F459481

General Info

Members Datasets Scaffolds Average Seq Length
526 288 1052 107

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0756924|Ga0501079_0756924_58_441
Length 127
Sequence MPHPAFFPSREPTPGAKTVSRNLYYVGIAFFGMINGLPFFSPLYLPTFGYSAQLMTAPLFGNLSLIAYFASLMLSTGTVILAGIPAAIYESHVGAKDDSTDTSLWIWLVGTAILAIPAAGNFLRFGV

Samples

Sample ID Description Type Environment
1 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
14 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
100 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
101 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
151 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
155 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
174 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
175 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
176 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
187 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
211 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
212 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
213 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
267 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
268 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
269 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
270 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
271 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
272 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
276 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
277 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
278 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
279 2791355199
280 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
281 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
282 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
283 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
284 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
285 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
286 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
287 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
288 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0
Isolates 2.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.79
Nodule 2.28
Rhizoplane 3.04
Rhizosphere 85.17
Stem 0
Stem Tuber 0
Unclassified 11.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501079_0756924 3300049741 Unclassified 765
2 2214711583 2209111006 Bacteria 4441
3 ARcpr5oldR_c002427 3300000041 Bacteria 1722
4 ARSoilYngRDRAFT_c00277 3300000042 Bacteria 7608
5 ARcpr5yngRDRAFT_c002409 3300000043 Bacteria 1947
6 ARSoilOldRDRAFT_c000172 3300000044 Bacteria 10835
7 ARCol0yngRDRAFT_1003560 3300000652 Bacteria 1138
8 ARCol0yngRDRAFT_1007014 3300000652 Unclassified 809
9 JGI24737J22298_10023031 3300001990 Bacteria 1977
10 rootH2_10229419 3300003320 Bacteria 1198
11 rootH2_10302147 3300003320 Bacteria 1433
12 rootL2_10149047 3300003322 Bacteria 1163
13 JGI25404J52841_10002494 3300003659 Bacteria 3490
14 JGI25404J52841_10038340 3300003659 Bacteria 1017
15 JGI25405J52794_10088017 3300003911 Bacteria 686
16 JGI25405J52794_10116315 3300003911 Bacteria 601
17 Ga0065717_1004849 3300005276 Unclassified 967
18 Ga0065716_1001638 3300005277 Bacteria 4741
19 Ga0065704_10223188 3300005289 Bacteria 1067
20 Ga0065712_10123305 3300005290 Bacteria 1640
21 Ga0065712_10520309 3300005290 Bacteria 627
22 Ga0065715_10103587 3300005293 Bacteria 3012
23 Ga0065715_10874989 3300005293 Bacteria 583
24 Ga0070676_10027959 3300005328 Bacteria 3201
25 Ga0070676_10105688 3300005328 Bacteria 1746
26 Ga0070690_100075414 3300005330 Bacteria 2198
27 Ga0070690_100909869 3300005330 Bacteria 689
28 Ga0070670_101800124 3300005331 Bacteria 564
29 Ga0068869_101236794 3300005334 Unclassified 657
30 Ga0068869_101953676 3300005334 Bacteria 526
31 Ga0070666_10075127 3300005335 Bacteria 2304
32 Ga0070680_100304439 3300005336 Bacteria 1352
33 Ga0070682_100136412 3300005337 Bacteria 1667
34 Ga0070689_100202999 3300005340 Bacteria 1619
35 Ga0070689_101355890 3300005340 Bacteria 642
36 Ga0070691_10435341 3300005341 Bacteria 746
37 Ga0070687_100114921 3300005343 Unclassified 1530
38 Ga0070692_10033493 3300005345 Bacteria 2589
39 Ga0070668_100152180 3300005347 Bacteria 1872
40 Ga0070668_100615850 3300005347 Bacteria 951
41 Ga0070669_100061214 3300005353 Bacteria 2765
42 Ga0070669_100143874 3300005353 Bacteria 1840
43 Ga0070669_100389322 3300005353 Bacteria 1138
44 Ga0070669_101682007 3300005353 Bacteria 553
45 Ga0070675_100030260 3300005354 Bacteria 4370
46 Ga0070675_100109543 3300005354 Bacteria 2334
47 Ga0070675_101814279 3300005354 Bacteria 563
48 Ga0070671_100703587 3300005355 Bacteria 877
49 Ga0070674_100235978 3300005356 Bacteria 1429
50 Ga0070673_100036167 3300005364 Bacteria 3750
51 Ga0070688_100327706 3300005365 Bacteria 1115
52 Ga0070688_100644570 3300005365 Bacteria 815
53 Ga0070688_101204149 3300005365 Bacteria 609
54 Ga0070667_100248471 3300005367 Bacteria 1590
55 Ga0070701_11183146 3300005438 Bacteria 542
56 Ga0070694_100281687 3300005444 Bacteria 1268
57 Ga0070708_100414632 3300005445 Bacteria 1270
58 Ga0070663_100074552 3300005455 Bacteria 2478
59 Ga0070678_100060176 3300005456 Bacteria 2794
60 Ga0070662_100144565 3300005457 Bacteria 1846
61 Ga0070662_100250350 3300005457 Bacteria 1424
62 Ga0070662_101327720 3300005457 Bacteria 619
63 Ga0070681_10768759 3300005458 Unclassified 880
64 Ga0068867_100024496 3300005459 Bacteria 4324
65 Ga0068867_100483828 3300005459 Bacteria 1061
66 Ga0070698_100024843 3300005471 Bacteria 6248
67 Ga0068853_100075501 3300005539 Bacteria 2942
68 Ga0070672_100205094 3300005543 Bacteria 1649
69 Ga0070686_100107005 3300005544 Bacteria 1899
70 Ga0070686_101122970 3300005544 Bacteria 650
71 Ga0070695_100362822 3300005545 Bacteria 1088
72 Ga0070695_100470794 3300005545 Bacteria 966
73 Ga0070696_100183414 3300005546 Bacteria 1554
74 Ga0070665_100323295 3300005548 Bacteria 1547
75 Ga0070665_100688165 3300005548 Bacteria 1036
76 Ga0070665_102355512 3300005548 Bacteria 535
77 Ga0070704_100301790 3300005549 Unclassified 1334
78 Ga0070704_101848835 3300005549 Bacteria 559
79 Ga0068854_101313010 3300005578 Bacteria 652
80 Ga0068859_101667606 3300005617 Unclassified 704
81 Ga0068866_10742324 3300005718 Bacteria 677
82 Ga0068861_100515206 3300005719 Bacteria 1084
83 Ga0068858_100390878 3300005842 Unclassified 1335
84 Ga0068860_100292743 3300005843 Bacteria 1593
85 Ga0068860_102501959 3300005843 Unclassified 536
86 Ga0068862_100063980 3300005844 Bacteria 3165
87 Ga0068862_100104829 3300005844 Bacteria 2478
88 Ga0068862_102739116 3300005844 Unclassified 504
89 Ga0081455_10002279 3300005937 Bacteria 22898
90 Ga0081455_10011228 3300005937 Bacteria 9013
91 Ga0081455_10020261 3300005937 Bacteria 6269
92 Ga0081455_10047066 3300005937 Bacteria 3738
93 Ga0081455_10062120 3300005937 Bacteria 3141
94 Ga0081455_10085895 3300005937 Bacteria 2564
95 Ga0081455_10102973 3300005937 Bacteria 2287
96 Ga0081455_10623702 3300005937 Bacteria 699
97 Ga0081455_10917708 3300005937 Bacteria 544
98 Ga0081538_10034584 3300005981 Bacteria 3337
99 Ga0081538_10049043 3300005981 Bacteria 2566
100 Ga0081540_1009768 3300005983 Bacteria 6570
101 Ga0081540_1034966 3300005983 Bacteria 2701
102 Ga0081540_1091652 3300005983 Bacteria 1335
103 Ga0081540_1100725 3300005983 Bacteria 1245
104 Ga0081539_10031607 3300005985 Bacteria 3260
105 Ga0081539_10075913 3300005985 Bacteria 1783
106 Ga0075365_10111348 3300006038 Bacteria 1881
107 Ga0075365_10317705 3300006038 Bacteria 1097
108 Ga0075365_10675794 3300006038 Unclassified 730
109 Ga0075365_11035715 3300006038 Bacteria 578
110 Ga0075368_10113682 3300006042 Bacteria 1117
111 Ga0075368_10465283 3300006042 Bacteria 561
112 Ga0075363_100067494 3300006048 Bacteria 1938
113 Ga0075363_100104566 3300006048 Bacteria 1570
114 Ga0075364_10182944 3300006051 Unclassified 1418
115 Ga0075362_10170747 3300006177 Bacteria 1051
116 Ga0075362_10216972 3300006177 Bacteria 934
117 Ga0075362_10320273 3300006177 Bacteria 772
118 Ga0075367_10074482 3300006178 Bacteria 2047
119 Ga0075367_10973423 3300006178 Unclassified 542
120 Ga0075366_10056837 3300006195 Bacteria 2325
121 Ga0075366_10138895 3300006195 Bacteria 1468
122 Ga0075366_10452527 3300006195 Bacteria 792
123 Ga0075366_10648614 3300006195 Bacteria 655
124 Ga0097621_101787093 3300006237 Bacteria 586
125 Ga0075370_10013697 3300006353 Bacteria 4316
126 Ga0075370_10337059 3300006353 Unclassified 900
127 Ga0075428_100180463 3300006844 Bacteria 2285
128 Ga0075428_100201384 3300006844 Bacteria 2152
129 Ga0075428_100208698 3300006844 Bacteria 2111
130 Ga0075428_100304797 3300006844 Bacteria 1712
131 Ga0075428_100357238 3300006844 Bacteria 1568
132 Ga0075428_101912178 3300006844 Unclassified 616
133 Ga0075430_100032337 3300006846 Bacteria 4441
134 Ga0075430_100210587 3300006846 Bacteria 1613
135 Ga0075431_100005117 3300006847 Bacteria 12902
136 Ga0075431_100158185 3300006847 Bacteria 2331
137 Ga0075431_100233398 3300006847 Bacteria 1874
138 Ga0075431_102152648 3300006847 Bacteria 512
139 Ga0075433_10046856 3300006852 Bacteria 3760
140 Ga0075433_11155478 3300006852 Unclassified 672
141 Ga0075434_100198779 3300006871 Bacteria 2024
142 Ga0075429_100977434 3300006880 Bacteria 740
143 Ga0075429_101111540 3300006880 Bacteria 690
144 Ga0068865_100452011 3300006881 Bacteria 1062
145 Ga0068865_100847789 3300006881 Bacteria 791
146 Ga0068865_101392388 3300006881 Unclassified 626
147 Ga0097620_101666814 3300006931 Unclassified 704
148 Ga0075435_100033319 3300007076 Bacteria 4072
149 Ga0111539_10003351 3300009094 Bacteria 21159
150 Ga0111539_10007401 3300009094 Bacteria 14066
151 Ga0111539_10331316 3300009094 Bacteria 1772
152 Ga0111539_10418616 3300009094 Bacteria 1560
153 Ga0111539_10606880 3300009094 Bacteria 1274
154 Ga0114129_10137679 3300009147 Bacteria 3349
155 Ga0114129_10263477 3300009147 Bacteria 2309
156 Ga0114129_10657226 3300009147 Bacteria 1352
157 Ga0114129_13101717 3300009147 Unclassified 543
158 Ga0105243_10035742 3300009148 Bacteria 3852
159 Ga0105243_10268038 3300009148 Bacteria 1532
160 Ga0105243_10303538 3300009148 Bacteria 1448
161 Ga0105242_10690544 3300009176 Bacteria 997
162 Ga0105242_10706606 3300009176 Bacteria 987
163 Ga0105242_11341370 3300009176 Bacteria 740
164 Ga0105242_12143069 3300009176 Unclassified 603
165 Ga0105242_12958472 3300009176 Unclassified 525
166 Ga0105248_10589091 3300009177 Bacteria 1255
167 Ga0105237_10125936 3300009545 Bacteria 2556
168 Ga0105249_10255863 3300009553 Bacteria 1738
169 Ga0105249_10513858 3300009553 Bacteria 1244
170 Ga0105249_10923363 3300009553 Bacteria 940
171 Ga0105249_11384049 3300009553 Bacteria 775
172 Ga0105249_11674721 3300009553 Bacteria 709
173 Ga0105249_12774940 3300009553 Unclassified 562
174 Ga0105239_10067078 3300010375 Bacteria 3941
175 Ga0105246_10634770 3300011119 Bacteria 928
176 Ga0105246_10684929 3300011119 Bacteria 896
177 Ga0157378_10104856 3300013297 Bacteria 2585
178 Ga0157378_11141588 3300013297 Bacteria 817
179 Ga0157378_11661081 3300013297 Bacteria 685
180 Ga0163162_10115818 3300013306 Bacteria 2781
181 Ga0163163_10971178 3300014325 Bacteria 913
182 Ga0163163_12981928 3300014325 Unclassified 528
183 Ga0157380_10042875 3300014326 Bacteria 3540
184 Ga0157380_10122876 3300014326 Bacteria 2202
185 Ga0157380_10169554 3300014326 Bacteria 1906
186 Ga0157380_10447429 3300014326 Unclassified 1240
187 Ga0157380_10649526 3300014326 Bacteria 1052
188 Ga0157380_11308998 3300014326 Bacteria 772
189 Ga0157377_10581536 3300014745 Bacteria 796
190 Ga0157379_10354076 3300014968 Bacteria 1344
191 Ga0157376_10138691 3300014969 Bacteria 2179
192 Ga0163161_11345532 3300017792 Bacteria 622
193 Ga0214544_1014236 3300021320 Bacteria 9056
194 Ga0214542_1021322 3300021321 Bacteria 4490
195 Ga0214543_1015439 3300021327 Bacteria 8445
196 Ga0207697_10021745 3300025315 Bacteria 2628
197 Ga0207682_10004392 3300025893 Bacteria 5905
198 Ga0207710_10338127 3300025900 Bacteria 765
199 Ga0207688_10012521 3300025901 Bacteria 4617
200 Ga0207688_10050478 3300025901 Bacteria 2329
201 Ga0207680_10142700 3300025903 Bacteria 1589
202 Ga0207647_10064360 3300025904 Bacteria 2229
203 Ga0207643_10233356 3300025908 Bacteria 1129
204 Ga0207707_10576255 3300025912 Bacteria 954
205 Ga0207662_10093871 3300025918 Unclassified 1849
206 Ga0207662_10556792 3300025918 Bacteria 794
207 Ga0207662_10964491 3300025918 Bacteria 605
208 Ga0207681_10235711 3300025923 Bacteria 1422
209 Ga0207681_10573795 3300025923 Bacteria 930
210 Ga0207659_10169944 3300025926 Bacteria 1719
211 Ga0207659_10185277 3300025926 Bacteria 1652
212 Ga0207690_10174472 3300025932 Unclassified 1613
213 Ga0207690_11053943 3300025932 Bacteria 677
214 Ga0207706_10090266 3300025933 Bacteria 2694
215 Ga0207706_10210156 3300025933 Bacteria 1706
216 Ga0207709_10066146 3300025935 Bacteria 2276
217 Ga0207670_10515415 3300025936 Bacteria 973
218 Ga0207669_10109153 3300025937 Bacteria 1849
219 Ga0207669_10637602 3300025937 Bacteria 870
220 Ga0207704_10073997 3300025938 Bacteria 2172
221 Ga0207691_10022970 3300025940 Bacteria 5875
222 Ga0207679_10679413 3300025945 Bacteria 933
223 Ga0207712_10631649 3300025961 Bacteria 929
224 Ga0207640_10745961 3300025981 Bacteria 844
225 Ga0207677_10995514 3300026023 Bacteria 760
226 Ga0207639_10131074 3300026041 Bacteria 2075
227 Ga0207678_10089115 3300026067 Bacteria 2637
228 Ga0207678_11882113 3300026067 Bacteria 522
229 Ga0207708_10102991 3300026075 Bacteria 2211
230 Ga0207708_10518899 3300026075 Bacteria 1001
231 Ga0207648_10035413 3300026089 Bacteria 4397
232 Ga0207648_10267521 3300026089 Bacteria 1526
233 Ga0207676_12478816 3300026095 Unclassified 515
234 Ga0207675_100185345 3300026118 Bacteria 1994
235 Ga0207675_100231835 3300026118 Bacteria 1782
236 Ga0207683_10014963 3300026121 Bacteria 6604
237 Ga0209966_1047528 3300027695 Bacteria 907
238 Ga0209998_10008057 3300027717 Bacteria 2186
239 Ga0209998_10208101 3300027717 Unclassified 512
240 Ga0207428_10050582 3300027907 Bacteria 3324
241 Ga0207428_10132148 3300027907 Bacteria 1909
242 Ga0207428_11261357 3300027907 Unclassified 513
243 Ga0268266_10336613 3300028379 Bacteria 1416
244 Ga0268265_10086502 3300028380 Bacteria 2491
245 Ga0268265_10157821 3300028380 Bacteria 1922
246 Ga0268265_11746773 3300028380 Bacteria 628
247 Ga0268264_10287745 3300028381 Bacteria 1542
248 Ga0307513_10606027 3300031456 Bacteria 804
249 Ga0307408_100068119 3300031548 Bacteria 2620
250 Ga0307408_100265888 3300031548 Bacteria 1422
251 Ga0307408_100579808 3300031548 Bacteria 994
252 Ga0307408_101507129 3300031548 Unclassified 636
253 Ga0307405_10462819 3300031731 Bacteria 1008
254 Ga0307405_10835316 3300031731 Bacteria 774
255 Ga0307413_10053017 3300031824 Bacteria 2453
256 Ga0307410_10057546 3300031852 Bacteria 2648
257 Ga0307406_10579267 3300031901 Bacteria 922
258 Ga0307406_10821861 3300031901 Bacteria 786
259 Ga0307406_11333226 3300031901 Bacteria 627
260 Ga0307406_11598108 3300031901 Bacteria 576
261 Ga0307407_10483025 3300031903 Bacteria 905
262 Ga0307407_11222813 3300031903 Bacteria 587
263 Ga0307412_10252149 3300031911 Bacteria 1371
264 Ga0307412_10407291 3300031911 Bacteria 1109
265 Ga0307412_10660220 3300031911 Bacteria 893
266 Ga0307412_11096230 3300031911 Bacteria 708
267 Ga0307409_100003577 3300031995 Bacteria 8484
268 Ga0307409_100024205 3300031995 Bacteria 4229
269 Ga0307409_100163722 3300031995 Bacteria 1949
270 Ga0307409_100809167 3300031995 Bacteria 945
271 Ga0307416_100176620 3300032002 Bacteria 1996
272 Ga0307416_100317050 3300032002 Bacteria 1559
273 Ga0307416_100395459 3300032002 Bacteria 1418
274 Ga0307414_10248507 3300032004 Bacteria 1477
275 Ga0307411_10023605 3300032005 Bacteria 3647
276 Ga0307415_100159883 3300032126 Bacteria 1745
277 Ga0307415_100535814 3300032126 Bacteria 1030
278 Ga0307415_101348433 3300032126 Bacteria 677
279 Ga0373948_0006740 3300034817 Bacteria 1910
280 Ga0373950_0030694 3300034818 Bacteria 993
281 Ga0373959_0005398 3300034820 Bacteria 2094
282 Ga0373938_0001663 3300034957 Bacteria 3561
283 Ga0373928_0019290 3300035084 Bacteria 1421
284 Ga0373929_0004065 3300035085 Bacteria 2620
285 Ga0373949_0001315 3300035090 Bacteria 7172
286 Ga0373952_0012205 3300035092 Bacteria 1686
287 Ga0373932_0000066 3300035112 Bacteria 26000
288 Ga0373939_0023356 3300035114 Bacteria 1712
289 Ga0373941_0011276 3300035115 Bacteria 2306
290 Ga0373960_0007253 3300035121 Bacteria 2623
291 Ga0373946_0640967 3300035171 Unclassified 553
292 Ga0373961_0001122 3300035241 Bacteria 8437
293 Ga0373962_0002949 3300035242 Bacteria 4081
294 Ga0373931_0013516 3300035691 Bacteria 3976
295 Ga0373935_1293564 3300035692 Unclassified 544
296 Ga0373927_0010040 3300035695 Bacteria 6340
297 Ga0373947_0123905 3300035725 Bacteria 1644
298 Ga0373925_0145462 3300037068 Bacteria 1858
299 Ga0439453_0023641 3300041408 Bacteria 1123
300 Ga0439465_0109868 3300041413 Bacteria 959
301 Ga0439465_0286511 3300041413 Bacteria 614
302 Ga0451853_2036374 3300041512 Unclassified 563
303 Ga0439431_0195892 3300041997 Bacteria 587
304 Ga0439432_145502 3300042006 Bacteria 696
305 Ga0439460_0236376 3300042461 Bacteria 629
306 Ga0495590_0156158 3300046457 Bacteria 828
307 Ga0495638_0005377 3300046460 Bacteria 9547
308 Ga0495650_0160682 3300046471 Bacteria 801
309 Ga0495605_0135387 3300046474 Bacteria 1108
310 Ga0495585_0071087 3300046492 Bacteria 1897
311 Ga0495585_0210571 3300046492 Bacteria 985
312 Ga0495596_0241797 3300046500 Bacteria 701
313 Ga0495616_0230401 3300046513 Bacteria 803
314 Ga0495616_0300566 3300046513 Bacteria 678
315 Ga0495632_0031503 3300046519 Bacteria 2740
316 Ga0495644_0026332 3300046523 Bacteria 2207
317 Ga0495663_0080966 3300046525 Bacteria 1046
318 Ga0495642_0070939 3300046528 Bacteria 1457
319 Ga0495654_0150274 3300046530 Bacteria 1031
320 Ga0495665_0263943 3300046531 Unclassified 885
321 Ga0495598_0001270 3300046537 Bacteria 4927
322 Ga0495598_0467063 3300046537 Bacteria 501
323 Ga0495609_0099017 3300046538 Bacteria 1264
324 Ga0495633_0269135 3300046558 Bacteria 776
325 Ga0495656_0132796 3300046615 Bacteria 1186
326 Ga0495656_0196634 3300046615 Bacteria 999
327 Ga0495668_0021713 3300046616 Bacteria 3676
328 Ga0495668_0337709 3300046616 Bacteria 827
329 Ga0495611_0064012 3300046648 Bacteria 1674
330 Ga0495625_0061614 3300046660 Bacteria 2654
331 Ga0495659_0017716 3300046664 Bacteria 2365
332 Ga0495659_0098904 3300046664 Bacteria 1128
333 Ga0495661_0446395 3300046665 Bacteria 623
334 Ga0495658_0034048 3300046683 Bacteria 2793
335 Ga0495669_0567717 3300046684 Bacteria 552
336 Ga0495613_0406810 3300046689 Bacteria 928
337 Ga0495613_0596717 3300046689 Unclassified 735
338 Ga0495670_0181544 3300046691 Bacteria 1111
339 Ga0495670_0770066 3300046691 Bacteria 525
340 Ga0495671_0015468 3300046692 Bacteria 4087
341 Ga0495671_0024258 3300046692 Bacteria 3160
342 Ga0495649_0135737 3300046694 Bacteria 1297
343 Ga0495589_0191826 3300046794 Bacteria 966
344 Ga0495581_0217668 3300047315 Unclassified 1116
345 Ga0495636_0153289 3300047318 Bacteria 1035
346 Ga0495672_0153199 3300047320 Bacteria 1193
347 Ga0495683_0177060 3300047323 Bacteria 976
348 Ga0495677_0179253 3300047445 Bacteria 821
349 Ga0495679_145433 3300047446 Bacteria 638
350 Ga0495673_0070611 3300047469 Bacteria 1470
351 Ga0495681_0331965 3300047470 Bacteria 582
352 Ga0495615_0048601 3300048090 Bacteria 1085
353 Ga0496102_0070075 3300048905 Bacteria 3219
354 Ga0496102_1402372 3300048905 Bacteria 618
355 Ga0496102_1700369 3300048905 Unclassified 549
356 Ga0496103_0533615 3300048906 Bacteria 750
357 Ga0496103_0588326 3300048906 Bacteria 709
358 Ga0496104_0427170 3300048907 Bacteria 1237
359 Ga0496104_0479598 3300048907 Bacteria 1155
360 Ga0496105_0481663 3300048908 Bacteria 976
361 Ga0496106_1146700 3300048909 Bacteria 608
362 Ga0496108_0814217 3300048911 Bacteria 805
363 Ga0496108_1535771 3300048911 Bacteria 553
364 Ga0496109_1046813 3300048912 Bacteria 753
365 Ga0496111_0962143 3300048914 Bacteria 613
366 Ga0496112_0943421 3300048915 Bacteria 784
367 Ga0496113_0321122 3300048916 Unclassified 1241
368 Ga0496113_0637893 3300048916 Bacteria 852
369 Ga0501032_0877672 3300049569 Bacteria 565
370 Ga0501033_1121849 3300049570 Bacteria 523
371 Ga0501034_0000179 3300049571 Bacteria 118832
372 Ga0501034_0059202 3300049571 Bacteria 3848
373 Ga0501034_0916786 3300049571 Unclassified 763
374 Ga0501036_0245327 3300049572 Bacteria 1502
375 Ga0501036_0265763 3300049572 Unclassified 1437
376 Ga0501036_1025116 3300049572 Unclassified 675
377 Ga0501036_1361839 3300049572 Bacteria 576
378 Ga0501037_0574811 3300049573 Bacteria 759
379 Ga0501037_0595472 3300049573 Unclassified 743
380 Ga0501038_0185953 3300049574 Bacteria 1674
381 Ga0501038_0368221 3300049574 Bacteria 1117
382 Ga0501039_0146453 3300049575 Bacteria 1856
383 Ga0501039_0269631 3300049575 Bacteria 1338
384 Ga0501039_0706822 3300049575 Bacteria 788
385 Ga0501040_0274971 3300049576 Unclassified 1203
386 Ga0501040_0284088 3300049576 Bacteria 1182
387 Ga0501040_0419087 3300049576 Bacteria 962
388 Ga0501041_0076908 3300049577 Bacteria 2053
389 Ga0501041_0285952 3300049577 Unclassified 1038
390 Ga0501041_0302103 3300049577 Unclassified 1009
391 Ga0501041_0405028 3300049577 Bacteria 864
392 Ga0501042_0559959 3300049578 Bacteria 831
393 Ga0501042_0984984 3300049578 Bacteria 614
394 Ga0501046_0071634 3300049580 Bacteria 2693
395 Ga0501046_0802881 3300049580 Bacteria 659
396 Ga0501048_0292721 3300049582 Bacteria 1158
397 Ga0501048_0861155 3300049582 Bacteria 651
398 Ga0501067_0851766 3300049583 Bacteria 514
399 Ga0501069_0899410 3300049585 Bacteria 539
400 Ga0501070_0061735 3300049586 Bacteria 3105
401 Ga0501071_0545994 3300049587 Bacteria 890
402 Ga0501071_1426285 3300049587 Bacteria 535
403 Ga0501071_1503222 3300049587 Unclassified 520
404 Ga0501072_0492239 3300049588 Bacteria 970
405 Ga0501072_0780773 3300049588 Bacteria 749
406 Ga0501072_0888330 3300049588 Bacteria 696
407 Ga0501073_0521497 3300049589 Bacteria 821
408 Ga0501074_0023933 3300049590 Bacteria 4438
409 Ga0501074_0702151 3300049590 Unclassified 714
410 Ga0501075_0134451 3300049591 Bacteria 1884
411 Ga0501075_0374627 3300049591 Bacteria 1085
412 Ga0501075_0503391 3300049591 Bacteria 924
413 Ga0501075_0527220 3300049591 Unclassified 901
414 Ga0501075_0609478 3300049591 Bacteria 833
415 Ga0501075_1122654 3300049591 Unclassified 597
416 Ga0501076_0036388 3300049592 Bacteria 3857
417 Ga0501076_0056678 3300049592 Bacteria 3111
418 Ga0501076_0112529 3300049592 Bacteria 2202
419 Ga0501076_0155952 3300049592 Bacteria 1859
420 Ga0501076_0301829 3300049592 Unclassified 1313
421 Ga0501076_0502160 3300049592 Bacteria 1000
422 Ga0501076_1193397 3300049592 Bacteria 626
423 Ga0501077_0048945 3300049593 Bacteria 2686
424 Ga0501077_0200935 3300049593 Bacteria 1266
425 Ga0501077_0600999 3300049593 Bacteria 706
426 Ga0501221_222802 3300049704 Bacteria 532
427 Ga0501079_0049269 3300049741 Bacteria 3251
428 Ga0501079_0108149 3300049741 Bacteria 2159
429 Ga0501079_0161284 3300049741 Bacteria 1748
430 Ga0501079_0245312 3300049741 Bacteria 1400
431 Ga0501079_0423627 3300049741 Bacteria 1045
432 Ga0501079_0620639 3300049741 Bacteria 851
433 Ga0501079_0751226 3300049741 Bacteria 768
434 Ga0501079_0771530 3300049741 Unclassified 757
435 Ga0501079_0888143 3300049741 Bacteria 702
436 Ga0501079_1086488 3300049741 Bacteria 630
437 Ga0501079_1486481 3300049741 Bacteria 533
438 Ga0501079_1503244 3300049741 Bacteria 530
439 Ga0501080_0262113 3300049742 Bacteria 1574
440 Ga0501080_0512531 3300049742 Bacteria 1071
441 Ga0501080_1151993 3300049742 Bacteria 668
442 Ga0501081_0118215 3300049743 Bacteria 1886
443 Ga0501081_0133774 3300049743 Bacteria 1773
444 Ga0501081_0194404 3300049743 Bacteria 1470
445 Ga0501081_0276010 3300049743 Bacteria 1230
446 Ga0501081_0398204 3300049743 Bacteria 1019
447 Ga0501083_0014679 3300049744 Bacteria 5477
448 Ga0501083_0065020 3300049744 Bacteria 2430
449 Ga0501083_0396591 3300049744 Bacteria 898
450 Ga0501083_0574572 3300049744 Bacteria 733
451 Ga0501045_0068307 3300049824 Bacteria 2611
452 Ga0501045_0195793 3300049824 Bacteria 1506
453 Ga0501045_0331719 3300049824 Unclassified 1132
454 Ga0501045_0333974 3300049824 Unclassified 1128
455 Ga0501045_0442295 3300049824 Unclassified 967
456 Ga0501045_0483667 3300049824 Bacteria 920
457 Ga0501045_1106396 3300049824 Bacteria 579
458 Ga0501045_1400125 3300049824 Bacteria 508
459 nmdc:mga03683_106233_c1 3300050489 Bacteria 914
460 nmdc:mga03683_3108_c2 3300050489 Bacteria 3529
461 nmdc:mga00v17_165224_c1 3300050491 Bacteria 1426
462 nmdc:mga0yw44_438607_c1 3300050492 Bacteria 885
463 nmdc:mga0yw44_440428_c1 3300050492 Bacteria 883
464 nmdc:mga0yw44_548399_c1 3300050492 Bacteria 785
465 nmdc:mga0yw44_63709_c1 3300050492 Bacteria 2267
466 nmdc:mga0k408_149640_c1 3300050493 Bacteria 1390
467 nmdc:mga0k408_438366_c1 3300050493 Bacteria 776
468 nmdc:mga0k408_553600_c1 3300050493 Archaea 680
469 nmdc:mga06z11_24085_c1 3300050494 Bacteria 2868
470 nmdc:mga06z11_943427_c1 3300050494 Unclassified 526
471 nmdc:mga04h51_232820_c1 3300050495 Bacteria 733
472 nmdc:mga07m45_146181_c1 3300050496 Bacteria 1370
473 nmdc:mga05p37_345895_c1 3300050507 Bacteria 1752
474 nmdc:mga05p37_701836_c1 3300050507 Bacteria 1124
475 nmdc:mga09592_531871_c1 3300050508 Bacteria 1010
476 nmdc:mga09592_826412_c1 3300050508 Bacteria 782
477 nmdc:mga09592_895230_c1 3300050508 Bacteria 746
478 nmdc:mga0qj67_23136_c1 3300050509 Bacteria 4777
479 nmdc:mga06r32_1340185_c1 3300050510 Bacteria 659
480 nmdc:mga06r32_308153_c1 3300050510 Bacteria 1569
481 nmdc:mga06r32_3657_c1 3300050510 Bacteria 13740
482 nmdc:mga06r32_40579_c1 3300050510 Bacteria 4419
483 nmdc:mga06r32_905507_c1 3300050510 Bacteria 838
484 nmdc:mga08y16_3344_c1 3300050511 Bacteria 16605
485 nmdc:mga08y16_6454_c1 3300050511 Bacteria 12303
486 nmdc:mga0n895_579818_c1 3300050512 Bacteria 1126
487 nmdc:mga0a205_183827_c1 3300050515 Bacteria 1984
488 nmdc:mga0a205_72097_c1 3300050515 Bacteria 3336
489 nmdc:mga0a205_885364_c1 3300050515 Unclassified 740
490 nmdc:mga0sz30_453255_c1 3300050516 Bacteria 576
491 Ga0495655_0134878 3300053083 Bacteria 763
492 Ga0500646_0290670 3300053090 Bacteria 584
493 Ga0500651_0070131 3300053093 Bacteria 2182
494 Ga0500641_0021113 3300053096 Bacteria 2477
495 Ga0500650_0176798 3300053098 Bacteria 979
496 Ga0500597_352932 3300053120 Bacteria 572
497 Ga0500642_0305803 3300053130 Bacteria 717
498 Ga0501084_0077318 3300054114 Bacteria 2790
499 Ga0501084_0081911 3300054114 Bacteria 2707
500 Ga0501084_0094944 3300054114 Bacteria 2504
501 Ga0501084_0154661 3300054114 Bacteria 1934
502 Ga0501084_0683400 3300054114 Bacteria 866
503 Ga0501084_1039683 3300054114 Unclassified 688
504 Ga0501082_0084632 3300060353 Bacteria 2735
505 Ga0501082_0286112 3300060353 Bacteria 1435
506 Ga0501082_0644097 3300060353 Bacteria 927
507 Ga0530510_0070702 3300061734 Bacteria 2533
508 Ga0530510_0073271 3300061734 Bacteria 2486
509 Ga0530510_0109697 3300061734 Bacteria 2021
510 Ga0530510_0209876 3300061734 Unclassified 1447
511 Ga0530510_0660393 3300061734 Bacteria 796
512 Ga0530510_0805576 3300061734 Bacteria 717
513 Ga0530510_1443835 3300061734 Bacteria 528
514 2513694452 2513237101 Bacteria 7952346
515 2513701255 2513237102 Bacteria 7703324
516 2723849061 2721755755 Bacteria 8322773
517 2793079804
518 2824735669 2824732956 Bacteria 7810675
519 2874607040 2874604998 Bacteria 7834745
520 2874620471 2874612657 Bacteria 8252029
521 2879117127 2879110137 Bacteria 8907982
522 2889034860 2889033259 Bacteria 9099371
523 2908776780 2908775508 Bacteria 8092255
524 8006965041 8006964411 Bacteria 8966052
525 8006995288 8006994254 Bacteria 8309700
526 8056679218 8056673599 Bacteria 7871253
527 Ga0501079_0756924
528 2214711583
529 ARcpr5oldR_c002427
530 ARSoilYngRDRAFT_c00277
531 ARcpr5yngRDRAFT_c002409
532 ARSoilOldRDRAFT_c000172
533 ARCol0yngRDRAFT_1003560
534 ARCol0yngRDRAFT_1007014
535 JGI24737J22298_10023031
536 rootH2_10229419
537 rootH2_10302147
538 rootL2_10149047
539 JGI25404J52841_10002494
540 JGI25404J52841_10038340
541 JGI25405J52794_10088017
542 JGI25405J52794_10116315
543 Ga0065717_1004849
544 Ga0065716_1001638
545 Ga0065704_10223188
546 Ga0065712_10123305
547 Ga0065712_10520309
548 Ga0065715_10103587
549 Ga0065715_10874989
550 Ga0070676_10027959
551 Ga0070676_10105688
552 Ga0070690_100075414
553 Ga0070690_100909869
554 Ga0070670_101800124
555 Ga0068869_101236794
556 Ga0068869_101953676
557 Ga0070666_10075127
558 Ga0070680_100304439
559 Ga0070682_100136412
560 Ga0070689_100202999
561 Ga0070689_101355890
562 Ga0070691_10435341
563 Ga0070687_100114921
564 Ga0070692_10033493
565 Ga0070668_100152180
566 Ga0070668_100615850
567 Ga0070669_100061214
568 Ga0070669_100143874
569 Ga0070669_100389322
570 Ga0070669_101682007
571 Ga0070675_100030260
572 Ga0070675_100109543
573 Ga0070675_101814279
574 Ga0070671_100703587
575 Ga0070674_100235978
576 Ga0070673_100036167
577 Ga0070688_100327706
578 Ga0070688_100644570
579 Ga0070688_101204149
580 Ga0070667_100248471
581 Ga0070701_11183146
582 Ga0070694_100281687
583 Ga0070708_100414632
584 Ga0070663_100074552
585 Ga0070678_100060176
586 Ga0070662_100144565
587 Ga0070662_100250350
588 Ga0070662_101327720
589 Ga0070681_10768759
590 Ga0068867_100024496
591 Ga0068867_100483828
592 Ga0070698_100024843
593 Ga0068853_100075501
594 Ga0070672_100205094
595 Ga0070686_100107005
596 Ga0070686_101122970
597 Ga0070695_100362822
598 Ga0070695_100470794
599 Ga0070696_100183414
600 Ga0070665_100323295
601 Ga0070665_100688165
602 Ga0070665_102355512
603 Ga0070704_100301790
604 Ga0070704_101848835
605 Ga0068854_101313010
606 Ga0068859_101667606
607 Ga0068866_10742324
608 Ga0068861_100515206
609 Ga0068858_100390878
610 Ga0068860_100292743
611 Ga0068860_102501959
612 Ga0068862_100063980
613 Ga0068862_100104829
614 Ga0068862_102739116
615 Ga0081455_10002279
616 Ga0081455_10011228
617 Ga0081455_10020261
618 Ga0081455_10047066
619 Ga0081455_10062120
620 Ga0081455_10085895
621 Ga0081455_10102973
622 Ga0081455_10623702
623 Ga0081455_10917708
624 Ga0081538_10034584
625 Ga0081538_10049043
626 Ga0081540_1009768
627 Ga0081540_1034966
628 Ga0081540_1091652
629 Ga0081540_1100725
630 Ga0081539_10031607
631 Ga0081539_10075913
632 Ga0075365_10111348
633 Ga0075365_10317705
634 Ga0075365_10675794
635 Ga0075365_11035715
636 Ga0075368_10113682
637 Ga0075368_10465283
638 Ga0075363_100067494
639 Ga0075363_100104566
640 Ga0075364_10182944
641 Ga0075362_10170747
642 Ga0075362_10216972
643 Ga0075362_10320273
644 Ga0075367_10074482
645 Ga0075367_10973423
646 Ga0075366_10056837
647 Ga0075366_10138895
648 Ga0075366_10452527
649 Ga0075366_10648614
650 Ga0097621_101787093
651 Ga0075370_10013697
652 Ga0075370_10337059
653 Ga0075428_100180463
654 Ga0075428_100201384
655 Ga0075428_100208698
656 Ga0075428_100304797
657 Ga0075428_100357238
658 Ga0075428_101912178
659 Ga0075430_100032337
660 Ga0075430_100210587
661 Ga0075431_100005117
662 Ga0075431_100158185
663 Ga0075431_100233398
664 Ga0075431_102152648
665 Ga0075433_10046856
666 Ga0075433_11155478
667 Ga0075434_100198779
668 Ga0075429_100977434
669 Ga0075429_101111540
670 Ga0068865_100452011
671 Ga0068865_100847789
672 Ga0068865_101392388
673 Ga0097620_101666814
674 Ga0075435_100033319
675 Ga0111539_10003351
676 Ga0111539_10007401
677 Ga0111539_10331316
678 Ga0111539_10418616
679 Ga0111539_10606880
680 Ga0114129_10137679
681 Ga0114129_10263477
682 Ga0114129_10657226
683 Ga0114129_13101717
684 Ga0105243_10035742
685 Ga0105243_10268038
686 Ga0105243_10303538
687 Ga0105242_10690544
688 Ga0105242_10706606
689 Ga0105242_11341370
690 Ga0105242_12143069
691 Ga0105242_12958472
692 Ga0105248_10589091
693 Ga0105237_10125936
694 Ga0105249_10255863
695 Ga0105249_10513858
696 Ga0105249_10923363
697 Ga0105249_11384049
698 Ga0105249_11674721
699 Ga0105249_12774940
700 Ga0105239_10067078
701 Ga0105246_10634770
702 Ga0105246_10684929
703 Ga0157378_10104856
704 Ga0157378_11141588
705 Ga0157378_11661081
706 Ga0163162_10115818
707 Ga0163163_10971178
708 Ga0163163_12981928
709 Ga0157380_10042875
710 Ga0157380_10122876
711 Ga0157380_10169554
712 Ga0157380_10447429
713 Ga0157380_10649526
714 Ga0157380_11308998
715 Ga0157377_10581536
716 Ga0157379_10354076
717 Ga0157376_10138691
718 Ga0163161_11345532
719 Ga0214544_1014236
720 Ga0214542_1021322
721 Ga0214543_1015439
722 Ga0207697_10021745
723 Ga0207682_10004392
724 Ga0207710_10338127
725 Ga0207688_10012521
726 Ga0207688_10050478
727 Ga0207680_10142700
728 Ga0207647_10064360
729 Ga0207643_10233356
730 Ga0207707_10576255
731 Ga0207662_10093871
732 Ga0207662_10556792
733 Ga0207662_10964491
734 Ga0207681_10235711
735 Ga0207681_10573795
736 Ga0207659_10169944
737 Ga0207659_10185277
738 Ga0207690_10174472
739 Ga0207690_11053943
740 Ga0207706_10090266
741 Ga0207706_10210156
742 Ga0207709_10066146
743 Ga0207670_10515415
744 Ga0207669_10109153
745 Ga0207669_10637602
746 Ga0207704_10073997
747 Ga0207691_10022970
748 Ga0207679_10679413
749 Ga0207712_10631649
750 Ga0207640_10745961
751 Ga0207677_10995514
752 Ga0207639_10131074
753 Ga0207678_10089115
754 Ga0207678_11882113
755 Ga0207708_10102991
756 Ga0207708_10518899
757 Ga0207648_10035413
758 Ga0207648_10267521
759 Ga0207676_12478816
760 Ga0207675_100185345
761 Ga0207675_100231835
762 Ga0207683_10014963
763 Ga0209966_1047528
764 Ga0209998_10008057
765 Ga0209998_10208101
766 Ga0207428_10050582
767 Ga0207428_10132148
768 Ga0207428_11261357
769 Ga0268266_10336613
770 Ga0268265_10086502
771 Ga0268265_10157821
772 Ga0268265_11746773
773 Ga0268264_10287745
774 Ga0307513_10606027
775 Ga0307408_100068119
776 Ga0307408_100265888
777 Ga0307408_100579808
778 Ga0307408_101507129
779 Ga0307405_10462819
780 Ga0307405_10835316
781 Ga0307413_10053017
782 Ga0307410_10057546
783 Ga0307406_10579267
784 Ga0307406_10821861
785 Ga0307406_11333226
786 Ga0307406_11598108
787 Ga0307407_10483025
788 Ga0307407_11222813
789 Ga0307412_10252149
790 Ga0307412_10407291
791 Ga0307412_10660220
792 Ga0307412_11096230
793 Ga0307409_100003577
794 Ga0307409_100024205
795 Ga0307409_100163722
796 Ga0307409_100809167
797 Ga0307416_100176620
798 Ga0307416_100317050
799 Ga0307416_100395459
800 Ga0307414_10248507
801 Ga0307411_10023605
802 Ga0307415_100159883
803 Ga0307415_100535814
804 Ga0307415_101348433
805 Ga0373948_0006740
806 Ga0373950_0030694
807 Ga0373959_0005398
808 Ga0373938_0001663
809 Ga0373928_0019290
810 Ga0373929_0004065
811 Ga0373949_0001315
812 Ga0373952_0012205
813 Ga0373932_0000066
814 Ga0373939_0023356
815 Ga0373941_0011276
816 Ga0373960_0007253
817 Ga0373946_0640967
818 Ga0373961_0001122
819 Ga0373962_0002949
820 Ga0373931_0013516
821 Ga0373935_1293564
822 Ga0373927_0010040
823 Ga0373947_0123905
824 Ga0373925_0145462
825 Ga0439453_0023641
826 Ga0439465_0109868
827 Ga0439465_0286511
828 Ga0451853_2036374
829 Ga0439431_0195892
830 Ga0439432_145502
831 Ga0439460_0236376
832 Ga0495590_0156158
833 Ga0495638_0005377
834 Ga0495650_0160682
835 Ga0495605_0135387
836 Ga0495585_0071087
837 Ga0495585_0210571
838 Ga0495596_0241797
839 Ga0495616_0230401
840 Ga0495616_0300566
841 Ga0495632_0031503
842 Ga0495644_0026332
843 Ga0495663_0080966
844 Ga0495642_0070939
845 Ga0495654_0150274
846 Ga0495665_0263943
847 Ga0495598_0001270
848 Ga0495598_0467063
849 Ga0495609_0099017
850 Ga0495633_0269135
851 Ga0495656_0132796
852 Ga0495656_0196634
853 Ga0495668_0021713
854 Ga0495668_0337709
855 Ga0495611_0064012
856 Ga0495625_0061614
857 Ga0495659_0017716
858 Ga0495659_0098904
859 Ga0495661_0446395
860 Ga0495658_0034048
861 Ga0495669_0567717
862 Ga0495613_0406810
863 Ga0495613_0596717
864 Ga0495670_0181544
865 Ga0495670_0770066
866 Ga0495671_0015468
867 Ga0495671_0024258
868 Ga0495649_0135737
869 Ga0495589_0191826
870 Ga0495581_0217668
871 Ga0495636_0153289
872 Ga0495672_0153199
873 Ga0495683_0177060
874 Ga0495677_0179253
875 Ga0495679_145433
876 Ga0495673_0070611
877 Ga0495681_0331965
878 Ga0495615_0048601
879 Ga0496102_0070075
880 Ga0496102_1402372
881 Ga0496102_1700369
882 Ga0496103_0533615
883 Ga0496103_0588326
884 Ga0496104_0427170
885 Ga0496104_0479598
886 Ga0496105_0481663
887 Ga0496106_1146700
888 Ga0496108_0814217
889 Ga0496108_1535771
890 Ga0496109_1046813
891 Ga0496111_0962143
892 Ga0496112_0943421
893 Ga0496113_0321122
894 Ga0496113_0637893
895 Ga0501032_0877672
896 Ga0501033_1121849
897 Ga0501034_0000179
898 Ga0501034_0059202
899 Ga0501034_0916786
900 Ga0501036_0245327
901 Ga0501036_0265763
902 Ga0501036_1025116
903 Ga0501036_1361839
904 Ga0501037_0574811
905 Ga0501037_0595472
906 Ga0501038_0185953
907 Ga0501038_0368221
908 Ga0501039_0146453
909 Ga0501039_0269631
910 Ga0501039_0706822
911 Ga0501040_0274971
912 Ga0501040_0284088
913 Ga0501040_0419087
914 Ga0501041_0076908
915 Ga0501041_0285952
916 Ga0501041_0302103
917 Ga0501041_0405028
918 Ga0501042_0559959
919 Ga0501042_0984984
920 Ga0501046_0071634
921 Ga0501046_0802881
922 Ga0501048_0292721
923 Ga0501048_0861155
924 Ga0501067_0851766
925 Ga0501069_0899410
926 Ga0501070_0061735
927 Ga0501071_0545994
928 Ga0501071_1426285
929 Ga0501071_1503222
930 Ga0501072_0492239
931 Ga0501072_0780773
932 Ga0501072_0888330
933 Ga0501073_0521497
934 Ga0501074_0023933
935 Ga0501074_0702151
936 Ga0501075_0134451
937 Ga0501075_0374627
938 Ga0501075_0503391
939 Ga0501075_0527220
940 Ga0501075_0609478
941 Ga0501075_1122654
942 Ga0501076_0036388
943 Ga0501076_0056678
944 Ga0501076_0112529
945 Ga0501076_0155952
946 Ga0501076_0301829
947 Ga0501076_0502160
948 Ga0501076_1193397
949 Ga0501077_0048945
950 Ga0501077_0200935
951 Ga0501077_0600999
952 Ga0501221_222802
953 Ga0501079_0049269
954 Ga0501079_0108149
955 Ga0501079_0161284
956 Ga0501079_0245312
957 Ga0501079_0423627
958 Ga0501079_0620639
959 Ga0501079_0751226
960 Ga0501079_0771530
961 Ga0501079_0888143
962 Ga0501079_1086488
963 Ga0501079_1486481
964 Ga0501079_1503244
965 Ga0501080_0262113
966 Ga0501080_0512531
967 Ga0501080_1151993
968 Ga0501081_0118215
969 Ga0501081_0133774
970 Ga0501081_0194404
971 Ga0501081_0276010
972 Ga0501081_0398204
973 Ga0501083_0014679
974 Ga0501083_0065020
975 Ga0501083_0396591
976 Ga0501083_0574572
977 Ga0501045_0068307
978 Ga0501045_0195793
979 Ga0501045_0331719
980 Ga0501045_0333974
981 Ga0501045_0442295
982 Ga0501045_0483667
983 Ga0501045_1106396
984 Ga0501045_1400125
985 nmdc:mga03683_106233_c1
986 nmdc:mga03683_3108_c2
987 nmdc:mga00v17_165224_c1
988 nmdc:mga0yw44_438607_c1
989 nmdc:mga0yw44_440428_c1
990 nmdc:mga0yw44_548399_c1
991 nmdc:mga0yw44_63709_c1
992 nmdc:mga0k408_149640_c1
993 nmdc:mga0k408_438366_c1
994 nmdc:mga0k408_553600_c1
995 nmdc:mga06z11_24085_c1
996 nmdc:mga06z11_943427_c1
997 nmdc:mga04h51_232820_c1
998 nmdc:mga07m45_146181_c1
999 nmdc:mga05p37_345895_c1
1000 nmdc:mga05p37_701836_c1
1001 nmdc:mga09592_531871_c1
1002 nmdc:mga09592_826412_c1
1003 nmdc:mga09592_895230_c1
1004 nmdc:mga0qj67_23136_c1
1005 nmdc:mga06r32_1340185_c1
1006 nmdc:mga06r32_308153_c1
1007 nmdc:mga06r32_3657_c1
1008 nmdc:mga06r32_40579_c1
1009 nmdc:mga06r32_905507_c1
1010 nmdc:mga08y16_3344_c1
1011 nmdc:mga08y16_6454_c1
1012 nmdc:mga0n895_579818_c1
1013 nmdc:mga0a205_183827_c1
1014 nmdc:mga0a205_72097_c1
1015 nmdc:mga0a205_885364_c1
1016 nmdc:mga0sz30_453255_c1
1017 Ga0495655_0134878
1018 Ga0500646_0290670
1019 Ga0500651_0070131
1020 Ga0500641_0021113
1021 Ga0500650_0176798
1022 Ga0500597_352932
1023 Ga0500642_0305803
1024 Ga0501084_0077318
1025 Ga0501084_0081911
1026 Ga0501084_0094944
1027 Ga0501084_0154661
1028 Ga0501084_0683400
1029 Ga0501084_1039683
1030 Ga0501082_0084632
1031 Ga0501082_0286112
1032 Ga0501082_0644097
1033 Ga0530510_0070702
1034 Ga0530510_0073271
1035 Ga0530510_0109697
1036 Ga0530510_0209876
1037 Ga0530510_0660393
1038 Ga0530510_0805576
1039 Ga0530510_1443835
1040 2513694452
1041 2513701255
1042 2723849061
1043 2793079804
1044 2824735669
1045 2874607040
1046 2874620471
1047 2879117127
1048 2889034860
1049 2908776780
1050 8006965041
1051 8006995288
1052 8056679218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vab-assembly1.cif.gz_R cryo-em structure of the non-acylated tirzepatide (ly3298176)-bound human gipr-gs complex 0.4738 6 106
7vab-assembly1.cif.gz_R cryo-em structure of the non-acylated tirzepatide (ly3298176)-bound human gipr-gs complex 0.423 6 106
5g49-assembly1.cif.gz_A crystal structure of the arabodopsis thaliana histone-fold dimer l1l nf-yc3 0.3824 22 107
5g49-assembly1.cif.gz_A crystal structure of the arabodopsis thaliana histone-fold dimer l1l nf-yc3 0.3463 22 107
8am5-assembly1.cif.gz_l rcii/psi complex, class 3 0.3409 6 105
ID Description Score Start End Superfamily
2y3dA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4556 57 106 1.20.120.1490
af_A4D1F6_755_850_1.10.533.10 Mainly Alpha;Orthogonal Bundle;Death Domain, Fas;Death Domain, Fas 0.4359 3 108 1.10.533.10
af_A4D1F6_755_850_1.10.533.10 Mainly Alpha;Orthogonal Bundle;Death Domain, Fas;Death Domain, Fas 0.4289 3 108 1.10.533.10
af_O02279_261_506_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.4116 24 107 1.10.565.10
af_O44668_157_360_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.4028 47 106 1.10.565.10
ID Description Score Start End GO Terms
AF-A0A3A0G345-F1-model_v4 HEAT repeat domain-containing protein 0.9914 1 95 GO:0016020
AF-A0A0H5BAS5-F1-model_v4 Uncharacterized protein 0.9871 1 108 GO:0016020
AF-A0A0H5BAS5-F1-model_v4 Uncharacterized protein 0.9781 1 108 GO:0016020
AF-A0A1E4CTV1-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9533 16 108 GO:0016020
AF-A0A2N6B2U7-F1-model_v4 Uncharacterized protein 0.9375 3 108 GO:0016020

Map