F459487

General Info

Members Datasets Scaffolds Average Seq Length
526 268 1052 409

Family's Representative Sequence

Representative Sequence 3300053088|Ga0500644_0000053|Ga0500644_0000053_7156_8505
Length 449
Sequence VTPSRSSSAPRPDPPALIHHHLQHSKEGITMTRTRVVVTGLGTTSPVGGDVPSTWDALVNGRSGVRYLDDDWAEGFPVRIAGRIAVEPSEVLERVKARRLDRSSQFAMVAAMEAWADAGLAEVQEQLDSERVGVAMASGIGGVTTLLENYDALKEKGPRRVSPLAVPMLMPNAPAAQISLYVGARAAVNTPVSACASGNEAISLAVDQIRLGRADIVVAGGTEAAIHPLPMAAFANMMALSKTASGEEGGDPTAVSRPWDTARDGFVLGEGAGVLVLESEEHALARGAKIYAEVLGAGITADAHDIAQPDPAGRGGSRAILRALAEGDIGPESIFHVNAHATSTPQGDIAEGLMLHATLGAHVGQVVVTSTKSMTGHLLGGAGALEAIATVLALQHRVVPPTINLDNQDPQVDLDIATKARDLPLGDIAALNNSFGFGGANVAVAFGSR

Samples

Sample ID Description Type Environment
1 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
111 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
124 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
125 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
126 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
128 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
138 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
238 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
239 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
244 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
245 2643221561 Nocardioides sp. Root151 Isolate Unclassified
246 2643221576 Nocardioides sp. Root614 Isolate Unclassified
247 2643221590 Nocardioides sp. Root682 Isolate Unclassified
248 2643221604 Nocardioides sp. Root190 Isolate Unclassified
249 2643221615 Nocardioides sp. Root224 Isolate Unclassified
250 2643221617 Nocardioides sp. Root79 Isolate Unclassified
251 2643221620 Nocardioides sp. Root240 Isolate Unclassified
252 2643221641 Nocardioides sp. Root122 Isolate Unclassified
253 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
254 2643221696 Nocardioides sp. Root140 Isolate Unclassified
255 2738541305 Nocardioides sp. CF167 Isolate Unclassified
256 2739367898 Nocardioides sp. CF479 Isolate Unclassified
257 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
258 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
259 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
260 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
261 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
262 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
263 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
264 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
265 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
266 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
267 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
268 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.11
Metatranscriptomes 5.13
Isolates 4.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 8.75
Nodule 0.19
Rhizoplane 6.84
Rhizosphere 79.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500644_0000053 3300053088 Bacteria 69275
2 Ga0070658_10041593 3300005327 Bacteria 3708
3 Ga0070683_100017736 3300005329 Bacteria 6290
4 Ga0070683_100052260 3300005329 Bacteria 3785
5 Ga0070683_100092642 3300005329 Bacteria 2838
6 Ga0070680_100044971 3300005336 Bacteria 3588
7 Ga0070682_100008102 3300005337 Bacteria 5922
8 Ga0070682_100081926 3300005337 Bacteria 2090
9 Ga0070682_100106268 3300005337 Bacteria 1862
10 Ga0070660_100054517 3300005339 Bacteria 3088
11 Ga0070660_100107229 3300005339 Bacteria 2219
12 Ga0070674_100151301 3300005356 Bacteria 1751
13 Ga0070673_100027915 3300005364 Bacteria 4191
14 Ga0070667_100258392 3300005367 Bacteria 1559
15 Ga0070714_100022738 3300005435 Bacteria 5144
16 Ga0070700_100014093 3300005441 Bacteria 4509
17 Ga0070700_100070097 3300005441 Bacteria 2234
18 Ga0070663_100042194 3300005455 Bacteria 3205
19 Ga0070663_100072081 3300005455 Bacteria 2515
20 Ga0070681_10097190 3300005458 Bacteria 2892
21 Ga0070681_10238893 3300005458 Bacteria 1731
22 Ga0070707_100035467 3300005468 Bacteria 4758
23 Ga0070679_100026136 3300005530 Bacteria 5731
24 Ga0070679_100116402 3300005530 Bacteria 2658
25 Ga0070684_100023375 3300005535 Bacteria 5169
26 Ga0070684_100226174 3300005535 Bacteria 1708
27 Ga0068853_100168431 3300005539 Bacteria 1981
28 Ga0068853_100189603 3300005539 Bacteria 1868
29 Ga0070665_100000151 3300005548 Bacteria 127579
30 Ga0070665_100017404 3300005548 Bacteria 7215
31 Ga0068855_100010862 3300005563 Bacteria 10993
32 Ga0068857_100094882 3300005577 Bacteria 2671
33 Ga0068857_100169508 3300005577 Bacteria 1984
34 Ga0068854_100016207 3300005578 Bacteria 4962
35 Ga0068856_100075597 3300005614 Bacteria 3336
36 Ga0070702_100039962 3300005615 Bacteria 2621
37 Ga0070702_100053892 3300005615 Bacteria 2312
38 Ga0068852_100018206 3300005616 Bacteria 5530
39 Ga0068852_100102370 3300005616 Bacteria 2587
40 Ga0068864_100273203 3300005618 Bacteria 1575
41 Ga0068870_10095068 3300005840 Bacteria 1673
42 Ga0068870_10101071 3300005840 Bacteria 1629
43 Ga0068860_100000669 3300005843 Bacteria 39653
44 Ga0068862_100075048 3300005844 Bacteria 2924
45 Ga0081455_10038396 3300005937 Bacteria 4241
46 Ga0081539_10033336 3300005985 Bacteria 3138
47 Ga0075365_10000470 3300006038 Bacteria 15196
48 Ga0075365_10001880 3300006038 Bacteria 9887
49 Ga0075365_10026811 3300006038 Bacteria 3661
50 Ga0075365_10101482 3300006038 Bacteria 1970
51 Ga0075365_10101491 3300006038 Bacteria 1970
52 Ga0075365_10115034 3300006038 Bacteria 1851
53 Ga0075365_10134744 3300006038 Bacteria 1711
54 Ga0075368_10004248 3300006042 Bacteria 4838
55 Ga0075368_10008967 3300006042 Bacteria 3588
56 Ga0075368_10019797 3300006042 Bacteria 2542
57 Ga0075363_100000621 3300006048 Bacteria 11717
58 Ga0075363_100014383 3300006048 Bacteria 3865
59 Ga0075364_10022378 3300006051 Bacteria 3991
60 Ga0075364_10033379 3300006051 Bacteria 3314
61 Ga0075364_10037384 3300006051 Bacteria 3143
62 Ga0075364_10078841 3300006051 Bacteria 2176
63 Ga0075367_10002364 3300006178 Bacteria 8578
64 Ga0075428_100005438 3300006844 Bacteria 14158
65 Ga0075428_100136124 3300006844 Bacteria 2671
66 Ga0075430_100002279 3300006846 Bacteria 15890
67 Ga0075431_100000688 3300006847 Bacteria 29046
68 Ga0075429_100003294 3300006880 Bacteria 13748
69 Ga0105240_10029994 3300009093 Bacteria 7075
70 Ga0111539_10212471 3300009094 Bacteria 2254
71 Ga0105245_10003182 3300009098 Bacteria 14677
72 Ga0114129_10002282 3300009147 Bacteria 26556
73 Ga0105243_10011888 3300009148 Bacteria 6584
74 Ga0105243_10098821 3300009148 Bacteria 2418
75 Ga0105243_10252207 3300009148 Bacteria 1576
76 Ga0105242_10043114 3300009176 Bacteria 3648
77 Ga0105248_10054259 3300009177 Bacteria 4494
78 Ga0105248_10233017 3300009177 Bacteria 2073
79 Ga0105237_10033213 3300009545 Bacteria 5227
80 Ga0105237_10036682 3300009545 Bacteria 4960
81 Ga0105237_10216971 3300009545 Bacteria 1913
82 Ga0105237_10258714 3300009545 Bacteria 1743
83 Ga0105238_10009859 3300009551 Bacteria 9571
84 Ga0105249_10198365 3300009553 Bacteria 1963
85 Ga0105239_10008974 3300010375 Bacteria 11315
86 Ga0105246_10002020 3300011119 Bacteria 12263
87 Ga0157369_10098845 3300013105 Bacteria 3111
88 Ga0157374_10040112 3300013296 Bacteria 4310
89 Ga0163162_10029343 3300013306 Bacteria 5443
90 Ga0163162_10289145 3300013306 Bacteria 1771
91 Ga0157372_10040655 3300013307 Bacteria 5137
92 Ga0157372_10146109 3300013307 Bacteria 2727
93 Ga0157372_10187267 3300013307 Bacteria 2397
94 Ga0157372_10206606 3300013307 Bacteria 2275
95 Ga0157375_10030583 3300013308 Bacteria 5079
96 Ga0157375_10045488 3300013308 Bacteria 4272
97 Ga0163163_10028395 3300014325 Bacteria 5371
98 Ga0163163_10034092 3300014325 Bacteria 4928
99 Ga0157380_10042933 3300014326 Bacteria 3537
100 Ga0182008_10034949 3300014497 Bacteria 2519
101 Ga0157377_10046558 3300014745 Bacteria 2426
102 Ga0157379_10004668 3300014968 Bacteria 11758
103 Ga0206356_10453459 3300020070 Bacteria 3185
104 Ga0206356_11132904 3300020070 Bacteria 3813
105 Ga0206349_1622728 3300020075 Bacteria 2391
106 Ga0206350_10630687 3300020080 Bacteria 1833
107 Ga0206354_10570980 3300020081 Bacteria 3053
108 Ga0206353_10225234 3300020082 Bacteria 4346
109 Ga0206353_10654821 3300020082 Bacteria 3250
110 Ga0224712_10001806 3300022467 Bacteria 5103
111 Ga0224712_10004801 3300022467 Bacteria 3689
112 Ga0224712_10005351 3300022467 Bacteria 3564
113 Ga0224712_10005871 3300022467 Bacteria 3459
114 Ga0207688_10003707 3300025901 Bacteria 8343
115 Ga0207647_10006912 3300025904 Bacteria 8226
116 Ga0207647_10062276 3300025904 Bacteria 2273
117 Ga0207685_10061560 3300025905 Bacteria 1488
118 Ga0207699_10015559 3300025906 Bacteria 3955
119 Ga0207643_10028887 3300025908 Bacteria 3082
120 Ga0207705_10159552 3300025909 Bacteria 1694
121 Ga0207695_10003251 3300025913 Bacteria 23099
122 Ga0207695_10003836 3300025913 Bacteria 20810
123 Ga0207671_10005080 3300025914 Bacteria 12290
124 Ga0207671_10092164 3300025914 Bacteria 2284
125 Ga0207671_10225479 3300025914 Bacteria 1469
126 Ga0207660_10012320 3300025917 Bacteria 5593
127 Ga0207662_10013033 3300025918 Bacteria 4643
128 Ga0207662_10046784 3300025918 Bacteria 2561
129 Ga0207657_10035942 3300025919 Bacteria 4437
130 Ga0207657_10048512 3300025919 Bacteria 3707
131 Ga0207646_10050220 3300025922 Bacteria 3733
132 Ga0207694_10000342 3300025924 Bacteria 44161
133 Ga0207687_10268088 3300025927 Bacteria 1364
134 Ga0207700_10215546 3300025928 Bacteria 1625
135 Ga0207664_10012904 3300025929 Bacteria 5987
136 Ga0207664_10017062 3300025929 Bacteria 5310
137 Ga0207690_10156051 3300025932 Bacteria 1697
138 Ga0207670_10193358 3300025936 Bacteria 1541
139 Ga0207704_10051061 3300025938 Bacteria 2498
140 Ga0207704_10171912 3300025938 Bacteria 1555
141 Ga0207691_10001144 3300025940 Bacteria 26303
142 Ga0207711_10030898 3300025941 Bacteria 4518
143 Ga0207661_10011121 3300025944 Bacteria 6506
144 Ga0207661_10020487 3300025944 Bacteria 4944
145 Ga0207661_10026302 3300025944 Bacteria 4432
146 Ga0207661_10091275 3300025944 Bacteria 2537
147 Ga0207679_10076627 3300025945 Bacteria 2542
148 Ga0207679_10260628 3300025945 Bacteria 1478
149 Ga0207667_10066615 3300025949 Bacteria 3753
150 Ga0207667_10207759 3300025949 Bacteria 2007
151 Ga0207651_10085401 3300025960 Bacteria 2290
152 Ga0207668_10157511 3300025972 Bacteria 1766
153 Ga0207640_10024444 3300025981 Bacteria 3645
154 Ga0207677_10050669 3300026023 Bacteria 2810
155 Ga0207639_10083515 3300026041 Bacteria 2535
156 Ga0207639_10094591 3300026041 Bacteria 2399
157 Ga0207708_10000682 3300026075 Bacteria 25816
158 Ga0207708_10033099 3300026075 Bacteria 3926
159 Ga0207708_10056724 3300026075 Bacteria 2988
160 Ga0207708_10196276 3300026075 Bacteria 1608
161 Ga0207702_10042935 3300026078 Bacteria 3794
162 Ga0207702_10186828 3300026078 Bacteria 1912
163 Ga0207702_10198816 3300026078 Bacteria 1857
164 Ga0207648_10012248 3300026089 Bacteria 8030
165 Ga0207676_10100550 3300026095 Bacteria 2396
166 Ga0207674_10038457 3300026116 Bacteria 4964
167 Ga0207675_100002695 3300026118 Bacteria 17523
168 Ga0207675_100080169 3300026118 Bacteria 3060
169 Ga0207683_10020195 3300026121 Bacteria 5695
170 Ga0207698_10004391 3300026142 Bacteria 8591
171 Ga0209813_10002483 3300027866 Bacteria 4221
172 Ga0209813_10007973 3300027866 Bacteria 2659
173 Ga0268266_10004252 3300028379 Bacteria 13772
174 Ga0268264_10000510 3300028381 Bacteria 50047
175 Ga0314311_1017403 3300030733 Bacteria 2233
176 Ga0307509_10026446 3300031507 Bacteria 6470
177 Ga0316575_10000437 3300031665 Bacteria 11888
178 Ga0316575_10008841 3300031665 Bacteria 3677
179 Ga0316579_10013416 3300031691 Bacteria 3524
180 Ga0316576_10001895 3300031727 Bacteria 11638
181 Ga0316576_10014932 3300031727 Bacteria 5196
182 Ga0316576_10019780 3300031727 Bacteria 4618
183 Ga0316578_10023057 3300031728 Bacteria 3480
184 Ga0316578_10026134 3300031728 Bacteria 3290
185 Ga0307405_10085045 3300031731 Bacteria 2078
186 Ga0307405_10090312 3300031731 Bacteria 2026
187 Ga0316577_10002292 3300031733 Bacteria 9437
188 Ga0316577_10005229 3300031733 Bacteria 6790
189 Ga0307413_10044035 3300031824 Bacteria 2635
190 Ga0307413_10060526 3300031824 Bacteria 2332
191 Ga0307410_10017963 3300031852 Bacteria 4261
192 Ga0307406_10147104 3300031901 Bacteria 1676
193 Ga0307407_10011430 3300031903 Bacteria 4225
194 Ga0307407_10027347 3300031903 Bacteria 3034
195 Ga0307407_10043517 3300031903 Bacteria 2525
196 Ga0307416_100016196 3300032002 Bacteria 5173
197 Ga0307416_100071537 3300032002 Bacteria 2882
198 Ga0307411_10019293 3300032005 Bacteria 3936
199 Ga0307415_100049255 3300032126 Bacteria 2848
200 Ga0307415_100237681 3300032126 Bacteria 1471
201 Ga0316583_10000929 3300032133 Bacteria 9433
202 Ga0316585_10013834 3300032137 Bacteria 2405
203 Ga0316580_10003997 3300032139 Bacteria 4244
204 Ga0316593_10005093 3300032168 Bacteria 3435
205 Ga0307507_10000008 3300033179 Bacteria 266336
206 Ga0316596_1002930 3300033541 Bacteria 3698
207 Ga0316574_0011148 3300035398 Bacteria 5100
208 Ga0316574_0013429 3300035398 Bacteria 4708
209 Ga0316574_0017339 3300035398 Bacteria 4214
210 Ga0316574_0043093 3300035398 Bacteria 2787
211 Ga0316582_0003116 3300036647 Bacteria 8031
212 Ga0316582_0013529 3300036647 Bacteria 4596
213 Ga0316582_0028395 3300036647 Bacteria 3389
214 Ga0316584_0000749 3300036712 Bacteria 18064
215 Ga0316584_0000987 3300036712 Bacteria 16361
216 Ga0316584_0042882 3300036712 Bacteria 3372
217 Ga0395899_0009626 3300037312 Bacteria 7416
218 Ga0395900_0037901 3300037418 Bacteria 4970
219 Ga0395900_0248557 3300037418 Bacteria 1781
220 Ga0395900_0284029 3300037418 Bacteria 1646
221 Ga0395898_0025361 3300037466 Bacteria 5975
222 Ga0395898_0110541 3300037466 Bacteria 2634
223 Ga0316581_0000038 3300037588 Bacteria 14543
224 Ga0395901_0018219 3300038443 Bacteria 7169
225 Ga0395901_0024639 3300038443 Bacteria 6179
226 Ga0451797_0017618 3300041453 Bacteria 2598
227 Ga0450907_007070 3300042146 Bacteria 1872
228 Ga0439464_0044191 3300042439 Bacteria 1276
229 Ga0466969_0000713 3300044656 Bacteria 17995
230 Ga0466969_0006709 3300044656 Bacteria 6120
231 Ga0466969_0010600 3300044656 Bacteria 4885
232 Ga0466969_0143403 3300044656 Bacteria 1103
233 Ga0466972_0061824 3300044658 Bacteria 1795
234 Ga0466965_0003157 3300044683 Bacteria 7188
235 Ga0466965_0003838 3300044683 Bacteria 6637
236 Ga0466965_0035400 3300044683 Bacteria 2446
237 Ga0466965_0037191 3300044683 Bacteria 2390
238 Ga0466965_0088634 3300044683 Bacteria 1571
239 Ga0466966_0014980 3300044684 Bacteria 5130
240 Ga0466966_0018198 3300044684 Bacteria 4636
241 Ga0466966_0025867 3300044684 Bacteria 3833
242 Ga0466966_0082419 3300044684 Bacteria 2002
243 Ga0466961_0007086 3300044693 Bacteria 7132
244 Ga0466961_0008461 3300044693 Bacteria 6554
245 Ga0466961_0014588 3300044693 Bacteria 5048
246 Ga0466961_0016752 3300044693 Bacteria 4711
247 Ga0466961_0040069 3300044693 Bacteria 3003
248 Ga0466961_0116731 3300044693 Bacteria 1677
249 Ga0466961_0121159 3300044693 Bacteria 1642
250 Ga0466963_0011308 3300044694 Bacteria 5431
251 Ga0466963_0164689 3300044694 Bacteria 1544
252 Ga0466971_0000240 3300044719 Bacteria 20933
253 Ga0466971_0004855 3300044719 Bacteria 5817
254 Ga0466968_0029803 3300044735 Bacteria 2258
255 Ga0466970_0003733 3300044765 Bacteria 7446
256 Ga0466970_0005060 3300044765 Bacteria 6517
257 Ga0466970_0014113 3300044765 Bacteria 4097
258 Ga0466970_0033236 3300044765 Bacteria 2727
259 Ga0466970_0060701 3300044765 Bacteria 2025
260 Ga0466970_0071862 3300044765 Bacteria 1861
261 Ga0466970_0084688 3300044765 Bacteria 1716
262 Ga0466957_0006991 3300044842 Bacteria 6378
263 Ga0466957_0014166 3300044842 Bacteria 4640
264 Ga0466957_0017446 3300044842 Bacteria 4205
265 Ga0466957_0039006 3300044842 Bacteria 2865
266 Ga0466957_0181765 3300044842 Bacteria 1374
267 Ga0466960_0018258 3300044901 Bacteria 3071
268 Ga0466959_0001242 3300045049 Bacteria 15406
269 Ga0466959_0003696 3300045049 Bacteria 10096
270 Ga0466959_0006498 3300045049 Bacteria 8103
271 Ga0466958_0006398 3300045836 Bacteria 6406
272 Ga0466967_0001845 3300045976 Bacteria 12751
273 Ga0466967_0008465 3300045976 Bacteria 7542
274 Ga0466967_0017387 3300045976 Bacteria 5707
275 Ga0466967_0020067 3300045976 Bacteria 5391
276 Ga0466967_0022411 3300045976 Bacteria 5152
277 Ga0466967_0100142 3300045976 Bacteria 2647
278 Ga0466967_0137912 3300045976 Bacteria 2270
279 Ga0466967_0186202 3300045976 Bacteria 1960
280 Ga0466967_0200721 3300045976 Bacteria 1889
281 Ga0495651_0000264 3300046462 Bacteria 40677
282 Ga0495651_0004105 3300046462 Bacteria 11144
283 Ga0495606_0001559 3300046507 Bacteria 30113
284 Ga0495618_0083576 3300046514 Bacteria 2040
285 Ga0495628_0001798 3300046516 Bacteria 19460
286 Ga0495628_0020384 3300046516 Bacteria 5469
287 Ga0495652_0001184 3300046529 Bacteria 29336
288 Ga0495652_0024678 3300046529 Bacteria 5320
289 Ga0495645_0059665 3300046543 Bacteria 2766
290 Ga0495622_0007545 3300046557 Bacteria 5049
291 Ga0495668_0000173 3300046616 Bacteria 95830
292 Ga0495625_0001109 3300046660 Bacteria 34897
293 Ga0495657_0046187 3300046675 Bacteria 2951
294 Ga0495646_0007285 3300046680 Bacteria 7026
295 Ga0495624_0138255 3300046690 Bacteria 1493
296 Ga0495600_0003290 3300046809 Bacteria 9475
297 Ga0495600_0037503 3300046809 Bacteria 3151
298 Ga0495626_0000267 3300048091 Bacteria 58992
299 Ga0496101_0021379 3300048904 Bacteria 4446
300 Ga0496101_0114875 3300048904 Bacteria 2030
301 Ga0496101_0165958 3300048904 Bacteria 1695
302 Ga0496102_0057700 3300048905 Bacteria 3546
303 Ga0496102_0137743 3300048905 Bacteria 2287
304 Ga0496103_0066701 3300048906 Bacteria 2246
305 Ga0496104_0005382 3300048907 Bacteria 11205
306 Ga0496105_0015129 3300048908 Bacteria 6140
307 Ga0496105_0037902 3300048908 Bacteria 3971
308 Ga0496105_0068541 3300048908 Bacteria 2931
309 Ga0496105_0076165 3300048908 Bacteria 2770
310 Ga0496106_0117763 3300048909 Bacteria 2073
311 Ga0496107_0005448 3300048910 Bacteria 8710
312 Ga0496107_0074690 3300048910 Bacteria 2466
313 Ga0496107_0079838 3300048910 Bacteria 2385
314 Ga0496108_0088492 3300048911 Bacteria 2631
315 Ga0496108_0157343 3300048911 Bacteria 1963
316 Ga0496109_0012869 3300048912 Bacteria 7232
317 Ga0496109_0041805 3300048912 Bacteria 4152
318 Ga0496109_0245897 3300048912 Bacteria 1684
319 Ga0496110_0069722 3300048913 Bacteria 3114
320 Ga0496110_0161277 3300048913 Bacteria 2033
321 Ga0496110_0230319 3300048913 Bacteria 1685
322 Ga0496111_0017648 3300048914 Bacteria 4934
323 Ga0496111_0021435 3300048914 Bacteria 4512
324 Ga0496111_0119737 3300048914 Bacteria 1944
325 Ga0496113_0045404 3300048916 Bacteria 3259
326 Ga0496114_0022319 3300048917 Bacteria 5157
327 Ga0496114_0042896 3300048917 Bacteria 3750
328 Ga0496114_0095718 3300048917 Bacteria 2527
329 Ga0496114_0139758 3300048917 Bacteria 2096
330 Ga0496114_0319567 3300048917 Bacteria 1371
331 Ga0496115_0002956 3300048918 Bacteria 12229
332 Ga0496115_0075873 3300048918 Bacteria 2732
333 Ga0496115_0163377 3300048918 Bacteria 1841
334 Ga0501307_001637 3300049162 Bacteria 1935
335 Ga0501311_000164 3300049527 Bacteria 3700
336 Ga0501312_004558 3300049528 Bacteria 1640
337 Ga0501315_000813 3300049531 Bacteria 2375
338 Ga0501316_002343 3300049532 Bacteria 1745
339 Ga0501317_000089 3300049533 Bacteria 4581
340 Ga0501317_000148 3300049533 Bacteria 3947
341 Ga0501317_002226 3300049533 Bacteria 1806
342 Ga0501321_000242 3300049537 Bacteria 3163
343 Ga0501321_000389 3300049537 Bacteria 2740
344 Ga0501323_000993 3300049539 Bacteria 2353
345 Ga0501323_002246 3300049539 Bacteria 1849
346 Ga0501324_000227 3300049540 Bacteria 2705
347 Ga0501324_000844 3300049540 Bacteria 1860
348 Ga0501031_0005125 3300049568 Bacteria 8533
349 Ga0501031_0006103 3300049568 Bacteria 7868
350 Ga0501031_0011816 3300049568 Bacteria 5694
351 Ga0501031_0014348 3300049568 Bacteria 5151
352 Ga0501032_0157411 3300049569 Bacteria 1492
353 Ga0501033_0037944 3300049570 Bacteria 3605
354 Ga0501033_0142133 3300049570 Bacteria 1735
355 Ga0501034_0016610 3300049571 Bacteria 7548
356 Ga0501034_0029475 3300049571 Bacteria 5578
357 Ga0501034_0125331 3300049571 Bacteria 2554
358 Ga0501036_0002089 3300049572 Bacteria 15576
359 Ga0501036_0011526 3300049572 Bacteria 7325
360 Ga0501036_0086627 3300049572 Bacteria 2647
361 Ga0501036_0226068 3300049572 Bacteria 1571
362 Ga0501036_0306232 3300049572 Bacteria 1328
363 Ga0501037_0003757 3300049573 Bacteria 11014
364 Ga0501037_0033320 3300049573 Bacteria 3805
365 Ga0501037_0119565 3300049573 Bacteria 1895
366 Ga0501037_0162599 3300049573 Bacteria 1591
367 Ga0501038_0006446 3300049574 Bacteria 10866
368 Ga0501038_0012289 3300049574 Bacteria 7820
369 Ga0501038_0187671 3300049574 Bacteria 1665
370 Ga0501038_0286053 3300049574 Bacteria 1297
371 Ga0501039_0020005 3300049575 Bacteria 5131
372 Ga0501039_0020614 3300049575 Bacteria 5052
373 Ga0501039_0042979 3300049575 Bacteria 3491
374 Ga0501039_0125351 3300049575 Bacteria 2014
375 Ga0501040_0012913 3300049576 Bacteria 5487
376 Ga0501040_0013080 3300049576 Bacteria 5457
377 Ga0501040_0096169 3300049576 Bacteria 2062
378 Ga0501040_0104798 3300049576 Bacteria 1975
379 Ga0501041_0012638 3300049577 Bacteria 5001
380 Ga0501041_0072747 3300049577 Bacteria 2112
381 Ga0501041_0098363 3300049577 Bacteria 1810
382 Ga0501042_0002904 3300049578 Bacteria 10638
383 Ga0501042_0019547 3300049578 Bacteria 4705
384 Ga0501042_0033007 3300049578 Bacteria 3668
385 Ga0501042_0093622 3300049578 Bacteria 2158
386 Ga0501043_0047757 3300049579 Bacteria 3365
387 Ga0501043_0111178 3300049579 Bacteria 2151
388 Ga0501046_0000417 3300049580 Bacteria 42443
389 Ga0501046_0019264 3300049580 Bacteria 5660
390 Ga0501046_0043853 3300049580 Bacteria 3559
391 Ga0501046_0046331 3300049580 Bacteria 3451
392 Ga0501046_0057908 3300049580 Bacteria 3039
393 Ga0501047_0012599 3300049581 Bacteria 8011
394 Ga0501047_0025941 3300049581 Bacteria 5635
395 Ga0501047_0135566 3300049581 Bacteria 2342
396 Ga0501048_0011041 3300049582 Bacteria 6737
397 Ga0501048_0012681 3300049582 Bacteria 6266
398 Ga0501048_0017355 3300049582 Bacteria 5304
399 Ga0501048_0039744 3300049582 Bacteria 3373
400 Ga0501048_0052411 3300049582 Bacteria 2904
401 Ga0501067_0000923 3300049583 Bacteria 15771
402 Ga0501067_0002311 3300049583 Bacteria 10537
403 Ga0501067_0012494 3300049583 Bacteria 4710
404 Ga0501067_0026395 3300049583 Bacteria 3217
405 Ga0501068_0010066 3300049584 Bacteria 5307
406 Ga0501068_0020039 3300049584 Bacteria 3892
407 Ga0501068_0081345 3300049584 Bacteria 1988
408 Ga0501068_0137927 3300049584 Bacteria 1528
409 Ga0501069_0011677 3300049585 Bacteria 4657
410 Ga0501069_0042852 3300049585 Bacteria 2504
411 Ga0501069_0065408 3300049585 Bacteria 2033
412 Ga0501069_0104392 3300049585 Bacteria 1610
413 Ga0501070_0002641 3300049586 Bacteria 15647
414 Ga0501070_0006106 3300049586 Bacteria 10267
415 Ga0501070_0038071 3300049586 Bacteria 4013
416 Ga0501070_0052324 3300049586 Bacteria 3389
417 Ga0501070_0094799 3300049586 Bacteria 2470
418 Ga0501070_0258304 3300049586 Bacteria 1424
419 Ga0501071_0002855 3300049587 Bacteria 10654
420 Ga0501071_0020061 3300049587 Bacteria 4644
421 Ga0501072_0013958 3300049588 Bacteria 6155
422 Ga0501072_0014341 3300049588 Bacteria 6075
423 Ga0501072_0079170 3300049588 Bacteria 2602
424 Ga0501073_0016195 3300049589 Bacteria 5402
425 Ga0501073_0034120 3300049589 Bacteria 3622
426 Ga0501073_0117711 3300049589 Bacteria 1841
427 Ga0501074_0003634 3300049590 Bacteria 10948
428 Ga0501074_0011544 3300049590 Bacteria 6424
429 Ga0501074_0069973 3300049590 Bacteria 2523
430 Ga0501074_0072416 3300049590 Bacteria 2475
431 Ga0501075_0035075 3300049591 Bacteria 3740
432 Ga0501075_0067829 3300049591 Bacteria 2694
433 Ga0501075_0074291 3300049591 Bacteria 2571
434 Ga0501076_0018654 3300049592 Bacteria 5294
435 Ga0501077_0039424 3300049593 Bacteria 3009
436 Ga0501077_0068252 3300049593 Bacteria 2254
437 Ga0501077_0105660 3300049593 Bacteria 1784
438 Ga0501079_0014879 3300049741 Bacteria 5930
439 Ga0501079_0025813 3300049741 Bacteria 4506
440 Ga0501080_0014846 3300049742 Bacteria 7173
441 Ga0501080_0025452 3300049742 Bacteria 5493
442 Ga0501080_0026172 3300049742 Bacteria 5419
443 Ga0501080_0042815 3300049742 Bacteria 4215
444 Ga0501080_0078561 3300049742 Bacteria 3069
445 Ga0501081_0166178 3300049743 Bacteria 1592
446 Ga0501083_0004021 3300049744 Bacteria 10335
447 Ga0501035_0009014 3300049822 Bacteria 9278
448 Ga0501035_0009023 3300049822 Bacteria 9276
449 Ga0501035_0209872 3300049822 Bacteria 1666
450 Ga0501044_0012300 3300049823 Bacteria 9266
451 Ga0501044_0017836 3300049823 Bacteria 7614
452 Ga0501044_0205916 3300049823 Bacteria 1924
453 Ga0501045_0007874 3300049824 Bacteria 7418
454 Ga0501045_0046491 3300049824 Bacteria 3161
455 Ga0501045_0083812 3300049824 Bacteria 2352
456 Ga0501045_0164674 3300049824 Bacteria 1651
457 nmdc:mga03683_558_c1 3300050489 Bacteria 10707
458 nmdc:mga03n38_24174_c1 3300050490 Bacteria 2482
459 nmdc:mga03n38_25898_c1 3300050490 Bacteria 2416
460 nmdc:mga00v17_110072_c1 3300050491 Bacteria 1747
461 nmdc:mga00v17_52705_c1 3300050491 Bacteria 2477
462 nmdc:mga00v17_57907_c1 3300050491 Bacteria 2372
463 nmdc:mga0yw44_103672_c1 3300050492 Bacteria 1815
464 nmdc:mga0yw44_115211_c1 3300050492 Bacteria 1726
465 nmdc:mga0yw44_117564_c1 3300050492 Bacteria 1710
466 nmdc:mga0yw44_133020_c1 3300050492 Bacteria 1612
467 nmdc:mga0yw44_143540_c1 3300050492 Bacteria 1553
468 nmdc:mga0yw44_24864_c1 3300050492 Bacteria 3396
469 nmdc:mga0yw44_304_c1 3300050492 Bacteria 16988
470 nmdc:mga0yw44_4249_c1 3300050492 Bacteria 6530
471 nmdc:mga0yw44_56293_c1 3300050492 Bacteria 2395
472 nmdc:mga06z11_152968_c1 3300050494 Bacteria 1313
473 nmdc:mga06z11_2621_c1 3300050494 Bacteria 6892
474 nmdc:mga04h51_6010_c1 3300050495 Bacteria 3125
475 nmdc:mga07m45_10848_c1 3300050496 Bacteria 4772
476 nmdc:mga07m45_6579_c1 3300050496 Bacteria 5886
477 nmdc:mga07m45_68985_c1 3300050496 Bacteria 2010
478 nmdc:mga07m45_72657_c1 3300050496 Bacteria 1958
479 nmdc:mga05p37_46222_c1 3300050507 Bacteria 5353
480 nmdc:mga09592_902_c1 3300050508 Bacteria 23321
481 nmdc:mga0qj67_5132_c1 3300050509 Bacteria 9540
482 nmdc:mga06r32_19952_c1 3300050510 Bacteria 6163
483 Ga0495612_0000755 3300053078 Bacteria 13181
484 Ga0495612_0001143 3300053078 Bacteria 10900
485 Ga0495619_0024599 3300053085 Bacteria 3864
486 Ga0495619_0039828 3300053085 Bacteria 3069
487 Ga0495619_0119307 3300053085 Bacteria 1808
488 Ga0500644_0060471 3300053088 Bacteria 1332
489 Ga0500556_0001235 3300053104 Bacteria 11863
490 Ga0500593_001163 3300053117 Bacteria 9497
491 Ga0500573_0007544 3300053140 Bacteria 5938
492 Ga0501084_0016774 3300054114 Bacteria 6085
493 Ga0501084_0044527 3300054114 Bacteria 3715
494 Ga0501084_0098928 3300054114 Bacteria 2449
495 Ga0501082_0033066 3300060353 Bacteria 4460
496 Ga0501082_0205933 3300060353 Bacteria 1711
497 Ga0466962_0000194 3300061719 Bacteria 25158
498 Ga0466962_0010687 3300061719 Bacteria 4416
499 Ga0466962_0020969 3300061719 Bacteria 3140
500 Ga0530510_0067833 3300061734 Bacteria 2587
501 Ga0530510_0359930 3300061734 Bacteria 1093
502 2552105018 2551306166 Bacteria 9731570
503 2643826599 2643221561 Bacteria 4984412
504 2643891214 2643221576 Bacteria 5214352
505 2643960262 2643221590 Bacteria 5214697
506 2644036309 2643221604 Bacteria 5014917
507 2644093785 2643221615 Bacteria 5487866
508 2644101930 2643221617 Bacteria 5139111
509 2644115153 2643221620 Bacteria 5134593
510 2644229844 2643221641 Bacteria 4490190
511 2644323628 2643221657 Bacteria 5490246
512 2644535637 2643221696 Bacteria 5431823
513 2738870115 2738541305 Bacteria 4910150
514 2740167791 2739367898 Bacteria 4367674
515 2774397275 2773857762 Bacteria 5971770
516 2809193603 2808606439 Bacteria 5952208
517 2812333521 2811994874 Bacteria 5367947
518 2812352492 2811994878 Bacteria 5992952
519 2855390949 2855386786 Bacteria 4752232
520 2857485502 2857481737 Bacteria 4761446
521 2887480928 2887478801 Bacteria 8972725
522 2891969922 2891968417 Bacteria 5821697
523 2984576677 2984576629 Bacteria 4248407
524 2990258441 2990256926 Bacteria 4252839
525 8001785395 8001781756 Bacteria 9586736
526 8054610639 8054609563 Bacteria 5170090
527 Ga0500644_0000053
528 Ga0070658_10041593
529 Ga0070683_100017736
530 Ga0070683_100052260
531 Ga0070683_100092642
532 Ga0070680_100044971
533 Ga0070682_100008102
534 Ga0070682_100081926
535 Ga0070682_100106268
536 Ga0070660_100054517
537 Ga0070660_100107229
538 Ga0070674_100151301
539 Ga0070673_100027915
540 Ga0070667_100258392
541 Ga0070714_100022738
542 Ga0070700_100014093
543 Ga0070700_100070097
544 Ga0070663_100042194
545 Ga0070663_100072081
546 Ga0070681_10097190
547 Ga0070681_10238893
548 Ga0070707_100035467
549 Ga0070679_100026136
550 Ga0070679_100116402
551 Ga0070684_100023375
552 Ga0070684_100226174
553 Ga0068853_100168431
554 Ga0068853_100189603
555 Ga0070665_100000151
556 Ga0070665_100017404
557 Ga0068855_100010862
558 Ga0068857_100094882
559 Ga0068857_100169508
560 Ga0068854_100016207
561 Ga0068856_100075597
562 Ga0070702_100039962
563 Ga0070702_100053892
564 Ga0068852_100018206
565 Ga0068852_100102370
566 Ga0068864_100273203
567 Ga0068870_10095068
568 Ga0068870_10101071
569 Ga0068860_100000669
570 Ga0068862_100075048
571 Ga0081455_10038396
572 Ga0081539_10033336
573 Ga0075365_10000470
574 Ga0075365_10001880
575 Ga0075365_10026811
576 Ga0075365_10101482
577 Ga0075365_10101491
578 Ga0075365_10115034
579 Ga0075365_10134744
580 Ga0075368_10004248
581 Ga0075368_10008967
582 Ga0075368_10019797
583 Ga0075363_100000621
584 Ga0075363_100014383
585 Ga0075364_10022378
586 Ga0075364_10033379
587 Ga0075364_10037384
588 Ga0075364_10078841
589 Ga0075367_10002364
590 Ga0075428_100005438
591 Ga0075428_100136124
592 Ga0075430_100002279
593 Ga0075431_100000688
594 Ga0075429_100003294
595 Ga0105240_10029994
596 Ga0111539_10212471
597 Ga0105245_10003182
598 Ga0114129_10002282
599 Ga0105243_10011888
600 Ga0105243_10098821
601 Ga0105243_10252207
602 Ga0105242_10043114
603 Ga0105248_10054259
604 Ga0105248_10233017
605 Ga0105237_10033213
606 Ga0105237_10036682
607 Ga0105237_10216971
608 Ga0105237_10258714
609 Ga0105238_10009859
610 Ga0105249_10198365
611 Ga0105239_10008974
612 Ga0105246_10002020
613 Ga0157369_10098845
614 Ga0157374_10040112
615 Ga0163162_10029343
616 Ga0163162_10289145
617 Ga0157372_10040655
618 Ga0157372_10146109
619 Ga0157372_10187267
620 Ga0157372_10206606
621 Ga0157375_10030583
622 Ga0157375_10045488
623 Ga0163163_10028395
624 Ga0163163_10034092
625 Ga0157380_10042933
626 Ga0182008_10034949
627 Ga0157377_10046558
628 Ga0157379_10004668
629 Ga0206356_10453459
630 Ga0206356_11132904
631 Ga0206349_1622728
632 Ga0206350_10630687
633 Ga0206354_10570980
634 Ga0206353_10225234
635 Ga0206353_10654821
636 Ga0224712_10001806
637 Ga0224712_10004801
638 Ga0224712_10005351
639 Ga0224712_10005871
640 Ga0207688_10003707
641 Ga0207647_10006912
642 Ga0207647_10062276
643 Ga0207685_10061560
644 Ga0207699_10015559
645 Ga0207643_10028887
646 Ga0207705_10159552
647 Ga0207695_10003251
648 Ga0207695_10003836
649 Ga0207671_10005080
650 Ga0207671_10092164
651 Ga0207671_10225479
652 Ga0207660_10012320
653 Ga0207662_10013033
654 Ga0207662_10046784
655 Ga0207657_10035942
656 Ga0207657_10048512
657 Ga0207646_10050220
658 Ga0207694_10000342
659 Ga0207687_10268088
660 Ga0207700_10215546
661 Ga0207664_10012904
662 Ga0207664_10017062
663 Ga0207690_10156051
664 Ga0207670_10193358
665 Ga0207704_10051061
666 Ga0207704_10171912
667 Ga0207691_10001144
668 Ga0207711_10030898
669 Ga0207661_10011121
670 Ga0207661_10020487
671 Ga0207661_10026302
672 Ga0207661_10091275
673 Ga0207679_10076627
674 Ga0207679_10260628
675 Ga0207667_10066615
676 Ga0207667_10207759
677 Ga0207651_10085401
678 Ga0207668_10157511
679 Ga0207640_10024444
680 Ga0207677_10050669
681 Ga0207639_10083515
682 Ga0207639_10094591
683 Ga0207708_10000682
684 Ga0207708_10033099
685 Ga0207708_10056724
686 Ga0207708_10196276
687 Ga0207702_10042935
688 Ga0207702_10186828
689 Ga0207702_10198816
690 Ga0207648_10012248
691 Ga0207676_10100550
692 Ga0207674_10038457
693 Ga0207675_100002695
694 Ga0207675_100080169
695 Ga0207683_10020195
696 Ga0207698_10004391
697 Ga0209813_10002483
698 Ga0209813_10007973
699 Ga0268266_10004252
700 Ga0268264_10000510
701 Ga0314311_1017403
702 Ga0307509_10026446
703 Ga0316575_10000437
704 Ga0316575_10008841
705 Ga0316579_10013416
706 Ga0316576_10001895
707 Ga0316576_10014932
708 Ga0316576_10019780
709 Ga0316578_10023057
710 Ga0316578_10026134
711 Ga0307405_10085045
712 Ga0307405_10090312
713 Ga0316577_10002292
714 Ga0316577_10005229
715 Ga0307413_10044035
716 Ga0307413_10060526
717 Ga0307410_10017963
718 Ga0307406_10147104
719 Ga0307407_10011430
720 Ga0307407_10027347
721 Ga0307407_10043517
722 Ga0307416_100016196
723 Ga0307416_100071537
724 Ga0307411_10019293
725 Ga0307415_100049255
726 Ga0307415_100237681
727 Ga0316583_10000929
728 Ga0316585_10013834
729 Ga0316580_10003997
730 Ga0316593_10005093
731 Ga0307507_10000008
732 Ga0316596_1002930
733 Ga0316574_0011148
734 Ga0316574_0013429
735 Ga0316574_0017339
736 Ga0316574_0043093
737 Ga0316582_0003116
738 Ga0316582_0013529
739 Ga0316582_0028395
740 Ga0316584_0000749
741 Ga0316584_0000987
742 Ga0316584_0042882
743 Ga0395899_0009626
744 Ga0395900_0037901
745 Ga0395900_0248557
746 Ga0395900_0284029
747 Ga0395898_0025361
748 Ga0395898_0110541
749 Ga0316581_0000038
750 Ga0395901_0018219
751 Ga0395901_0024639
752 Ga0451797_0017618
753 Ga0450907_007070
754 Ga0439464_0044191
755 Ga0466969_0000713
756 Ga0466969_0006709
757 Ga0466969_0010600
758 Ga0466969_0143403
759 Ga0466972_0061824
760 Ga0466965_0003157
761 Ga0466965_0003838
762 Ga0466965_0035400
763 Ga0466965_0037191
764 Ga0466965_0088634
765 Ga0466966_0014980
766 Ga0466966_0018198
767 Ga0466966_0025867
768 Ga0466966_0082419
769 Ga0466961_0007086
770 Ga0466961_0008461
771 Ga0466961_0014588
772 Ga0466961_0016752
773 Ga0466961_0040069
774 Ga0466961_0116731
775 Ga0466961_0121159
776 Ga0466963_0011308
777 Ga0466963_0164689
778 Ga0466971_0000240
779 Ga0466971_0004855
780 Ga0466968_0029803
781 Ga0466970_0003733
782 Ga0466970_0005060
783 Ga0466970_0014113
784 Ga0466970_0033236
785 Ga0466970_0060701
786 Ga0466970_0071862
787 Ga0466970_0084688
788 Ga0466957_0006991
789 Ga0466957_0014166
790 Ga0466957_0017446
791 Ga0466957_0039006
792 Ga0466957_0181765
793 Ga0466960_0018258
794 Ga0466959_0001242
795 Ga0466959_0003696
796 Ga0466959_0006498
797 Ga0466958_0006398
798 Ga0466967_0001845
799 Ga0466967_0008465
800 Ga0466967_0017387
801 Ga0466967_0020067
802 Ga0466967_0022411
803 Ga0466967_0100142
804 Ga0466967_0137912
805 Ga0466967_0186202
806 Ga0466967_0200721
807 Ga0495651_0000264
808 Ga0495651_0004105
809 Ga0495606_0001559
810 Ga0495618_0083576
811 Ga0495628_0001798
812 Ga0495628_0020384
813 Ga0495652_0001184
814 Ga0495652_0024678
815 Ga0495645_0059665
816 Ga0495622_0007545
817 Ga0495668_0000173
818 Ga0495625_0001109
819 Ga0495657_0046187
820 Ga0495646_0007285
821 Ga0495624_0138255
822 Ga0495600_0003290
823 Ga0495600_0037503
824 Ga0495626_0000267
825 Ga0496101_0021379
826 Ga0496101_0114875
827 Ga0496101_0165958
828 Ga0496102_0057700
829 Ga0496102_0137743
830 Ga0496103_0066701
831 Ga0496104_0005382
832 Ga0496105_0015129
833 Ga0496105_0037902
834 Ga0496105_0068541
835 Ga0496105_0076165
836 Ga0496106_0117763
837 Ga0496107_0005448
838 Ga0496107_0074690
839 Ga0496107_0079838
840 Ga0496108_0088492
841 Ga0496108_0157343
842 Ga0496109_0012869
843 Ga0496109_0041805
844 Ga0496109_0245897
845 Ga0496110_0069722
846 Ga0496110_0161277
847 Ga0496110_0230319
848 Ga0496111_0017648
849 Ga0496111_0021435
850 Ga0496111_0119737
851 Ga0496113_0045404
852 Ga0496114_0022319
853 Ga0496114_0042896
854 Ga0496114_0095718
855 Ga0496114_0139758
856 Ga0496114_0319567
857 Ga0496115_0002956
858 Ga0496115_0075873
859 Ga0496115_0163377
860 Ga0501307_001637
861 Ga0501311_000164
862 Ga0501312_004558
863 Ga0501315_000813
864 Ga0501316_002343
865 Ga0501317_000089
866 Ga0501317_000148
867 Ga0501317_002226
868 Ga0501321_000242
869 Ga0501321_000389
870 Ga0501323_000993
871 Ga0501323_002246
872 Ga0501324_000227
873 Ga0501324_000844
874 Ga0501031_0005125
875 Ga0501031_0006103
876 Ga0501031_0011816
877 Ga0501031_0014348
878 Ga0501032_0157411
879 Ga0501033_0037944
880 Ga0501033_0142133
881 Ga0501034_0016610
882 Ga0501034_0029475
883 Ga0501034_0125331
884 Ga0501036_0002089
885 Ga0501036_0011526
886 Ga0501036_0086627
887 Ga0501036_0226068
888 Ga0501036_0306232
889 Ga0501037_0003757
890 Ga0501037_0033320
891 Ga0501037_0119565
892 Ga0501037_0162599
893 Ga0501038_0006446
894 Ga0501038_0012289
895 Ga0501038_0187671
896 Ga0501038_0286053
897 Ga0501039_0020005
898 Ga0501039_0020614
899 Ga0501039_0042979
900 Ga0501039_0125351
901 Ga0501040_0012913
902 Ga0501040_0013080
903 Ga0501040_0096169
904 Ga0501040_0104798
905 Ga0501041_0012638
906 Ga0501041_0072747
907 Ga0501041_0098363
908 Ga0501042_0002904
909 Ga0501042_0019547
910 Ga0501042_0033007
911 Ga0501042_0093622
912 Ga0501043_0047757
913 Ga0501043_0111178
914 Ga0501046_0000417
915 Ga0501046_0019264
916 Ga0501046_0043853
917 Ga0501046_0046331
918 Ga0501046_0057908
919 Ga0501047_0012599
920 Ga0501047_0025941
921 Ga0501047_0135566
922 Ga0501048_0011041
923 Ga0501048_0012681
924 Ga0501048_0017355
925 Ga0501048_0039744
926 Ga0501048_0052411
927 Ga0501067_0000923
928 Ga0501067_0002311
929 Ga0501067_0012494
930 Ga0501067_0026395
931 Ga0501068_0010066
932 Ga0501068_0020039
933 Ga0501068_0081345
934 Ga0501068_0137927
935 Ga0501069_0011677
936 Ga0501069_0042852
937 Ga0501069_0065408
938 Ga0501069_0104392
939 Ga0501070_0002641
940 Ga0501070_0006106
941 Ga0501070_0038071
942 Ga0501070_0052324
943 Ga0501070_0094799
944 Ga0501070_0258304
945 Ga0501071_0002855
946 Ga0501071_0020061
947 Ga0501072_0013958
948 Ga0501072_0014341
949 Ga0501072_0079170
950 Ga0501073_0016195
951 Ga0501073_0034120
952 Ga0501073_0117711
953 Ga0501074_0003634
954 Ga0501074_0011544
955 Ga0501074_0069973
956 Ga0501074_0072416
957 Ga0501075_0035075
958 Ga0501075_0067829
959 Ga0501075_0074291
960 Ga0501076_0018654
961 Ga0501077_0039424
962 Ga0501077_0068252
963 Ga0501077_0105660
964 Ga0501079_0014879
965 Ga0501079_0025813
966 Ga0501080_0014846
967 Ga0501080_0025452
968 Ga0501080_0026172
969 Ga0501080_0042815
970 Ga0501080_0078561
971 Ga0501081_0166178
972 Ga0501083_0004021
973 Ga0501035_0009014
974 Ga0501035_0009023
975 Ga0501035_0209872
976 Ga0501044_0012300
977 Ga0501044_0017836
978 Ga0501044_0205916
979 Ga0501045_0007874
980 Ga0501045_0046491
981 Ga0501045_0083812
982 Ga0501045_0164674
983 nmdc:mga03683_558_c1
984 nmdc:mga03n38_24174_c1
985 nmdc:mga03n38_25898_c1
986 nmdc:mga00v17_110072_c1
987 nmdc:mga00v17_52705_c1
988 nmdc:mga00v17_57907_c1
989 nmdc:mga0yw44_103672_c1
990 nmdc:mga0yw44_115211_c1
991 nmdc:mga0yw44_117564_c1
992 nmdc:mga0yw44_133020_c1
993 nmdc:mga0yw44_143540_c1
994 nmdc:mga0yw44_24864_c1
995 nmdc:mga0yw44_304_c1
996 nmdc:mga0yw44_4249_c1
997 nmdc:mga0yw44_56293_c1
998 nmdc:mga06z11_152968_c1
999 nmdc:mga06z11_2621_c1
1000 nmdc:mga04h51_6010_c1
1001 nmdc:mga07m45_10848_c1
1002 nmdc:mga07m45_6579_c1
1003 nmdc:mga07m45_68985_c1
1004 nmdc:mga07m45_72657_c1
1005 nmdc:mga05p37_46222_c1
1006 nmdc:mga09592_902_c1
1007 nmdc:mga0qj67_5132_c1
1008 nmdc:mga06r32_19952_c1
1009 Ga0495612_0000755
1010 Ga0495612_0001143
1011 Ga0495619_0024599
1012 Ga0495619_0039828
1013 Ga0495619_0119307
1014 Ga0500644_0060471
1015 Ga0500556_0001235
1016 Ga0500593_001163
1017 Ga0500573_0007544
1018 Ga0501084_0016774
1019 Ga0501084_0044527
1020 Ga0501084_0098928
1021 Ga0501082_0033066
1022 Ga0501082_0205933
1023 Ga0466962_0000194
1024 Ga0466962_0010687
1025 Ga0466962_0020969
1026 Ga0530510_0067833
1027 Ga0530510_0359930
1028 2552105018
1029 2643826599
1030 2643891214
1031 2643960262
1032 2644036309
1033 2644093785
1034 2644101930
1035 2644115153
1036 2644229844
1037 2644323628
1038 2644535637
1039 2738870115
1040 2740167791
1041 2774397275
1042 2809193603
1043 2812333521
1044 2812352492
1045 2855390949
1046 2857485502
1047 2887480928
1048 2891969922
1049 2984576677
1050 2990258441
1051 8001785395
1052 8054610639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02801

Ketoacyl-synt_C

Beta-ketoacyl synthase, C-terminal domain

291

406

0.97

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

33

283

0.92

PF00108

Thiolase_N

Thiolase, N-terminal domain

170

248

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j3n-assembly1.cif.gz_A crystal structure of 3-oxoacyl-(acyl-carrier protein) synthase ii from thermus thermophilus hb8 0.9772 4 412
1j3n-assembly1.cif.gz_A crystal structure of 3-oxoacyl-(acyl-carrier protein) synthase ii from thermus thermophilus hb8 0.9725 4 412
4jrm-assembly2.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) from vibrio cholerae (space group p212121) at 1.75 angstrom 0.9717 4 412
4r8e-assembly1.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) from yersinia pestis 0.9707 4 412
3g0y-assembly1.cif.gz_A structure of e. coli fabf(c163q) in complex with dihydroplatensimycin 0.9698 4 412
ID Description Score Start End Superfamily
af_C6KT99_32_472_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9698 4 412 3.40.47.10
af_P0AAI5_1_413_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9672 1 412 3.40.47.10
af_O94297_1_425_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.966 4 412 3.40.47.10
af_P0AAI5_1_413_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9649 1 412 3.40.47.10
af_Q9VNF5_9_438_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9625 4 412 3.40.47.10
ID Description Score Start End GO Terms
AF-X1NXM5-F1-model_v4 Ketosynthase family 3 (KS3) domain-containing protein 0.9818 93 379 GO:0004315
GO:0006633
AF-X0W266-F1-model_v4 Ketosynthase family 3 (KS3) domain-containing protein 0.9805 98 359 GO:0004315
GO:0006633
AF-A0A327ZIV7-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase II 0.9793 1 412 GO:0004315
GO:0005829
GO:0006633
AF-Q50FD3-F1-model_v4 Ketoacyl synthase 0.9793 165 346 GO:0004315
GO:0005829
GO:0006633
AF-A0A536SDM7-F1-model_v4 Beta-ketoacyl-ACP synthase II (EC 2.3.1.179) 0.9778 114 412 GO:0004315
GO:0005829
GO:0006633

Map