
7rzb-assembly1.cif.gz_A-2 brxa from staphylococcus aureus with bacillithiol mixed disulfide 0.9551 4 138
7rzb-assembly1.cif.gz_A-2 brxa from staphylococcus aureus with bacillithiol mixed disulfide 0.9283 4 138
3fhk-assembly1.cif.gz_A crystal structure of apc1446, b.subtilis yphp disulfide isomerase 0.8903 6 138
7c3f-assembly4.cif.gz_L crystal structure of ferredoxin: thioredoxin reductase and thioredoxin m2 complex 0.7838 20 137
ID Description Score Start End Superfamily
af_Q95Q32_223_318_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9519 100 113 2.60.40.10
af_Q2FY55_25_142_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.951 21 138 3.40.30.10
af_Q2FYK4_24_144_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9441 21 138 3.40.30.10
af_Q2FY55_25_142_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9354 21 138 3.40.30.10
af_Q2FYK4_24_144_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9141 21 138 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3M1RM10-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9755 3 139
AF-A0A3M2C6P9-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9725 1 138
AF-A0A0B7H7U3-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9724 3 138
AF-F9YR41-F1-model_v4 UPF0403 protein 0.9724 3 138
AF-A0A2T5JEL3-F1-model_v4 Putative YphP/YqiW family bacilliredoxin 0.9722 2 138 GO:0016020

Map