F459479

General Info

Members Datasets Scaffolds Average Seq Length
526 294 467 333

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0013024|Ga0501043_0013024_238_1398
Length 386
Sequence MRTCIACSSARPNERRRVVVENTFGQSALHEAGLGEEGTVSKGPVNPPAYWYGDLPVPFGARLLSGVYGTLSGLRRGAYRKGWFKRRHPGVPVLVVGNLTAGGAGKTPLTIALVERLRAEGWNPGVASRGYGRDDAGTARWVDTKSDAAQGGDEPVLIAHRTGAPVRVDKDRAAAAGALAQAGCDLVICDDGLQHYRLARDIEIEVVDGRRRYGNGRLLPAGPLRELPERGQTCDFRVVNVGTGGTATGFGEWSMRLVADAVDPMLGGRARKLGSFSGQRVHAVAGIGDPERFFSMLRDFGIAVVPHAFSDHHQYQAGDFEFGSRELPVLMTEKDAVKCAAFADERFFSVPVRAELPEAFWVSLLDRVAAKARQYRDGRASGTKTA

Samples

Sample ID Description Type Environment
1 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221573 Lysobacter sp. Root604 Isolate Unclassified
6 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
7 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
8 2643221586 Lysobacter sp. Root667 Isolate Unclassified
9 2643221593 Lysobacter sp. Root690 Isolate Unclassified
10 2643221612 Lysobacter sp. Root76 Isolate Unclassified
11 2643221695 Lysobacter sp. Root494 Isolate Unclassified
12 2643221720 Lysobacter sp. Root916 Isolate Unclassified
13 2643221727 Lysobacter sp. Root96 Isolate Unclassified
14 2643221728 Lysobacter sp. Root983 Isolate Unclassified
15 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
16 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
17 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
18 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
19 2818991457 Xanthomonas translucens 569 Isolate Unclassified
20 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
21 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
22 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
23 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
24 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
25 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
26 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
27 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
28 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
29 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
30 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
31 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
32 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
33 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
34 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
35 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
36 2919513703 Luteimonas sp. 3794 Isolate Unclassified
37 2919675420 Luteimonas terrae 4099 Isolate Unclassified
38 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
39 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
40 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
41 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
42 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
43 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
44 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
45 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
46 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
47 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
48 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
49 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
50 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
51 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
52 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
53 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
54 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
55 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
56 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
57 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
60 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
63 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
64 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
65 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
66 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
67 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
68 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
69 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
70 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
74 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
80 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
125 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
129 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
180 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
181 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
182 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
183 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
201 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
202 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
205 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
206 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
207 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
210 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
211 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
212 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
215 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
216 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
217 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
275 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
287 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
288 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
289 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
290 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
291 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
292 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
293 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
294 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.78
Metatranscriptomes 0
Isolates 11.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 19.58
Nodule 0.19
Rhizoplane 3.04
Rhizosphere 54.56
Stem 0
Stem Tuber 0
Unclassified 22.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000035 3300002773 Bacteria 93806
2 JGI25150J39212_1000236 3300002774 Bacteria 30024
3 JGI25151J46595_10000057 3300003187 Bacteria 151052
4 JGI25151J46595_10000080 3300003187 Bacteria 131551
5 JGI25151J46595_10005659 3300003187 Bacteria 6423
6 JGI25153J46596_10000041 3300003215 Bacteria 162103
7 rootH2_10014268 3300003320 Bacteria 20171
8 rootH1_10127287 3300003323 Bacteria 7746
9 Ga0055526_1000024 3300003771 Bacteria 158479
10 Ga0055526_1000405 3300003771 Bacteria 34858
11 Ga0055537_1000051 3300003773 Bacteria 85079
12 Ga0055537_1000500 3300003773 Bacteria 23689
13 Ga0055524_1000142 3300003775 Bacteria 85070
14 Ga0055524_1007691 3300003775 Bacteria 4552
15 Ga0055536_1004054 3300003781 Bacteria 7628
16 Ga0055536_1005362 3300003781 Bacteria 6289
17 Ga0055536_1005471 3300003781 Bacteria 6197
18 Ga0055536_1006528 3300003781 Bacteria 5421
19 Ga0055536_1009373 3300003781 Bacteria 4052
20 Ga0055534_1000058 3300003784 Bacteria 85079
21 Ga0055534_1000155 3300003784 Bacteria 51103
22 Ga0055528_1000016 3300003790 Bacteria 158479
23 Ga0055528_1000093 3300003790 Bacteria 71453
24 Ga0055530_10002531 3300003791 Bacteria 11650
25 Ga0055530_10003554 3300003791 Bacteria 8779
26 Ga0055530_10003555 3300003791 Bacteria 8776
27 Ga0055531_10006364 3300003794 Bacteria 6717
28 Ga0055531_10006830 3300003794 Bacteria 6367
29 Ga0055531_10008743 3300003794 Bacteria 5284
30 Ga0055531_10008871 3300003794 Bacteria 5224
31 Ga0055531_10010246 3300003794 Bacteria 4685
32 Ga0055531_10010598 3300003794 Bacteria 4558
33 Ga0055531_10012348 3300003794 Bacteria 4027
34 Ga0055531_10027113 3300003794 Bacteria 2021
35 Ga0058692_1000002 3300003856 Bacteria 508401
36 Ga0058692_1000006 3300003856 Bacteria 398109
37 Ga0065714_10132794 3300005288 Bacteria 1235
38 Ga0065704_10071998 3300005289 Bacteria 9420
39 Ga0065704_10074223 3300005289 Bacteria 6427
40 Ga0070670_100016146 3300005331 Bacteria 6409
41 Ga0068869_100298419 3300005334 Bacteria 1300
42 Ga0070680_100022902 3300005336 Bacteria 4977
43 Ga0070680_100155692 3300005336 Bacteria 1920
44 Ga0070680_100159561 3300005336 Bacteria 1894
45 Ga0068868_100325654 3300005338 Bacteria 1310
46 Ga0070660_100011869 3300005339 Bacteria 6209
47 Ga0070668_100017065 3300005347 Bacteria 5431
48 Ga0070669_100069083 3300005353 Bacteria 2609
49 Ga0070669_100078989 3300005353 Bacteria 2446
50 Ga0070675_100194584 3300005354 Bacteria 1758
51 Ga0070671_100116826 3300005355 Bacteria 2243
52 Ga0070667_100000108 3300005367 Bacteria 105301
53 Ga0070667_100229407 3300005367 Bacteria 1655
54 Ga0070714_100235785 3300005435 Bacteria 1687
55 Ga0070700_100003344 3300005441 Bacteria 8270
56 Ga0070663_100000070 3300005455 Bacteria 44357
57 Ga0070663_100077540 3300005455 Bacteria 2433
58 Ga0070663_100123863 3300005455 Bacteria 1956
59 Ga0070681_10043160 3300005458 Bacteria 4518
60 Ga0070681_10074311 3300005458 Bacteria 3360
61 Ga0068867_100060721 3300005459 Bacteria 2805
62 Ga0068867_100086219 3300005459 Bacteria 2375
63 Ga0070679_100076945 3300005530 Bacteria 3325
64 Ga0070679_100147247 3300005530 Bacteria 2332
65 Ga0068853_100002884 3300005539 Bacteria 13042
66 Ga0068853_100004551 3300005539 Bacteria 10759
67 Ga0068853_100028903 3300005539 Bacteria 4667
68 Ga0070672_100019135 3300005543 Bacteria 4964
69 Ga0070696_100036036 3300005546 Bacteria 3409
70 Ga0070665_100038534 3300005548 Bacteria 4805
71 Ga0070664_100325434 3300005564 Bacteria 1394
72 Ga0068856_100009238 3300005614 Bacteria 9587
73 Ga0068864_100024810 3300005618 Bacteria 5043
74 Ga0068863_100002876 3300005841 Bacteria 17046
75 Ga0068858_100235280 3300005842 Bacteria 1737
76 Ga0068860_100130283 3300005843 Bacteria 2413
77 Ga0068862_100153024 3300005844 Bacteria 2054
78 Ga0075364_10000141 3300006051 Bacteria 31242
79 Ga0075364_10325110 3300006051 Bacteria 1047
80 Ga0075367_10064513 3300006178 Bacteria 2191
81 Ga0068871_100099970 3300006358 Bacteria 2429
82 Ga0105251_10000261 3300009011 Bacteria 52880
83 Ga0105244_10115220 3300009036 Bacteria 1305
84 Ga0105250_10000006 3300009092 Bacteria 390071
85 Ga0105240_10005759 3300009093 Bacteria 18377
86 Ga0105243_10003831 3300009148 Bacteria 12028
87 Ga0105243_10015888 3300009148 Bacteria 5693
88 Ga0105243_10049201 3300009148 Bacteria 3324
89 Ga0105248_10002649 3300009177 Bacteria 19869
90 Ga0105248_10383497 3300009177 Bacteria 1582
91 Ga0105237_10001198 3300009545 Bacteria 34705
92 Ga0105237_10008213 3300009545 Bacteria 11339
93 Ga0105237_10040038 3300009545 Bacteria 4728
94 Ga0105249_10000426 3300009553 Bacteria 40153
95 Ga0105032_101928 3300009979 Bacteria 1874
96 Ga0105239_10006000 3300010375 Bacteria 14138
97 Ga0105239_10012655 3300010375 Bacteria 9387
98 Ga0157318_1000419 3300012482 Bacteria 1787
99 Ga0157373_10145519 3300013100 Bacteria 1667
100 Ga0157371_10000314 3300013102 Bacteria 63006
101 Ga0157371_10009804 3300013102 Bacteria 7513
102 Ga0157371_10021425 3300013102 Bacteria 4746
103 Ga0157371_10125848 3300013102 Bacteria 1822
104 Ga0157371_10181806 3300013102 Bacteria 1504
105 Ga0157370_10038859 3300013104 Bacteria 4603
106 Ga0157370_10042796 3300013104 Bacteria 4362
107 Ga0157370_10291476 3300013104 Bacteria 1507
108 Ga0157369_10037066 3300013105 Bacteria 5340
109 Ga0157369_10199750 3300013105 Bacteria 2099
110 Ga0157378_10252466 3300013297 Bacteria 1689
111 Ga0157372_10037434 3300013307 Bacteria 5352
112 Ga0157380_10193384 3300014326 Bacteria 1798
113 Ga0182008_10000264 3300014497 Bacteria 41157
114 Ga0182008_10024516 3300014497 Bacteria 3070
115 Ga0157379_10000087 3300014968 Bacteria 61431
116 Ga0182006_1012761 3300015261 Bacteria 3669
117 Ga0182007_10000111 3300015262 Bacteria 55925
118 Ga0182005_1000255 3300015265 Bacteria 33823
119 Ga0182005_1003003 3300015265 Bacteria 5831
120 Ga0183360_10001 3300015689 Bacteria 3943671
121 Ga0163161_10005943 3300017792 Bacteria 8460
122 Ga0163161_10013091 3300017792 Bacteria 5765
123 Ga0163161_10036670 3300017792 Bacteria 3512
124 Ga0207425_1000044 3300025245 Bacteria 195202
125 Ga0209026_1000158 3300025250 Bacteria 106333
126 Ga0209759_1005506 3300025256 Bacteria 4419
127 Ga0209129_1000044 3300025258 Bacteria 298971
128 Ga0209565_1000001 3300025263 Bacteria 2950419
129 Ga0209565_1000014 3300025263 Bacteria 530302
130 Ga0209455_1001416 3300025272 Bacteria 10865
131 Ga0209673_1000001 3300025273 Bacteria 3176258
132 Ga0209673_1000570 3300025273 Bacteria 58750
133 Ga0209673_1001811 3300025273 Bacteria 17554
134 Ga0209130_1003727 3300025284 Bacteria 6241
135 Ga0209675_1000001 3300025291 Bacteria 2950293
136 Ga0209675_1000021 3300025291 Bacteria 334833
137 Ga0209675_1009024 3300025291 Bacteria 3577
138 Ga0209676_1000024 3300025292 Bacteria 578839
139 Ga0209676_1000047 3300025292 Bacteria 408645
140 Ga0209676_1000079 3300025292 Bacteria 290447
141 Ga0209676_1001617 3300025292 Bacteria 19932
142 Ga0209676_1002237 3300025292 Bacteria 14284
143 Ga0209676_1002587 3300025292 Bacteria 12450
144 Ga0209676_1003153 3300025292 Bacteria 10529
145 Ga0209676_1004292 3300025292 Bacteria 8035
146 Ga0209676_1010370 3300025292 Bacteria 3895
147 Ga0209676_1013373 3300025292 Bacteria 3159
148 Ga0209025_1000012 3300025294 Bacteria 924362
149 Ga0209025_1000015 3300025294 Bacteria 808120
150 Ga0209025_1001739 3300025294 Bacteria 26163
151 Ga0209025_1029027 3300025294 Bacteria 2691
152 Ga0209025_1029972 3300025294 Bacteria 2616
153 Ga0209025_1035259 3300025294 Bacteria 2264
154 Ga0209025_1041550 3300025294 Bacteria 1967
155 Ga0209564_1000001 3300025295 Bacteria 3176258
156 Ga0209564_1000990 3300025295 Bacteria 35493
157 Ga0209564_1007773 3300025295 Bacteria 5444
158 Ga0209758_1000018 3300025297 Bacteria 753320
159 Ga0209758_1006183 3300025297 Bacteria 8754
160 Ga0209758_1020298 3300025297 Bacteria 3151
161 Ga0209758_1035302 3300025297 Bacteria 1973
162 Ga0209050_1000153 3300025298 Bacteria 160851
163 Ga0209050_1000311 3300025298 Bacteria 98948
164 Ga0209050_1002075 3300025298 Bacteria 18403
165 Ga0209050_1009393 3300025298 Bacteria 5013
166 Ga0209050_1009397 3300025298 Bacteria 5011
167 Ga0209256_1000002 3300025299 Bacteria 1906740
168 Ga0209256_1000890 3300025299 Bacteria 36781
169 Ga0209256_1000896 3300025299 Bacteria 36605
170 Ga0209256_1001492 3300025299 Bacteria 23795
171 Ga0209256_1002854 3300025299 Bacteria 13160
172 Ga0209051_1000458 3300025303 Bacteria 53808
173 Ga0209051_1011731 3300025303 Bacteria 4302
174 Ga0209257_1000080 3300025304 Bacteria 312038
175 Ga0209257_1000081 3300025304 Bacteria 306577
176 Ga0209257_1000122 3300025304 Bacteria 219678
177 Ga0209257_1001214 3300025304 Bacteria 32372
178 Ga0209257_1001644 3300025304 Bacteria 25517
179 Ga0209257_1001670 3300025304 Bacteria 25081
180 Ga0209257_1002094 3300025304 Bacteria 20980
181 Ga0209257_1002725 3300025304 Bacteria 16789
182 Ga0209257_1003816 3300025304 Bacteria 12372
183 Ga0209257_1012717 3300025304 Bacteria 3849
184 Ga0207696_1000333 3300025711 Bacteria 49519
185 Ga0207713_1000598 3300025735 Bacteria 35526
186 Ga0207707_10181706 3300025912 Bacteria 1836
187 Ga0207695_10002149 3300025913 Bacteria 29878
188 Ga0207671_10002319 3300025914 Bacteria 20536
189 Ga0207671_10003475 3300025914 Bacteria 15671
190 Ga0207660_10059885 3300025917 Bacteria 2735
191 Ga0207660_10409297 3300025917 Bacteria 1093
192 Ga0207657_10005785 3300025919 Bacteria 12892
193 Ga0207652_10102277 3300025921 Bacteria 2532
194 Ga0207681_10405023 3300025923 Bacteria 1102
195 Ga0207650_10002277 3300025925 Bacteria 13392
196 Ga0207659_10129103 3300025926 Bacteria 1948
197 Ga0207664_10314264 3300025929 Bacteria 1381
198 Ga0207706_10135253 3300025933 Bacteria 2168
199 Ga0207709_10000767 3300025935 Bacteria 25291
200 Ga0207709_10028069 3300025935 Bacteria 3250
201 Ga0207691_10001092 3300025940 Bacteria 26983
202 Ga0207667_10139931 3300025949 Bacteria 2492
203 Ga0207712_10000363 3300025961 Bacteria 40122
204 Ga0207668_10018993 3300025972 Bacteria 4335
205 Ga0207658_10000093 3300025986 Bacteria 98928
206 Ga0207658_10087686 3300025986 Bacteria 2404
207 Ga0207703_10334370 3300026035 Bacteria 1390
208 Ga0207639_10001135 3300026041 Bacteria 18080
209 Ga0207639_10084754 3300026041 Bacteria 2518
210 Ga0207678_10030184 3300026067 Bacteria 4733
211 Ga0207678_10033888 3300026067 Bacteria 4448
212 Ga0207708_10002841 3300026075 Bacteria 12741
213 Ga0207702_10000290 3300026078 Bacteria 58330
214 Ga0207641_10161011 3300026088 Bacteria 2040
215 Ga0207648_10043250 3300026089 Bacteria 3954
216 Ga0207648_10067367 3300026089 Bacteria 3121
217 Ga0207676_10043278 3300026095 Bacteria 3467
218 Ga0207674_10009737 3300026116 Bacteria 10949
219 Ga0209371_1000004 3300027312 Bacteria 1098197
220 Ga0209371_1000016 3300027312 Bacteria 646301
221 Ga0209970_1004953 3300027614 Bacteria 2202
222 Ga0209983_1004093 3300027665 Bacteria 3078
223 Ga0209971_1001280 3300027682 Bacteria 6267
224 Ga0268266_10011472 3300028379 Bacteria 7698
225 Ga0268266_10305283 3300028379 Bacteria 1486
226 Ga0268265_10037052 3300028380 Bacteria 3576
227 Ga0268265_10077648 3300028380 Bacteria 2609
228 Ga0268265_10105775 3300028380 Bacteria 2284
229 Ga0268264_10240386 3300028381 Bacteria 1677
230 Ga0268256_1000005 3300030500 Bacteria 1082342
231 Ga0268256_1000015 3300030500 Bacteria 646300
232 Ga0316177_1042085 3300030731 Bacteria 2227
233 Ga0316176_1019534 3300030732 Bacteria 1940
234 Ga0316176_1165582 3300030732 Bacteria 5946
235 Ga0314311_1184420 3300030733 Bacteria 4554
236 Ga0316183_1123718 3300030742 Bacteria 4353
237 Ga0307513_10004763 3300031456 Bacteria 18017
238 Ga0307408_100351360 3300031548 Bacteria 1251
239 Ga0307405_10119429 3300031731 Bacteria 1801
240 Ga0307413_10002372 3300031824 Bacteria 7643
241 Ga0307410_10276870 3300031852 Bacteria 1315
242 Ga0307406_10022304 3300031901 Bacteria 3755
243 Ga0307407_10040456 3300031903 Bacteria 2599
244 Ga0307412_10000115 3300031911 Bacteria 61620
245 Ga0307414_10003669 3300032004 Bacteria 8228
246 Ga0307414_10009845 3300032004 Bacteria 5510
247 Ga0307414_10010133 3300032004 Bacteria 5451
248 Ga0307414_10104409 3300032004 Bacteria 2140
249 Ga0307414_10130437 3300032004 Bacteria 1950
250 Ga0307414_10163979 3300032004 Bacteria 1769
251 Ga0307414_10172519 3300032004 Bacteria 1730
252 Ga0307411_10096481 3300032005 Bacteria 2078
253 Ga0373960_0014119 3300035121 Bacteria 2018
254 Ga0395899_0005871 3300037312 Bacteria 9528
255 Ga0395899_0069674 3300037312 Bacteria 2575
256 Ga0395900_0001828 3300037418 Bacteria 24288
257 Ga0395900_0462862 3300037418 Bacteria 1223
258 Ga0395898_0334377 3300037466 Bacteria 1444
259 Ga0395905_0001042 3300037471 Bacteria 35110
260 Ga0395905_0275723 3300037471 Bacteria 1567
261 Ga0395901_0061175 3300038443 Bacteria 3918
262 Ga0237819_00245 3300038705 Bacteria 19768
263 Ga0237819_09465 3300038705 Bacteria 1306
264 Ga0439436_0004573 3300041404 Bacteria 4241
265 Ga0439436_0031546 3300041404 Bacteria 1538
266 Ga0439436_0039942 3300041404 Bacteria 1346
267 Ga0439447_005127 3300041407 Bacteria 4396
268 Ga0439465_0000027 3300041413 Bacteria 29319
269 Ga0439465_0002863 3300041413 Bacteria 5650
270 Ga0439465_0025392 3300041413 Bacteria 1870
271 Ga0451791_1488951 3300041451 Bacteria 1378
272 Ga0451793_0311360 3300041452 Bacteria 2808
273 Ga0451793_0603339 3300041452 Bacteria 2003
274 Ga0451797_0254407 3300041453 Bacteria 1431
275 Ga0451798_0509102 3300041458 Bacteria 1860
276 Ga0451807_0176940 3300041486 Bacteria 1448
277 Ga0451807_1026026 3300041486 Bacteria 3941
278 Ga0451841_0931635 3300041498 Bacteria 1518
279 Ga0451847_0753956 3300041503 Bacteria 1760
280 Ga0451849_0742676 3300041505 Bacteria 1506
281 Ga0451843_0088182 3300041509 Bacteria 1233
282 Ga0451853_0870536 3300041512 Bacteria 1575
283 Ga0439432_003034 3300042006 Bacteria 6252
284 Ga0439432_017675 3300042006 Bacteria 2391
285 Ga0439449_0000093 3300042007 Bacteria 28815
286 Ga0439449_0027914 3300042007 Bacteria 2105
287 Ga0439449_0034219 3300042007 Bacteria 1891
288 Ga0439449_0040916 3300042007 Bacteria 1723
289 Ga0439449_0100209 3300042007 Bacteria 1071
290 Ga0439452_008963 3300042010 Bacteria 2979
291 Ga0450901_002690 3300042533 Bacteria 1895
292 Ga0451577_0018280 3300042876 Bacteria 6459
293 Ga0495627_033463 3300046453 Bacteria 1611
294 Ga0495638_0011107 3300046460 Bacteria 6224
295 Ga0495607_0005959 3300046501 Bacteria 8643
296 Ga0495606_0008762 3300046507 Bacteria 8692
297 Ga0495610_0009775 3300046512 Bacteria 6026
298 Ga0495616_0012826 3300046513 Bacteria 4742
299 Ga0495631_0001216 3300046518 Bacteria 15899
300 Ga0495632_0053195 3300046519 Bacteria 1989
301 Ga0495643_0002561 3300046522 Bacteria 14201
302 Ga0495663_0001531 3300046525 Bacteria 7267
303 Ga0495663_0002073 3300046525 Bacteria 6130
304 Ga0495663_0003516 3300046525 Bacteria 4514
305 Ga0495663_0011852 3300046525 Bacteria 2429
306 Ga0495598_0000769 3300046537 Bacteria 6112
307 Ga0495621_0005091 3300046539 Bacteria 3751
308 Ga0495633_0020789 3300046558 Bacteria 3295
309 Ga0495656_0002051 3300046615 Bacteria 6643
310 Ga0495656_0003135 3300046615 Bacteria 5561
311 Ga0495668_0001007 3300046616 Bacteria 30277
312 Ga0495625_0083212 3300046660 Bacteria 2224
313 Ga0495625_0105148 3300046660 Bacteria 1934
314 Ga0495670_0050511 3300046691 Bacteria 2082
315 Ga0495671_0004376 3300046692 Bacteria 8464
316 Ga0495636_0003114 3300047318 Bacteria 6434
317 Ga0495672_0000134 3300047320 Bacteria 110142
318 Ga0495672_0062459 3300047320 Bacteria 2142
319 Ga0495681_0094090 3300047470 Bacteria 1319
320 Ga0495686_0006280 3300047472 Bacteria 9141
321 Ga0495686_0010513 3300047472 Bacteria 6577
322 Ga0495686_0022413 3300047472 Bacteria 4180
323 Ga0496101_0164445 3300048904 Bacteria 1703
324 Ga0496105_0102454 3300048908 Bacteria 2364
325 Ga0496106_0177986 3300048909 Bacteria 1688
326 Ga0496107_0196068 3300048910 Bacteria 1501
327 Ga0496108_0236891 3300048911 Bacteria 1587
328 Ga0496109_0025862 3300048912 Bacteria 5232
329 Ga0496110_0110397 3300048913 Bacteria 2471
330 Ga0496113_0061694 3300048916 Bacteria 2829
331 Ga0496114_0002418 3300048917 Bacteria 14241
332 Ga0496116_0000379 3300048919 Bacteria 66179
333 Ga0496116_0004882 3300048919 Bacteria 12649
334 Ga0496116_0048604 3300048919 Bacteria 2845
335 Ga0496117_0002130 3300048920 Bacteria 25899
336 Ga0496117_0003468 3300048920 Bacteria 18312
337 Ga0496117_0004169 3300048920 Bacteria 16159
338 Ga0496117_0024962 3300048920 Bacteria 4708
339 Ga0496117_0027916 3300048920 Bacteria 4380
340 Ga0496117_0049132 3300048920 Bacteria 3004
341 Ga0496117_0077420 3300048920 Bacteria 2201
342 Ga0496117_0084608 3300048920 Bacteria 2068
343 Ga0496118_0000145 3300048921 Bacteria 123886
344 Ga0496118_0000166 3300048921 Bacteria 119204
345 Ga0496118_0000573 3300048921 Bacteria 60932
346 Ga0496118_0022049 3300048921 Bacteria 5583
347 Ga0496118_0027038 3300048921 Bacteria 4866
348 Ga0496118_0039516 3300048921 Bacteria 3763
349 Ga0496118_0077296 3300048921 Bacteria 2361
350 Ga0496118_0085457 3300048921 Bacteria 2197
351 Ga0496119_0000211 3300048922 Bacteria 83064
352 Ga0496119_0000550 3300048922 Bacteria 51088
353 Ga0496119_0019937 3300048922 Bacteria 4912
354 Ga0496120_0000432 3300048923 Bacteria 66285
355 Ga0496120_0004047 3300048923 Bacteria 12694
356 Ga0496121_0007855 3300048924 Bacteria 12757
357 Ga0496121_0018930 3300048924 Bacteria 6909
358 Ga0496121_0026218 3300048924 Bacteria 5500
359 Ga0496121_0034397 3300048924 Bacteria 4561
360 Ga0496121_0055823 3300048924 Bacteria 3287
361 Ga0496121_0112477 3300048924 Bacteria 2074
362 Ga0496121_0163728 3300048924 Bacteria 1623
363 Ga0496122_0000158 3300048925 Bacteria 159352
364 Ga0496122_0001084 3300048925 Bacteria 47272
365 Ga0496122_0001279 3300048925 Bacteria 41853
366 Ga0496122_0006292 3300048925 Bacteria 13689
367 Ga0496122_0012051 3300048925 Bacteria 8668
368 Ga0496122_0035673 3300048925 Bacteria 4040
369 Ga0496122_0037021 3300048925 Bacteria 3935
370 Ga0496122_0042863 3300048925 Bacteria 3554
371 Ga0496122_0044515 3300048925 Bacteria 3461
372 Ga0496122_0047560 3300048925 Bacteria 3311
373 Ga0496122_0103483 3300048925 Bacteria 1894
374 Ga0496123_0000120 3300048926 Bacteria 159406
375 Ga0496123_0002035 3300048926 Bacteria 26128
376 Ga0496123_0004739 3300048926 Bacteria 14079
377 Ga0496123_0005462 3300048926 Bacteria 12794
378 Ga0496123_0018827 3300048926 Bacteria 5472
379 Ga0496123_0020303 3300048926 Bacteria 5201
380 Ga0496123_0029301 3300048926 Bacteria 4056
381 Ga0496123_0036030 3300048926 Bacteria 3515
382 Ga0496123_0037707 3300048926 Bacteria 3409
383 Ga0496124_0000009 3300048927 Bacteria 734820
384 Ga0496124_0000255 3300048927 Bacteria 102645
385 Ga0496124_0000700 3300048927 Bacteria 54959
386 Ga0496124_0010152 3300048927 Bacteria 9580
387 Ga0496124_0011563 3300048927 Bacteria 8808
388 Ga0496124_0012194 3300048927 Bacteria 8504
389 Ga0496124_0020070 3300048927 Bacteria 6189
390 Ga0496124_0032446 3300048927 Bacteria 4610
391 Ga0496124_0076106 3300048927 Bacteria 2771
392 Ga0496124_0117953 3300048927 Bacteria 2125
393 Ga0496124_0143116 3300048927 Bacteria 1884
394 Ga0496124_0227914 3300048927 Bacteria 1395
395 Ga0496124_0327243 3300048927 Bacteria 1094
396 Ga0496124_0348530 3300048927 Bacteria 1048
397 Ga0496125_0001909 3300048928 Bacteria 28515
398 Ga0496125_0013398 3300048928 Bacteria 8063
399 Ga0496125_0016061 3300048928 Bacteria 7207
400 Ga0496125_0019874 3300048928 Bacteria 6318
401 Ga0496125_0044544 3300048928 Bacteria 3750
402 Ga0496125_0086287 3300048928 Bacteria 2374
403 Ga0496126_0000806 3300048929 Bacteria 56104
404 Ga0496126_0017421 3300048929 Bacteria 7158
405 Ga0501031_0007389 3300049568 Bacteria 7160
406 Ga0501031_0034121 3300049568 Bacteria 3321
407 Ga0501032_0001852 3300049569 Bacteria 16730
408 Ga0501032_0022563 3300049569 Bacteria 4362
409 Ga0501032_0031644 3300049569 Bacteria 3627
410 Ga0501032_0182851 3300049569 Bacteria 1372
411 Ga0501033_0001325 3300049570 Bacteria 22021
412 Ga0501033_0004497 3300049570 Bacteria 11158
413 Ga0501033_0148984 3300049570 Bacteria 1689
414 Ga0501034_0000415 3300049571 Bacteria 71688
415 Ga0501034_0000431 3300049571 Bacteria 69520
416 Ga0501034_0006842 3300049571 Bacteria 12199
417 Ga0501034_0009734 3300049571 Bacteria 10048
418 Ga0501034_0013640 3300049571 Bacteria 8357
419 Ga0501036_0025497 3300049572 Bacteria 4988
420 Ga0501036_0045063 3300049572 Bacteria 3737
421 Ga0501037_0002636 3300049573 Bacteria 12927
422 Ga0501037_0006365 3300049573 Bacteria 8634
423 Ga0501038_0000372 3300049574 Bacteria 38621
424 Ga0501038_0056930 3300049574 Bacteria 3357
425 Ga0501039_0040530 3300049575 Bacteria 3595
426 Ga0501039_0051701 3300049575 Bacteria 3179
427 Ga0501039_0371412 3300049575 Bacteria 1124
428 Ga0501043_0013024 3300049579 Bacteria 6501
429 Ga0501043_0028687 3300049579 Bacteria 4368
430 Ga0501043_0110393 3300049579 Bacteria 2159
431 Ga0501043_0133466 3300049579 Bacteria 1946
432 Ga0501046_0000242 3300049580 Bacteria 56090
433 Ga0501047_0012320 3300049581 Bacteria 8094
434 Ga0501047_0049579 3300049581 Bacteria 4054
435 Ga0501047_0071060 3300049581 Bacteria 3351
436 Ga0501047_0299157 3300049581 Bacteria 1452
437 Ga0501070_0032812 3300049586 Bacteria 4344
438 Ga0501070_0065520 3300049586 Bacteria 3008
439 Ga0501070_0091295 3300049586 Bacteria 2521
440 Ga0501073_0011860 3300049589 Bacteria 6363
441 Ga0501073_0020523 3300049589 Bacteria 4765
442 Ga0501223_008954 3300049663 Bacteria 2035
443 Ga0501257_026183 3300049686 Bacteria 1391
444 Ga0501080_0036995 3300049742 Bacteria 4557
445 Ga0501083_0036594 3300049744 Bacteria 3347
446 Ga0501270_001588 3300049767 Bacteria 2205
447 Ga0501035_0002161 3300049822 Bacteria 19514
448 Ga0501035_0009933 3300049822 Bacteria 8837
449 Ga0501035_0029548 3300049822 Bacteria 4999
450 Ga0501035_0198994 3300049822 Bacteria 1719
451 Ga0501044_0014154 3300049823 Bacteria 8612
452 Ga0501044_0015037 3300049823 Bacteria 8343
453 Ga0501044_0042529 3300049823 Bacteria 4725
454 Ga0501044_0049041 3300049823 Bacteria 4358
455 nmdc:mga00v17_152487_c1 3300050491 Bacteria 1485
456 nmdc:mga00v17_31706_c1 3300050491 Bacteria 3119
457 nmdc:mga00v17_39924_c1 3300050491 Bacteria 2813
458 nmdc:mga00v17_88_c1 3300050491 Bacteria 56091
459 nmdc:mga0qj67_36311_c1 3300050509 Bacteria 3855
460 nmdc:mga08x19_104484_c1 3300050514 Bacteria 1882
461 nmdc:mga08x19_71295_c1 3300050514 Bacteria 2265
462 Ga0500610_0006571 3300053079 Bacteria 4887
463 Ga0500651_0110217 3300053093 Bacteria 1680
464 Ga0500597_000184 3300053120 Bacteria 12796
465 Ga0500626_060569 3300053128 Bacteria 1693
466 Ga0500634_0000036 3300053161 Bacteria 64860
467 Ga0500661_015331 3300055283 Bacteria 1375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10015888 Ga0105243_100158882 274
2 3300037418 Ga0395900_0462862 Ga0395900_0462862_32_889 281
3 3300026041 Ga0207639_10084754 Ga0207639_100847542 283
4 3300042007 Ga0439449_0100209 Ga0439449_0100209_17_898 287
5 3300048927 Ga0496124_0348530 Ga0496124_0348530_90_1031 287
6 3300049579 Ga0501043_0133466 Ga0501043_0133466_798_1787 301
7 3300005347 Ga0070668_100017065 Ga0070668_1000170653 303
8 3300005353 Ga0070669_100078989 Ga0070669_1000789892 303
9 3300025972 Ga0207668_10018993 Ga0207668_100189935 303
10 3300048925 Ga0496122_0037021 Ga0496122_0037021_14_970 304
11 3300048927 Ga0496124_0076106 Ga0496124_0076106_611_1567 304
12 3300028379 Ga0268266_10011472 Ga0268266_100114725 305
13 3300028380 Ga0268265_10105775 Ga0268265_101057753 305
14 3300041452 Ga0451793_0311360 Ga0451793_0311360_1199_2191 306
15 3300005367 Ga0070667_100229407 Ga0070667_1002294071 308
16 3300025986 Ga0207658_10087686 Ga0207658_100876862 308
17 3300041452 Ga0451793_0603339 Ga0451793_0603339_678_1670 309
18 3300005618 Ga0068864_100024810 Ga0068864_1000248102 310
19 3300026095 Ga0207676_10043278 Ga0207676_100432783 310
20 3300028380 Ga0268265_10077648 Ga0268265_100776482 310
21 3300046615 Ga0495656_0003135 Ga0495656_0003135_312_1325 310
22 3300048909 Ga0496106_0177986 Ga0496106_0177986_192_1205 310
23 3300048910 Ga0496107_0196068 Ga0496107_0196068_468_1481 310
24 3300048911 Ga0496108_0236891 Ga0496108_0236891_266_1279 310
25 3300005334 Ga0068869_100298419 Ga0068869_1002984192 312
26 3300005455 Ga0070663_100123863 Ga0070663_1001238631 312
27 3300005539 Ga0068853_100028903 Ga0068853_1000289032 312
28 3300005548 Ga0070665_100038534 Ga0070665_1000385342 312
29 3300005841 Ga0068863_100002876 Ga0068863_1000028768 312
30 3300009545 Ga0105237_10040038 Ga0105237_100400382 312
31 3300010375 Ga0105239_10006000 Ga0105239_100060009 312
32 3300026067 Ga0207678_10033888 Ga0207678_100338882 312
33 3300026088 Ga0207641_10161011 Ga0207641_101610112 312
34 3300041503 Ga0451847_0753956 Ga0451847_0753956_200_1195 312
35 3300012482 Ga0157318_1000419 Ga0157318_10004192 313
36 3300025921 Ga0207652_10102277 Ga0207652_101022773 314
37 3300050514 nmdc:mga08x19_104484_c1 nmdc:mga08x19_104484_c1_855_1832 314
38 3300025294 Ga0209025_1035259 Ga0209025_10352592 315
39 3300048925 Ga0496122_0001279 Ga0496122_0001279_9336_10325 315
40 3300048926 Ga0496123_0002035 Ga0496123_0002035_1571_2560 315
41 3300048929 Ga0496126_0017421 Ga0496126_0017421_72_1061 315
42 3300049568 Ga0501031_0007389 Ga0501031_0007389_3167_4156 315
43 3300049569 Ga0501032_0001852 Ga0501032_0001852_6601_7590 315
44 3300049570 Ga0501033_0004497 Ga0501033_0004497_9959_10948 315
45 3300049571 Ga0501034_0006842 Ga0501034_0006842_5160_6149 315
46 3300049571 Ga0501034_0009734 Ga0501034_0009734_6149_7150 315
47 3300049572 Ga0501036_0045063 Ga0501036_0045063_2282_3271 315
48 3300049573 Ga0501037_0002636 Ga0501037_0002636_2074_3063 315
49 3300049574 Ga0501038_0000372 Ga0501038_0000372_20973_21962 315
50 3300049575 Ga0501039_0051701 Ga0501039_0051701_1484_2473 315
51 3300049579 Ga0501043_0110393 Ga0501043_0110393_832_1821 315
52 3300049580 Ga0501046_0000242 Ga0501046_0000242_29160_30149 315
53 3300049581 Ga0501047_0012320 Ga0501047_0012320_5160_6149 315
54 3300049589 Ga0501073_0011860 Ga0501073_0011860_4555_5544 315
55 3300049742 Ga0501080_0036995 Ga0501080_0036995_3388_4377 315
56 3300049822 Ga0501035_0009933 Ga0501035_0009933_2381_3370 315
57 3300049823 Ga0501044_0042529 Ga0501044_0042529_748_1737 315
58 3300053079 Ga0500610_0006571 Ga0500610_0006571_2962_3966 315
59 3300009148 Ga0105243_10049201 Ga0105243_100492014 316
60 3300026075 Ga0207708_10002841 Ga0207708_100028418 316
61 3300048908 Ga0496105_0102454 Ga0496105_0102454_1391_2344 316
62 3300013102 Ga0157371_10009804 Ga0157371_100098046 317
63 3300038705 Ga0237819_09465 Ga0237819_09465_13_969 317
64 3300041498 Ga0451841_0931635 Ga0451841_0931635_287_1309 317
65 3300046460 Ga0495638_0011107 Ga0495638_0011107_2326_3348 317
66 3300046513 Ga0495616_0012826 Ga0495616_0012826_194_1216 317
67 3300046525 Ga0495663_0003516 Ga0495663_0003516_2392_3414 317
68 3300046539 Ga0495621_0005091 Ga0495621_0005091_934_1917 317
69 3300048920 Ga0496117_0084608 Ga0496117_0084608_210_1232 317
70 3300048921 Ga0496118_0022049 Ga0496118_0022049_2193_3215 317
71 3300053128 Ga0500626_060569 Ga0500626_060569_196_1218 317
72 3300009979 Ga0105032_101928 Ga0105032_1019282 318
73 3300013104 Ga0157370_10042796 Ga0157370_100427964 319
74 3300014497 Ga0182008_10000264 Ga0182008_1000026429 319
75 3300017792 Ga0163161_10005943 Ga0163161_100059434 319
76 3300030732 Ga0316176_1165582 Ga0316176_11655825 319
77 3300041451 Ga0451791_1488951 Ga0451791_1488951_87_1106 319
78 3300041453 Ga0451797_0254407 Ga0451797_0254407_114_1133 319
79 3300041458 Ga0451798_0509102 Ga0451798_0509102_810_1829 319
80 3300041486 Ga0451807_0176940 Ga0451807_0176940_163_1182 319
81 3300041509 Ga0451843_0088182 Ga0451843_0088182_184_1203 319
82 3300041512 Ga0451853_0870536 Ga0451853_0870536_122_1141 319
83 3300048913 Ga0496110_0110397 Ga0496110_0110397_17_1039 319
84 3300048916 Ga0496113_0061694 Ga0496113_0061694_1492_2514 319
85 3300048920 Ga0496117_0002130 Ga0496117_0002130_19958_20980 319
86 3300048921 Ga0496118_0000145 Ga0496118_0000145_2365_3387 319
87 3300048924 Ga0496121_0034397 Ga0496121_0034397_2663_3685 319
88 3300048925 Ga0496122_0012051 Ga0496122_0012051_738_1760 319
89 3300048926 Ga0496123_0036030 Ga0496123_0036030_257_1279 319
90 3300048927 Ga0496124_0032446 Ga0496124_0032446_2510_3532 319
91 iso_pu_bacteria 2919513703 2919516349 319
92 iso_pu_bacteria 2919675420 2919676812 319
93 3300009177 Ga0105248_10383497 Ga0105248_103834972 321
94 3300035121 Ga0373960_0014119 Ga0373960_0014119_597_1574 322
95 3300049568 Ga0501031_0034121 Ga0501031_0034121_640_1653 322
96 3300050514 nmdc:mga08x19_71295_c1 nmdc:mga08x19_71295_c1_974_1951 322
97 3300006051 Ga0075364_10325110 Ga0075364_103251101 323
98 3300050491 nmdc:mga00v17_31706_c1 nmdc:mga00v17_31706_c1_1698_2669 323
99 3300050491 nmdc:mga00v17_39924_c1 nmdc:mga00v17_39924_c1_1817_2788 323
100 3300041486 Ga0451807_1026026 Ga0451807_1026026_56_1036 324
101 3300048920 Ga0496117_0077420 Ga0496117_0077420_127_1107 324
102 3300048921 Ga0496118_0000166 Ga0496118_0000166_108117_109097 324
103 3300048924 Ga0496121_0018930 Ga0496121_0018930_2820_3839 324
104 3300048924 Ga0496121_0112477 Ga0496121_0112477_667_1647 324
105 3300055283 Ga0500661_015331 Ga0500661_015331_197_1177 324
106 3300005336 Ga0070680_100022902 Ga0070680_1000229022 325
107 3300005336 Ga0070680_100159561 Ga0070680_1001595612 325
108 3300005367 Ga0070667_100000108 Ga0070667_10000010838 325
109 3300005455 Ga0070663_100000070 Ga0070663_10000007014 325
110 3300005455 Ga0070663_100077540 Ga0070663_1000775402 325
111 3300005458 Ga0070681_10043160 Ga0070681_100431602 325
112 3300005458 Ga0070681_10074311 Ga0070681_100743112 325
113 3300005530 Ga0070679_100076945 Ga0070679_1000769454 325
114 3300005530 Ga0070679_100147247 Ga0070679_1001472472 325
115 3300005539 Ga0068853_100002884 Ga0068853_1000028844 325
116 3300005546 Ga0070696_100036036 Ga0070696_1000360363 325
117 3300005614 Ga0068856_100009238 Ga0068856_1000092385 325
118 3300005842 Ga0068858_100235280 Ga0068858_1002352802 325
119 3300005843 Ga0068860_100130283 Ga0068860_1001302832 325
120 3300005844 Ga0068862_100153024 Ga0068862_1001530244 325
121 3300009093 Ga0105240_10005759 Ga0105240_1000575915 325
122 3300009177 Ga0105248_10002649 Ga0105248_1000264911 325
123 3300009545 Ga0105237_10001198 Ga0105237_100011982 325
124 3300009545 Ga0105237_10008213 Ga0105237_100082134 325
125 3300009553 Ga0105249_10000426 Ga0105249_1000042623 325
126 3300013102 Ga0157371_10021425 Ga0157371_100214252 325
127 3300013104 Ga0157370_10038859 Ga0157370_100388593 325
128 3300013104 Ga0157370_10291476 Ga0157370_102914762 325
129 3300013105 Ga0157369_10037066 Ga0157369_100370664 325
130 3300017792 Ga0163161_10013091 Ga0163161_100130914 325
131 3300025250 Ga0209026_1000158 Ga0209026_100015843 325
132 3300025256 Ga0209759_1005506 Ga0209759_10055063 325
133 3300025272 Ga0209455_1001416 Ga0209455_10014169 325
134 3300025912 Ga0207707_10181706 Ga0207707_101817061 325
135 3300025913 Ga0207695_10002149 Ga0207695_1000214922 325
136 3300025914 Ga0207671_10002319 Ga0207671_1000231912 325
137 3300025914 Ga0207671_10003475 Ga0207671_100034752 325
138 3300025917 Ga0207660_10059885 Ga0207660_100598854 325
139 3300025949 Ga0207667_10139931 Ga0207667_101399312 325
140 3300025961 Ga0207712_10000363 Ga0207712_1000036313 325
141 3300025986 Ga0207658_10000093 Ga0207658_1000009353 325
142 3300026035 Ga0207703_10334370 Ga0207703_103343701 325
143 3300026067 Ga0207678_10030184 Ga0207678_100301842 325
144 3300026078 Ga0207702_10000290 Ga0207702_1000029033 325
145 3300028380 Ga0268265_10037052 Ga0268265_100370525 325
146 3300028381 Ga0268264_10240386 Ga0268264_102403862 325
147 3300031911 Ga0307412_10000115 Ga0307412_1000011542 325
148 3300032004 Ga0307414_10003669 Ga0307414_100036694 325
149 3300037312 Ga0395899_0069674 Ga0395899_0069674_1322_2308 325
150 3300037418 Ga0395900_0001828 Ga0395900_0001828_21844_22827 325
151 3300047472 Ga0495686_0006280 Ga0495686_0006280_1311_2294 325
152 3300048919 Ga0496116_0000379 Ga0496116_0000379_36228_37247 325
153 3300048920 Ga0496117_0049132 Ga0496117_0049132_50_1069 325
154 3300048924 Ga0496121_0026218 Ga0496121_0026218_376_1395 325
155 3300048924 Ga0496121_0055823 Ga0496121_0055823_1165_2148 325
156 3300048925 Ga0496122_0001084 Ga0496122_0001084_12864_13847 325
157 3300048926 Ga0496123_0005462 Ga0496123_0005462_602_1585 325
158 3300048928 Ga0496125_0016061 Ga0496125_0016061_247_1266 325
159 3300049569 Ga0501032_0022563 Ga0501032_0022563_3294_4274 325
160 3300049569 Ga0501032_0031644 Ga0501032_0031644_247_1233 325
161 3300049569 Ga0501032_0182851 Ga0501032_0182851_289_1275 325
162 3300049570 Ga0501033_0148984 Ga0501033_0148984_461_1441 325
163 3300049571 Ga0501034_0013640 Ga0501034_0013640_7184_8164 325
164 3300049572 Ga0501036_0025497 Ga0501036_0025497_2523_3503 325
165 3300049573 Ga0501037_0006365 Ga0501037_0006365_1589_2569 325
166 3300049574 Ga0501038_0056930 Ga0501038_0056930_512_1492 325
167 3300049575 Ga0501039_0040530 Ga0501039_0040530_1098_2078 325
168 3300049579 Ga0501043_0028687 Ga0501043_0028687_1602_2582 325
169 3300049581 Ga0501047_0049579 Ga0501047_0049579_246_1226 325
170 3300049581 Ga0501047_0299157 Ga0501047_0299157_427_1404 325
171 3300049586 Ga0501070_0032812 Ga0501070_0032812_1937_2917 325
172 3300049586 Ga0501070_0065520 Ga0501070_0065520_974_1960 325
173 3300049589 Ga0501073_0020523 Ga0501073_0020523_21_1001 325
174 3300049822 Ga0501035_0029548 Ga0501035_0029548_2669_3649 325
175 3300049823 Ga0501044_0014154 Ga0501044_0014154_6330_7310 325
176 3300049823 Ga0501044_0015037 Ga0501044_0015037_3755_4732 325
177 3300053120 Ga0500597_000184 Ga0500597_000184_4439_5422 325
178 iso_pu_bacteria 2842780639 2842781008 325
179 iso_pu_bacteria 2891633521 2891634634 325
180 3300005441 Ga0070700_100003344 Ga0070700_1000033444 326
181 3300005459 Ga0068867_100060721 Ga0068867_1000607214 326
182 3300025935 Ga0207709_10028069 Ga0207709_100280693 326
183 3300026089 Ga0207648_10043250 Ga0207648_100432505 326
184 3300048917 Ga0496114_0002418 Ga0496114_0002418_5706_6686 326
185 3300049744 Ga0501083_0036594 Ga0501083_0036594_2285_3280 326
186 3300053093 Ga0500651_0110217 Ga0500651_0110217_479_1468 326
187 iso_pu_bacteria 2643221581 2643916330 326
188 iso_pu_bacteria 2923516293 2923518113 326
189 3300005435 Ga0070714_100235785 Ga0070714_1002357851 327
190 3300005564 Ga0070664_100325434 Ga0070664_1003254342 327
191 3300013297 Ga0157378_10252466 Ga0157378_102524662 327
192 3300025929 Ga0207664_10314264 Ga0207664_103142641 327
193 3300049822 Ga0501035_0002161 Ga0501035_0002161_17468_18466 327
194 3300049823 Ga0501044_0049041 Ga0501044_0049041_2133_3131 327
195 3300005289 Ga0065704_10074223 Ga0065704_100742233 328
196 3300005331 Ga0070670_100016146 Ga0070670_1000161462 328
197 3300005539 Ga0068853_100004551 Ga0068853_1000045515 328
198 3300006358 Ga0068871_100099970 Ga0068871_1000999703 328
199 3300009011 Ga0105251_10000261 Ga0105251_1000026147 328
200 3300010375 Ga0105239_10012655 Ga0105239_100126557 328
201 3300025735 Ga0207713_1000598 Ga0207713_100059828 328
202 3300025925 Ga0207650_10002277 Ga0207650_100022775 328
203 3300026041 Ga0207639_10001135 Ga0207639_100011353 328
204 3300026116 Ga0207674_10009737 Ga0207674_100097373 328
205 3300032004 Ga0307414_10010133 Ga0307414_100101333 328
206 3300041505 Ga0451849_0742676 Ga0451849_0742676_113_1123 328
207 3300046691 Ga0495670_0050511 Ga0495670_0050511_701_1747 328
208 3300048920 Ga0496117_0003468 Ga0496117_0003468_6162_7193 328
209 3300048921 Ga0496118_0077296 Ga0496118_0077296_113_1144 328
210 3300048922 Ga0496119_0000550 Ga0496119_0000550_6264_7295 328
211 3300048923 Ga0496120_0004047 Ga0496120_0004047_419_1450 328
212 3300048925 Ga0496122_0000158 Ga0496122_0000158_12412_13443 328
213 3300048926 Ga0496123_0000120 Ga0496123_0000120_145910_146941 328
214 3300049575 Ga0501039_0371412 Ga0501039_0371412_41_1030 328
215 3300049581 Ga0501047_0071060 Ga0501047_0071060_1890_2879 328
216 3300049586 Ga0501070_0091295 Ga0501070_0091295_768_1757 328
217 3300049822 Ga0501035_0198994 Ga0501035_0198994_127_1116 328
218 iso_pu_bacteria 2894414249 2894416234 328
219 3300003794 Ga0055531_10027113 Ga0055531_100271132 329
220 3300009092 Ga0105250_10000006 Ga0105250_10000006243 329
221 3300014968 Ga0157379_10000087 Ga0157379_1000008715 329
222 3300025304 Ga0209257_1000122 Ga0209257_1000122183 329
223 3300025711 Ga0207696_1000333 Ga0207696_10003337 329
224 3300046501 Ga0495607_0005959 Ga0495607_0005959_3487_4500 329
225 3300046507 Ga0495606_0008762 Ga0495606_0008762_169_1182 329
226 3300046615 Ga0495656_0002051 Ga0495656_0002051_900_1940 329
227 3300047318 Ga0495636_0003114 Ga0495636_0003114_4709_5749 329
228 3300047470 Ga0495681_0094090 Ga0495681_0094090_249_1262 329
229 3300048925 Ga0496122_0035673 Ga0496122_0035673_2187_3206 329
230 3300048926 Ga0496123_0018827 Ga0496123_0018827_738_1757 329
231 3300048927 Ga0496124_0000009 Ga0496124_0000009_252370_253383 329
232 iso_pu_bacteria 2643221573 2643878779 329
233 iso_pu_bacteria 2643221720 2644660096 329
234 iso_pu_bacteria 2643221728 2644697396 329
235 3300003794 Ga0055531_10012348 Ga0055531_100123484 330
236 3300005289 Ga0065704_10071998 Ga0065704_100719982 330
237 3300025304 Ga0209257_1001644 Ga0209257_100164422 330
238 3300028379 Ga0268266_10305283 Ga0268266_103052832 330
239 3300031456 Ga0307513_10004763 Ga0307513_100047635 330
240 3300032004 Ga0307414_10104409 Ga0307414_101044092 330
241 3300037466 Ga0395898_0334377 Ga0395898_0334377_53_1066 330
242 3300041404 Ga0439436_0004573 Ga0439436_0004573_2636_3658 330
243 3300041413 Ga0439465_0002863 Ga0439465_0002863_4452_5474 330
244 3300041413 Ga0439465_0025392 Ga0439465_0025392_613_1635 330
245 3300046525 Ga0495663_0001531 Ga0495663_0001531_5801_6823 330
246 3300046692 Ga0495671_0004376 Ga0495671_0004376_4173_5195 330
247 3300048912 Ga0496109_0025862 Ga0496109_0025862_613_1626 330
248 3300049571 Ga0501034_0000431 Ga0501034_0000431_11501_12508 330
249 3300050509 nmdc:mga0qj67_36311_c1 nmdc:mga0qj67_36311_c1_1666_2676 330
250 iso_pu_bacteria 2643221579 2643908490 330
251 iso_pu_bacteria 8002869464 8002871993 330
252 iso_pu_bacteria 8003014200 8003016052 330
253 3300037312 Ga0395899_0005871 Ga0395899_0005871_7511_8527 331
254 3300037471 Ga0395905_0001042 Ga0395905_0001042_33980_34996 331
255 3300037471 Ga0395905_0275723 Ga0395905_0275723_427_1437 331
256 3300038443 Ga0395901_0061175 Ga0395901_0061175_2362_3378 331
257 iso_pu_bacteria 2571042365 2572255185 331
258 iso_pu_bacteria 2643221695 2644530043 331
259 3300031903 Ga0307407_10040456 Ga0307407_100404562 332
260 3300032004 Ga0307414_10009845 Ga0307414_100098452 332
261 3300032004 Ga0307414_10163979 Ga0307414_101639792 332
262 3300032004 Ga0307414_10172519 Ga0307414_101725191 332
263 3300038705 Ga0237819_00245 Ga0237819_00245_2613_3632 332
264 3300048904 Ga0496101_0164445 Ga0496101_0164445_200_1219 332
265 3300049571 Ga0501034_0000415 Ga0501034_0000415_39722_40726 332
266 3300049686 Ga0501257_026183 Ga0501257_026183_222_1229 332
267 3300049767 Ga0501270_001588 Ga0501270_001588_481_1488 332
268 3300006051 Ga0075364_10000141 Ga0075364_1000014116 333
269 3300025923 Ga0207681_10405023 Ga0207681_104050232 333
270 3300027614 Ga0209970_1004953 Ga0209970_10049532 333
271 3300027665 Ga0209983_1004093 Ga0209983_10040932 333
272 3300027682 Ga0209971_1001280 Ga0209971_10012802 333
273 3300032004 Ga0307414_10130437 Ga0307414_101304372 333
274 3300050491 nmdc:mga00v17_88_c1 nmdc:mga00v17_88_c1_42049_43056 333
275 iso_pu_bacteria 2818991457 2819659861 333
276 iso_pu_bacteria 2852684882 2852685313 333
277 iso_pu_bacteria 2919130084 2919131430 333
278 iso_pu_bacteria 2929195423 2929198148 333
279 iso_pu_bacteria 8021622325 8021624754 333
280 iso_pu_bacteria 8021626552 8021629968 333
281 iso_pu_bacteria 8021648035 8021651359 333
282 3300003187 JGI25151J46595_10005659 JGI25151J46595_100056594 334
283 3300003775 Ga0055524_1007691 Ga0055524_10076914 334
284 3300003781 Ga0055536_1004054 Ga0055536_10040544 334
285 3300003781 Ga0055536_1006528 Ga0055536_10065282 334
286 3300003781 Ga0055536_1009373 Ga0055536_10093731 334
287 3300003791 Ga0055530_10002531 Ga0055530_1000253112 334
288 3300003794 Ga0055531_10006364 Ga0055531_100063645 334
289 3300003794 Ga0055531_10008743 Ga0055531_100087434 334
290 3300003794 Ga0055531_10008871 Ga0055531_100088714 334
291 3300005336 Ga0070680_100155692 Ga0070680_1001556921 334
292 3300005339 Ga0070660_100011869 Ga0070660_1000118694 334
293 3300013102 Ga0157371_10125848 Ga0157371_101258482 334
294 3300013307 Ga0157372_10037434 Ga0157372_100374342 334
295 3300025273 Ga0209673_1001811 Ga0209673_100181113 334
296 3300025284 Ga0209130_1003727 Ga0209130_10037278 334
297 3300025291 Ga0209675_1009024 Ga0209675_10090243 334
298 3300025292 Ga0209676_1000024 Ga0209676_100002491 334
299 3300025292 Ga0209676_1001617 Ga0209676_100161720 334
300 3300025292 Ga0209676_1002237 Ga0209676_100223711 334
301 3300025292 Ga0209676_1002587 Ga0209676_100258712 334
302 3300025292 Ga0209676_1003153 Ga0209676_10031532 334
303 3300025292 Ga0209676_1010370 Ga0209676_10103702 334
304 3300025292 Ga0209676_1013373 Ga0209676_10133732 334
305 3300025294 Ga0209025_1001739 Ga0209025_10017399 334
306 3300025294 Ga0209025_1029027 Ga0209025_10290272 334
307 3300025294 Ga0209025_1029972 Ga0209025_10299723 334
308 3300025294 Ga0209025_1041550 Ga0209025_10415502 334
309 3300025295 Ga0209564_1007773 Ga0209564_10077734 334
310 3300025297 Ga0209758_1020298 Ga0209758_10202982 334
311 3300025297 Ga0209758_1035302 Ga0209758_10353022 334
312 3300025298 Ga0209050_1002075 Ga0209050_10020757 334
313 3300025298 Ga0209050_1009393 Ga0209050_10093933 334
314 3300025299 Ga0209256_1000890 Ga0209256_100089036 334
315 3300025299 Ga0209256_1000896 Ga0209256_100089611 334
316 3300025299 Ga0209256_1002854 Ga0209256_100285414 334
317 3300025303 Ga0209051_1011731 Ga0209051_10117312 334
318 3300025304 Ga0209257_1000080 Ga0209257_1000080158 334
319 3300025304 Ga0209257_1002094 Ga0209257_100209426 334
320 3300025304 Ga0209257_1002725 Ga0209257_100272517 334
321 3300025304 Ga0209257_1003816 Ga0209257_10038163 334
322 3300025304 Ga0209257_1012717 Ga0209257_10127173 334
323 3300025919 Ga0207657_10005785 Ga0207657_100057859 334
324 3300025933 Ga0207706_10135253 Ga0207706_101352532 334
325 3300041404 Ga0439436_0031546 Ga0439436_0031546_330_1346 334
326 3300041413 Ga0439465_0000027 Ga0439465_0000027_27114_28121 334
327 3300042007 Ga0439449_0000093 Ga0439449_0000093_7028_8035 334
328 3300042007 Ga0439449_0027914 Ga0439449_0027914_699_1742 334
329 3300042010 Ga0439452_008963 Ga0439452_008963_1840_2883 334
330 3300049579 Ga0501043_0013024 Ga0501043_0013024_238_1398 334
331 iso_pu_bacteria 2547132130 2547500927 334
332 iso_pu_bacteria 2747842428 2747948784 334
333 iso_pu_bacteria 2765235840 2765578483 334
334 iso_pu_bacteria 2816332141 2816516501 334
335 iso_pu_bacteria 2842391507 2842392783 334
336 iso_pu_bacteria 2842757796 2842758573 334
337 iso_pu_bacteria 2874220319 2874221110 334
338 iso_pu_bacteria 2895498888 2895504020 334
339 iso_pu_bacteria 2895511927 2895515368 334
340 iso_pu_bacteria 2895522137 2895525115 334
341 iso_pu_bacteria 2895525241 2895527852 334
342 iso_pu_bacteria 2919089067 2919091320 334
343 iso_pu_bacteria 2919134579 2919136341 334
344 iso_pu_bacteria 2928496128 2928497952 334
345 iso_pu_bacteria 2931380184 2931381245 334
346 iso_pu_bacteria 2937610967 2937611932 334
347 iso_pu_bacteria 2939626828 2939629663 334
348 iso_pu_bacteria 2961047084 2961047875 334
349 iso_pu_bacteria 2961064222 2961067213 334
350 3300031548 Ga0307408_100351360 Ga0307408_1003513602 335
351 3300031731 Ga0307405_10119429 Ga0307405_101194292 335
352 3300031852 Ga0307410_10276870 Ga0307410_102768701 335
353 3300032005 Ga0307411_10096481 Ga0307411_100964812 335
354 3300041404 Ga0439436_0039942 Ga0439436_0039942_128_1138 335
355 3300042006 Ga0439432_003034 Ga0439432_003034_3409_4419 335
356 3300042006 Ga0439432_017675 Ga0439432_017675_175_1185 335
357 3300042007 Ga0439449_0034219 Ga0439449_0034219_501_1511 335
358 3300042007 Ga0439449_0040916 Ga0439449_0040916_391_1401 335
359 3300042876 Ga0451577_0018280 Ga0451577_0018280_3929_4963 335
360 3300049663 Ga0501223_008954 Ga0501223_008954_214_1224 335
361 iso_pu_bacteria 2576861471 2578458890 335
362 iso_pu_bacteria 2747842501 2748016169 335
363 iso_pu_bacteria 2852649853 2852651241 335
364 iso_pu_bacteria 2857442823 2857446366 335
365 iso_pu_bacteria 2939589442 2939590600 335
366 iso_pu_bacteria 2939622612 2939622768 335
367 iso_pu_bacteria 2941475908 2941477817 335
368 iso_pu_bacteria 2941489479 2941494223 335
369 iso_pu_bacteria 2974307012 2974309352 335
370 iso_pu_bacteria 2977247770 2977250073 335
371 iso_pu_bacteria 2984514374 2984515437 335
372 iso_pu_bacteria 2987605356 2987607338 335
373 iso_pu_bacteria 2995948881 2995951203 335
374 3300048927 Ga0496124_0000700 Ga0496124_0000700_12362_13393 336
375 3300003771 Ga0055526_1000024 Ga0055526_1000024119 337
376 3300003773 Ga0055537_1000051 Ga0055537_100005156 337
377 3300003775 Ga0055524_1000142 Ga0055524_100014256 337
378 3300003784 Ga0055534_1000058 Ga0055534_100005856 337
379 3300003790 Ga0055528_1000016 Ga0055528_1000016119 337
380 3300003856 Ga0058692_1000006 Ga0058692_1000006168 337
381 3300005288 Ga0065714_10132794 Ga0065714_101327941 337
382 3300005338 Ga0068868_100325654 Ga0068868_1003256541 337
383 3300005353 Ga0070669_100069083 Ga0070669_1000690832 337
384 3300005354 Ga0070675_100194584 Ga0070675_1001945842 337
385 3300005355 Ga0070671_100116826 Ga0070671_1001168262 337
386 3300005459 Ga0068867_100086219 Ga0068867_1000862192 337
387 3300005543 Ga0070672_100019135 Ga0070672_1000191354 337
388 3300014326 Ga0157380_10193384 Ga0157380_101933842 337
389 3300015265 Ga0182005_1003003 Ga0182005_10030032 337
390 3300015689 Ga0183360_10001 Ga0183360_100012006 337
391 3300025263 Ga0209565_1000001 Ga0209565_10000011814 337
392 3300025273 Ga0209673_1000001 Ga0209673_10000011814 337
393 3300025291 Ga0209675_1000001 Ga0209675_1000001718 337
394 3300025295 Ga0209564_1000001 Ga0209564_1000001880 337
395 3300025299 Ga0209256_1000002 Ga0209256_1000002672 337
396 3300025926 Ga0207659_10129103 Ga0207659_101291032 337
397 3300025940 Ga0207691_10001092 Ga0207691_1000109222 337
398 3300026089 Ga0207648_10067367 Ga0207648_100673673 337
399 3300027312 Ga0209371_1000016 Ga0209371_1000016167 337
400 3300030500 Ga0268256_1000015 Ga0268256_1000015403 337
401 3300041407 Ga0439447_005127 Ga0439447_005127_1434_2471 337
402 3300046522 Ga0495643_0002561 Ga0495643_0002561_10836_11861 337
403 3300046537 Ga0495598_0000769 Ga0495598_0000769_3749_4765 337
404 3300046616 Ga0495668_0001007 Ga0495668_0001007_11476_12513 337
405 3300046660 Ga0495625_0083212 Ga0495625_0083212_178_1203 337
406 3300046660 Ga0495625_0105148 Ga0495625_0105148_653_1678 337
407 3300047320 Ga0495672_0000134 Ga0495672_0000134_77875_78900 337
408 3300047472 Ga0495686_0022413 Ga0495686_0022413_739_1764 337
409 3300048921 Ga0496118_0085457 Ga0496118_0085457_979_2013 337
410 3300048924 Ga0496121_0007855 Ga0496121_0007855_53_1090 337
411 iso_pu_bacteria 2643221593 2643974146 337
412 3300003187 JGI25151J46595_10000080 JGI25151J46595_1000008043 338
413 3300003320 rootH2_10014268 rootH2_1001426811 338
414 3300003323 rootH1_10127287 rootH1_101272873 338
415 3300003856 Ga0058692_1000002 Ga0058692_1000002223 338
416 3300009148 Ga0105243_10003831 Ga0105243_100038316 338
417 3300013100 Ga0157373_10145519 Ga0157373_101455192 338
418 3300013105 Ga0157369_10199750 Ga0157369_101997502 338
419 3300025292 Ga0209676_1000047 Ga0209676_1000047199 338
420 3300025294 Ga0209025_1000015 Ga0209025_1000015441 338
421 3300025297 Ga0209758_1006183 Ga0209758_10061835 338
422 3300025298 Ga0209050_1009397 Ga0209050_10093975 338
423 3300025935 Ga0207709_10000767 Ga0207709_1000076714 338
424 3300027312 Ga0209371_1000004 Ga0209371_1000004431 338
425 3300030500 Ga0268256_1000005 Ga0268256_1000005615 338
426 3300030731 Ga0316177_1042085 Ga0316177_10420852 338
427 3300030732 Ga0316176_1019534 Ga0316176_10195342 338
428 3300030733 Ga0314311_1184420 Ga0314311_11844204 338
429 3300031824 Ga0307413_10002372 Ga0307413_100023728 338
430 3300031901 Ga0307406_10022304 Ga0307406_100223043 338
431 3300042533 Ga0450901_002690 Ga0450901_002690_843_1862 338
432 3300046525 Ga0495663_0011852 Ga0495663_0011852_1163_2182 338
433 3300048922 Ga0496119_0019937 Ga0496119_0019937_2753_3772 338
434 3300048925 Ga0496122_0103483 Ga0496122_0103483_442_1461 338
435 3300049570 Ga0501033_0001325 Ga0501033_0001325_1966_2985 338
436 iso_pu_bacteria 2643221559 2643817576 338
437 iso_pu_bacteria 2643221586 2643940230 338
438 iso_pu_bacteria 2643221612 2644079358 338
439 iso_pu_bacteria 2643221727 2644694802 338
440 3300002773 JGI25152J39213_1000035 JGI25152J39213_100003573 339
441 3300002774 JGI25150J39212_1000236 JGI25150J39212_100023616 339
442 3300003187 JGI25151J46595_10000057 JGI25151J46595_1000005771 339
443 3300003215 JGI25153J46596_10000041 JGI25153J46596_1000004178 339
444 3300003771 Ga0055526_1000405 Ga0055526_100040520 339
445 3300003773 Ga0055537_1000500 Ga0055537_100050016 339
446 3300003781 Ga0055536_1005362 Ga0055536_10053623 339
447 3300003781 Ga0055536_1005471 Ga0055536_10054714 339
448 3300003784 Ga0055534_1000155 Ga0055534_100015523 339
449 3300003790 Ga0055528_1000093 Ga0055528_100009374 339
450 3300003791 Ga0055530_10003554 Ga0055530_100035544 339
451 3300003791 Ga0055530_10003555 Ga0055530_100035556 339
452 3300003794 Ga0055531_10006830 Ga0055531_100068304 339
453 3300003794 Ga0055531_10010246 Ga0055531_100102463 339
454 3300003794 Ga0055531_10010598 Ga0055531_100105983 339
455 3300006178 Ga0075367_10064513 Ga0075367_100645132 339
456 3300009036 Ga0105244_10115220 Ga0105244_101152202 339
457 3300013102 Ga0157371_10000314 Ga0157371_1000031428 339
458 3300013102 Ga0157371_10181806 Ga0157371_101818062 339
459 3300014497 Ga0182008_10024516 Ga0182008_100245163 339
460 3300015261 Ga0182006_1012761 Ga0182006_10127612 339
461 3300015262 Ga0182007_10000111 Ga0182007_1000011125 339
462 3300015265 Ga0182005_1000255 Ga0182005_100025534 339
463 3300017792 Ga0163161_10036670 Ga0163161_100366702 339
464 3300025245 Ga0207425_1000044 Ga0207425_1000044109 339
465 3300025258 Ga0209129_1000044 Ga0209129_1000044167 339
466 3300025263 Ga0209565_1000014 Ga0209565_1000014259 339
467 3300025273 Ga0209673_1000570 Ga0209673_100057046 339
468 3300025291 Ga0209675_1000021 Ga0209675_1000021229 339
469 3300025292 Ga0209676_1000079 Ga0209676_100007997 339
470 3300025292 Ga0209676_1004292 Ga0209676_10042925 339
471 3300025294 Ga0209025_1000012 Ga0209025_1000012333 339
472 3300025295 Ga0209564_1000990 Ga0209564_100099032 339
473 3300025297 Ga0209758_1000018 Ga0209758_1000018324 339
474 3300025298 Ga0209050_1000153 Ga0209050_100015370 339
475 3300025298 Ga0209050_1000311 Ga0209050_100031131 339
476 3300025299 Ga0209256_1001492 Ga0209256_10014923 339
477 3300025303 Ga0209051_1000458 Ga0209051_100045814 339
478 3300025304 Ga0209257_1000081 Ga0209257_1000081107 339
479 3300025304 Ga0209257_1001214 Ga0209257_100121432 339
480 3300025304 Ga0209257_1001670 Ga0209257_100167017 339
481 3300025917 Ga0207660_10409297 Ga0207660_104092971 339
482 3300030742 Ga0316183_1123718 Ga0316183_11237183 339
483 3300046453 Ga0495627_033463 Ga0495627_033463_132_1154 339
484 3300046512 Ga0495610_0009775 Ga0495610_0009775_3546_4568 339
485 3300046518 Ga0495631_0001216 Ga0495631_0001216_270_1292 339
486 3300046519 Ga0495632_0053195 Ga0495632_0053195_392_1417 339
487 3300046525 Ga0495663_0002073 Ga0495663_0002073_834_1859 339
488 3300046558 Ga0495633_0020789 Ga0495633_0020789_31_1056 339
489 3300047320 Ga0495672_0062459 Ga0495672_0062459_920_1942 339
490 3300047472 Ga0495686_0010513 Ga0495686_0010513_3276_4298 339
491 3300048919 Ga0496116_0004882 Ga0496116_0004882_8764_9786 339
492 3300048919 Ga0496116_0048604 Ga0496116_0048604_281_1303 339
493 3300048920 Ga0496117_0004169 Ga0496117_0004169_7372_8394 339
494 3300048920 Ga0496117_0024962 Ga0496117_0024962_2447_3469 339
495 3300048920 Ga0496117_0027916 Ga0496117_0027916_908_1930 339
496 3300048921 Ga0496118_0000573 Ga0496118_0000573_26169_27191 339
497 3300048921 Ga0496118_0027038 Ga0496118_0027038_2570_3592 339
498 3300048921 Ga0496118_0039516 Ga0496118_0039516_2593_3615 339
499 3300048922 Ga0496119_0000211 Ga0496119_0000211_48842_49864 339
500 3300048923 Ga0496120_0000432 Ga0496120_0000432_17297_18319 339
501 3300048924 Ga0496121_0163728 Ga0496121_0163728_73_1095 339
502 3300048925 Ga0496122_0006292 Ga0496122_0006292_5546_6568 339
503 3300048925 Ga0496122_0042863 Ga0496122_0042863_206_1228 339
504 3300048925 Ga0496122_0044515 Ga0496122_0044515_1863_2885 339
505 3300048925 Ga0496122_0047560 Ga0496122_0047560_2092_3114 339
506 3300048926 Ga0496123_0004739 Ga0496123_0004739_7476_8498 339
507 3300048926 Ga0496123_0020303 Ga0496123_0020303_646_1668 339
508 3300048926 Ga0496123_0029301 Ga0496123_0029301_926_1948 339
509 3300048926 Ga0496123_0037707 Ga0496123_0037707_83_1105 339
510 3300048927 Ga0496124_0000255 Ga0496124_0000255_28869_29891 339
511 3300048927 Ga0496124_0010152 Ga0496124_0010152_2355_3377 339
512 3300048927 Ga0496124_0011563 Ga0496124_0011563_4936_5958 339
513 3300048927 Ga0496124_0012194 Ga0496124_0012194_4899_5921 339
514 3300048927 Ga0496124_0020070 Ga0496124_0020070_2790_3812 339
515 3300048927 Ga0496124_0117953 Ga0496124_0117953_245_1267 339
516 3300048927 Ga0496124_0143116 Ga0496124_0143116_770_1792 339
517 3300048927 Ga0496124_0227914 Ga0496124_0227914_281_1303 339
518 3300048927 Ga0496124_0327243 Ga0496124_0327243_43_1065 339
519 3300048928 Ga0496125_0001909 Ga0496125_0001909_24622_25644 339
520 3300048928 Ga0496125_0013398 Ga0496125_0013398_5657_6679 339
521 3300048928 Ga0496125_0019874 Ga0496125_0019874_1110_2132 339
522 3300048928 Ga0496125_0044544 Ga0496125_0044544_672_1697 339
523 3300048928 Ga0496125_0086287 Ga0496125_0086287_1108_2130 339
524 3300048929 Ga0496126_0000806 Ga0496126_0000806_21077_22099 339
525 3300050491 nmdc:mga00v17_152487_c1 nmdc:mga00v17_152487_c1_82_1104 339
526 3300053161 Ga0500634_0000036 Ga0500634_0000036_7713_8738 339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02606

LpxK

Tetraacyldisaccharide-1-P 4'-kinase

60

369

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.8316 23 333
8elf-assembly1.cif.gz_A structure of get3d, a homolog of get3, from arabidopsis thaliana 0.827 52 89
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.8103 23 333
5a5g-assembly1.cif.gz_A crystal structure of fthfs2 from t.acetoxydans re1 0.7503 52 93
5a5g-assembly1.cif.gz_B crystal structure of fthfs2 from t.acetoxydans re1 0.749 52 93
ID Description Score Start End Superfamily
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.935 23 333 3.40.50.300
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9233 23 333 3.40.50.300
af_I1KYA1_28_391_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.843 21 333 3.40.50.300
af_A0A0P0X1P5_1_135_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8211 86 211 3.40.50.300
af_A0A1D6KF80_27_384_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7953 27 322 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4V5ZQK2-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9878 1 333 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A2A3LK26-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9829 7 336 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A356JHA0-F1-model_v4 deleted 0.9815 1 304
AF-B4SQP9-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.98 1 337 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A2P1PPD5-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9753 10 338 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245

Feature Viewer

pLDDT pTM Quality
89.42 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map