F459429
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 526 | 267 | 509 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_10208303|Ga0307406_102083032 |
| Length | 300 |
| Sequence | MRIIFMGSPEFAVPTLDALVAAGHEVVAAYTQPPRPAGRGKAERPTAVEVRARALGIEVRCPRSLKGAEEQAAFAALGADVAVVAAYGLILPQAVLDAPAHGCLNVHASLLPRWRGAAPVQRAIMAGDQVTGVTIMAMEAGLDTGPMVARREVPIGDKNAAQVTAELAEVGAALTVETLASGVFDGEPQPDAGATYAAKISKAEARIDWTRSAAEVVRQVQGLAPFPGAWLEVADERIKLLAAEAVDASAAAGAVIDDRLTIACGEQAIRPSLLQRAGHKALPLDEFLRGFAIPAGTLLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 4 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 5 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 6 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 7 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 8 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 9 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 10 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 11 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 12 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 13 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 14 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 15 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 16 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 17 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 18 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 19 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 20 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 21 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 22 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 25 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 26 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 27 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 28 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 94 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 145 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 148 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 149 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 150 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 151 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 152 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 160 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 161 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 162 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 163 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 164 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 168 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 169 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 170 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 171 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 174 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 175 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 176 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 179 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 180 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 207 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 211 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 212 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 213 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 214 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 215 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 216 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 217 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 218 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 219 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 220 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 221 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 222 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 223 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 224 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 225 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 231 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 232 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 233 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 234 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 237 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 238 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 239 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 240 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 241 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 242 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 243 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 244 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 245 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 246 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 250 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 251 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 252 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 253 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 254 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 255 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 256 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 257 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 258 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 259 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 260 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 261 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 262 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 263 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 264 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 265 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 266 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 267 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.77 |
| Metatranscriptomes | 0 |
| Isolates | 3.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.56 |
| Nodule | 0 |
| Rhizoplane | 1.9 |
| Rhizosphere | 80.99 |
| Stem | 0 |
| Stem Tuber | 0.19 |
| Unclassified | 8.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_261670 | 2162886007 | Bacteria | 4460 |
| 2 | JGI24736J21556_1001780 | 3300001904 | Bacteria | 3879 |
| 3 | JGI24741J21665_1001479 | 3300001915 | Bacteria | 6703 |
| 4 | JGI24740J21852_10006372 | 3300001979 | Bacteria | 4894 |
| 5 | JGI24740J21852_10031551 | 3300001979 | Bacteria | 1707 |
| 6 | JGI24739J22299_10002342 | 3300001989 | Bacteria | 7300 |
| 7 | JGI24739J22299_10009438 | 3300001989 | Bacteria | 3635 |
| 8 | JGI24739J22299_10009524 | 3300001989 | Bacteria | 3618 |
| 9 | JGI24739J22299_10016224 | 3300001989 | Bacteria | 2697 |
| 10 | JGI24737J22298_10010222 | 3300001990 | Bacteria | 3102 |
| 11 | JGI24737J22298_10032405 | 3300001990 | Bacteria | 1627 |
| 12 | JGI24735J21928_10002006 | 3300002067 | Bacteria | 7156 |
| 13 | JGI24735J21928_10003706 | 3300002067 | Bacteria | 5183 |
| 14 | JGI24735J21928_10003754 | 3300002067 | Bacteria | 5151 |
| 15 | JGI24735J21928_10005739 | 3300002067 | Bacteria | 4104 |
| 16 | JGI24735J21928_10006435 | 3300002067 | Bacteria | 3865 |
| 17 | JGI24735J21928_10008583 | 3300002067 | Bacteria | 3299 |
| 18 | JGI24735J21928_10022219 | 3300002067 | Bacteria | 1933 |
| 19 | JGI24735J21928_10050663 | 3300002067 | Bacteria | 1199 |
| 20 | JGI24738J21930_10001216 | 3300002075 | Bacteria | 7228 |
| 21 | JGI24738J21930_10001900 | 3300002075 | Bacteria | 5644 |
| 22 | JGI24738J21930_10004560 | 3300002075 | Bacteria | 3383 |
| 23 | JGI24744J21845_10000581 | 3300002077 | Bacteria | 6562 |
| 24 | JGI25165J46597_1000216 | 3300003214 | Bacteria | 81261 |
| 25 | Ga0055542_1009686 | 3300003762 | Bacteria | 1803 |
| 26 | Ga0065704_10009711 | 3300005289 | Bacteria | 3283 |
| 27 | Ga0065715_10007256 | 3300005293 | Bacteria | 2697 |
| 28 | Ga0065715_10177317 | 3300005293 | Bacteria | 1501 |
| 29 | Ga0070658_10000225 | 3300005327 | Bacteria | 50444 |
| 30 | Ga0070658_10003675 | 3300005327 | Bacteria | 12560 |
| 31 | Ga0070658_10010960 | 3300005327 | Bacteria | 7266 |
| 32 | Ga0070658_10087868 | 3300005327 | Bacteria | 2559 |
| 33 | Ga0070658_10099154 | 3300005327 | Bacteria | 2407 |
| 34 | Ga0070676_10003004 | 3300005328 | Bacteria | 8723 |
| 35 | Ga0070676_10003595 | 3300005328 | Bacteria | 8103 |
| 36 | Ga0070670_100004123 | 3300005331 | Bacteria | 12146 |
| 37 | Ga0070670_100010504 | 3300005331 | Bacteria | 7903 |
| 38 | Ga0070677_10020285 | 3300005333 | Bacteria | 2419 |
| 39 | Ga0068869_100031385 | 3300005334 | Bacteria | 3737 |
| 40 | Ga0068869_100295187 | 3300005334 | Bacteria | 1307 |
| 41 | Ga0070666_10008340 | 3300005335 | Bacteria | 6427 |
| 42 | Ga0070660_100000480 | 3300005339 | Bacteria | 26717 |
| 43 | Ga0070660_100003063 | 3300005339 | Bacteria | 11487 |
| 44 | Ga0070660_100007497 | 3300005339 | Bacteria | 7606 |
| 45 | Ga0070660_100090434 | 3300005339 | Bacteria | 2413 |
| 46 | Ga0070660_100319444 | 3300005339 | Bacteria | 1275 |
| 47 | Ga0070661_100026948 | 3300005344 | Bacteria | 4137 |
| 48 | Ga0070661_100095028 | 3300005344 | Bacteria | 2210 |
| 49 | Ga0070661_100107355 | 3300005344 | Bacteria | 2082 |
| 50 | Ga0070661_100142822 | 3300005344 | Bacteria | 1805 |
| 51 | Ga0070692_10001570 | 3300005345 | Bacteria | 8386 |
| 52 | Ga0070668_100000099 | 3300005347 | Bacteria | 52778 |
| 53 | Ga0070668_100232046 | 3300005347 | Bacteria | 1526 |
| 54 | Ga0070669_100001566 | 3300005353 | Bacteria | 16566 |
| 55 | Ga0070669_100005241 | 3300005353 | Bacteria | 9364 |
| 56 | Ga0070669_100075689 | 3300005353 | Bacteria | 2497 |
| 57 | Ga0070669_100112579 | 3300005353 | Bacteria | 2067 |
| 58 | Ga0070669_100118421 | 3300005353 | Bacteria | 2017 |
| 59 | Ga0070675_100070745 | 3300005354 | Bacteria | 2892 |
| 60 | Ga0070671_100008949 | 3300005355 | Bacteria | 8034 |
| 61 | Ga0070671_100039990 | 3300005355 | Bacteria | 3893 |
| 62 | Ga0070674_100108335 | 3300005356 | Bacteria | 2036 |
| 63 | Ga0070673_100000003 | 3300005364 | Bacteria | 216759 |
| 64 | Ga0070659_100000001 | 3300005366 | Bacteria | 576390 |
| 65 | Ga0070659_100093509 | 3300005366 | Bacteria | 2413 |
| 66 | Ga0070659_100114515 | 3300005366 | Bacteria | 2179 |
| 67 | Ga0070659_100247101 | 3300005366 | Bacteria | 1478 |
| 68 | Ga0070659_100456107 | 3300005366 | Bacteria | 1085 |
| 69 | Ga0070667_100000038 | 3300005367 | Bacteria | 171914 |
| 70 | Ga0070667_100244711 | 3300005367 | Bacteria | 1602 |
| 71 | Ga0070663_100001752 | 3300005455 | Bacteria | 12072 |
| 72 | Ga0070663_100077079 | 3300005455 | Bacteria | 2439 |
| 73 | Ga0070663_100080923 | 3300005455 | Bacteria | 2386 |
| 74 | Ga0070663_100082667 | 3300005455 | Bacteria | 2363 |
| 75 | Ga0070678_100002547 | 3300005456 | Bacteria | 10000 |
| 76 | Ga0070678_100010112 | 3300005456 | Bacteria | 5745 |
| 77 | Ga0070662_100040636 | 3300005457 | Bacteria | 3313 |
| 78 | Ga0068867_100000001 | 3300005459 | Bacteria | 427563 |
| 79 | Ga0068853_100000230 | 3300005539 | Bacteria | 39593 |
| 80 | Ga0068853_100081996 | 3300005539 | Bacteria | 2825 |
| 81 | Ga0068853_100097855 | 3300005539 | Bacteria | 2591 |
| 82 | Ga0068853_100268703 | 3300005539 | Bacteria | 1570 |
| 83 | Ga0070672_100045704 | 3300005543 | Bacteria | 3389 |
| 84 | Ga0070665_100000075 | 3300005548 | Bacteria | 189496 |
| 85 | Ga0070665_100006857 | 3300005548 | Bacteria | 11581 |
| 86 | Ga0070665_100015442 | 3300005548 | Bacteria | 7670 |
| 87 | Ga0070665_100094479 | 3300005548 | Bacteria | 2995 |
| 88 | Ga0068855_100000253 | 3300005563 | Bacteria | 67247 |
| 89 | Ga0068855_100190786 | 3300005563 | Bacteria | 2312 |
| 90 | Ga0070664_100218089 | 3300005564 | Bacteria | 1706 |
| 91 | Ga0070664_100443421 | 3300005564 | Bacteria | 1191 |
| 92 | Ga0068857_100048655 | 3300005577 | Bacteria | 3763 |
| 93 | Ga0068854_100002258 | 3300005578 | Bacteria | 11855 |
| 94 | Ga0068854_100022168 | 3300005578 | Bacteria | 4322 |
| 95 | Ga0068854_100100971 | 3300005578 | Bacteria | 2163 |
| 96 | Ga0068856_100018056 | 3300005614 | Bacteria | 6840 |
| 97 | Ga0068856_100028579 | 3300005614 | Bacteria | 5445 |
| 98 | Ga0068856_100509549 | 3300005614 | Bacteria | 1224 |
| 99 | Ga0068856_100536279 | 3300005614 | Bacteria | 1191 |
| 100 | Ga0068852_100218489 | 3300005616 | Bacteria | 1811 |
| 101 | Ga0068852_100288924 | 3300005616 | Bacteria | 1583 |
| 102 | Ga0068852_100441988 | 3300005616 | Bacteria | 1286 |
| 103 | Ga0068852_100605073 | 3300005616 | Bacteria | 1100 |
| 104 | Ga0068859_100011965 | 3300005617 | Bacteria | 8715 |
| 105 | Ga0068859_100228656 | 3300005617 | Bacteria | 1948 |
| 106 | Ga0068851_10011589 | 3300005834 | Bacteria | 4137 |
| 107 | Ga0068870_10234958 | 3300005840 | Bacteria | 1129 |
| 108 | Ga0068863_100000255 | 3300005841 | Bacteria | 55911 |
| 109 | Ga0068860_100049956 | 3300005843 | Bacteria | 3983 |
| 110 | Ga0068862_100132541 | 3300005844 | Bacteria | 2205 |
| 111 | Ga0068862_100690384 | 3300005844 | Bacteria | 988 |
| 112 | Ga0075368_10000134 | 3300006042 | Bacteria | 19630 |
| 113 | Ga0075363_100013689 | 3300006048 | Bacteria | 3943 |
| 114 | Ga0075367_10001817 | 3300006178 | Bacteria | 9398 |
| 115 | Ga0075369_10035734 | 3300006186 | Bacteria | 2113 |
| 116 | Ga0075369_10055714 | 3300006186 | Bacteria | 1718 |
| 117 | Ga0097621_100018847 | 3300006237 | Bacteria | 5283 |
| 118 | Ga0068865_100000011 | 3300006881 | Bacteria | 154581 |
| 119 | Ga0097620_100011965 | 3300006931 | Bacteria | 8715 |
| 120 | Ga0097620_100228649 | 3300006931 | Bacteria | 1948 |
| 121 | Ga0105240_10010869 | 3300009093 | Bacteria | 12751 |
| 122 | Ga0105240_10062505 | 3300009093 | Bacteria | 4636 |
| 123 | Ga0105240_10256881 | 3300009093 | Bacteria | 2018 |
| 124 | Ga0105240_10333654 | 3300009093 | Bacteria | 1725 |
| 125 | Ga0105243_10000241 | 3300009148 | Bacteria | 62487 |
| 126 | Ga0105243_10593154 | 3300009148 | Bacteria | 1065 |
| 127 | Ga0105242_10001038 | 3300009176 | Bacteria | 21821 |
| 128 | Ga0105237_10057301 | 3300009545 | Bacteria | 3900 |
| 129 | Ga0105238_10443384 | 3300009551 | Bacteria | 1295 |
| 130 | Ga0105249_10065937 | 3300009553 | Bacteria | 3332 |
| 131 | Ga0105239_10000037 | 3300010375 | Bacteria | 206779 |
| 132 | Ga0105239_10318812 | 3300010375 | Bacteria | 1752 |
| 133 | Ga0105239_10722964 | 3300010375 | Bacteria | 1139 |
| 134 | Ga0157373_10120531 | 3300013100 | Bacteria | 1844 |
| 135 | Ga0157371_10081003 | 3300013102 | Bacteria | 2299 |
| 136 | Ga0157370_10000008 | 3300013104 | Bacteria | 240668 |
| 137 | Ga0157370_10057631 | 3300013104 | Bacteria | 3693 |
| 138 | Ga0157369_10008475 | 3300013105 | Bacteria | 11790 |
| 139 | Ga0157369_10365901 | 3300013105 | Bacteria | 1497 |
| 140 | Ga0157369_10456374 | 3300013105 | Bacteria | 1323 |
| 141 | Ga0157374_10003756 | 3300013296 | Bacteria | 12761 |
| 142 | Ga0157374_10014340 | 3300013296 | Bacteria | 6935 |
| 143 | Ga0163162_10489713 | 3300013306 | Bacteria | 1361 |
| 144 | Ga0157372_10032282 | 3300013307 | Bacteria | 5740 |
| 145 | Ga0157372_10090364 | 3300013307 | Bacteria | 3481 |
| 146 | Ga0157372_10115473 | 3300013307 | Bacteria | 3078 |
| 147 | Ga0157372_10123785 | 3300013307 | Bacteria | 2972 |
| 148 | Ga0157372_10134257 | 3300013307 | Bacteria | 2849 |
| 149 | Ga0157372_10163739 | 3300013307 | Bacteria | 2571 |
| 150 | Ga0157372_10185007 | 3300013307 | Bacteria | 2412 |
| 151 | Ga0157375_10000902 | 3300013308 | Bacteria | 25835 |
| 152 | Ga0157380_10336861 | 3300014326 | Bacteria | 1405 |
| 153 | Ga0157376_10000192 | 3300014969 | Bacteria | 42285 |
| 154 | Ga0163161_10008263 | 3300017792 | Bacteria | 7200 |
| 155 | Ga0207427_101279 | 3300025231 | Bacteria | 9572 |
| 156 | Ga0209026_1002091 | 3300025250 | Bacteria | 7853 |
| 157 | Ga0209148_1000117 | 3300025254 | Bacteria | 188938 |
| 158 | Ga0209148_1004843 | 3300025254 | Bacteria | 3205 |
| 159 | Ga0209233_1000079 | 3300025261 | Bacteria | 346944 |
| 160 | Ga0207697_10000801 | 3300025315 | Bacteria | 17856 |
| 161 | Ga0207656_10007667 | 3300025321 | Bacteria | 3943 |
| 162 | Ga0207696_1014984 | 3300025711 | Bacteria | 2640 |
| 163 | Ga0207682_10001885 | 3300025893 | Bacteria | 9542 |
| 164 | Ga0207688_10077798 | 3300025901 | Bacteria | 1891 |
| 165 | Ga0207680_10005487 | 3300025903 | Bacteria | 6064 |
| 166 | Ga0207647_10002429 | 3300025904 | Bacteria | 14133 |
| 167 | Ga0207647_10007383 | 3300025904 | Bacteria | 7948 |
| 168 | Ga0207647_10018586 | 3300025904 | Bacteria | 4696 |
| 169 | Ga0207647_10081317 | 3300025904 | Bacteria | 1941 |
| 170 | Ga0207645_10001754 | 3300025907 | Bacteria | 17601 |
| 171 | Ga0207645_10004800 | 3300025907 | Bacteria | 9940 |
| 172 | Ga0207643_10130918 | 3300025908 | Bacteria | 1493 |
| 173 | Ga0207705_10000144 | 3300025909 | Bacteria | 76661 |
| 174 | Ga0207705_10000250 | 3300025909 | Bacteria | 52558 |
| 175 | Ga0207705_10002097 | 3300025909 | Bacteria | 15501 |
| 176 | Ga0207705_10007210 | 3300025909 | Bacteria | 8187 |
| 177 | Ga0207705_10174479 | 3300025909 | Bacteria | 1620 |
| 178 | Ga0207654_10022885 | 3300025911 | Bacteria | 3340 |
| 179 | Ga0207695_10004781 | 3300025913 | Bacteria | 18319 |
| 180 | Ga0207695_10032478 | 3300025913 | Bacteria | 5711 |
| 181 | Ga0207695_10109914 | 3300025913 | Bacteria | 2737 |
| 182 | Ga0207671_10020643 | 3300025914 | Bacteria | 5010 |
| 183 | Ga0207671_10352412 | 3300025914 | Bacteria | 1167 |
| 184 | Ga0207657_10002199 | 3300025919 | Bacteria | 21137 |
| 185 | Ga0207657_10003536 | 3300025919 | Bacteria | 16692 |
| 186 | Ga0207657_10003878 | 3300025919 | Bacteria | 15869 |
| 187 | Ga0207657_10009183 | 3300025919 | Bacteria | 9970 |
| 188 | Ga0207657_10050794 | 3300025919 | Bacteria | 3606 |
| 189 | Ga0207657_10160289 | 3300025919 | Bacteria | 1828 |
| 190 | Ga0207657_10174267 | 3300025919 | Bacteria | 1742 |
| 191 | Ga0207657_10323734 | 3300025919 | Bacteria | 1218 |
| 192 | Ga0207649_10002895 | 3300025920 | Bacteria | 9443 |
| 193 | Ga0207649_10078755 | 3300025920 | Bacteria | 2127 |
| 194 | Ga0207649_10118340 | 3300025920 | Bacteria | 1782 |
| 195 | Ga0207681_10000913 | 3300025923 | Bacteria | 19294 |
| 196 | Ga0207681_10004478 | 3300025923 | Bacteria | 8601 |
| 197 | Ga0207681_10007249 | 3300025923 | Bacteria | 6798 |
| 198 | Ga0207681_10065465 | 3300025923 | Bacteria | 2513 |
| 199 | Ga0207681_10162404 | 3300025923 | Bacteria | 1685 |
| 200 | Ga0207694_10111527 | 3300025924 | Bacteria | 2176 |
| 201 | Ga0207650_10001193 | 3300025925 | Bacteria | 19077 |
| 202 | Ga0207650_10108592 | 3300025925 | Bacteria | 2145 |
| 203 | Ga0207687_10013636 | 3300025927 | Bacteria | 5305 |
| 204 | Ga0207687_10077920 | 3300025927 | Bacteria | 2385 |
| 205 | Ga0207664_10366887 | 3300025929 | Bacteria | 1276 |
| 206 | Ga0207644_10043239 | 3300025931 | Bacteria | 3196 |
| 207 | Ga0207644_10166123 | 3300025931 | Bacteria | 1719 |
| 208 | Ga0207690_10000001 | 3300025932 | Bacteria | 807539 |
| 209 | Ga0207690_10000002 | 3300025932 | Bacteria | 807473 |
| 210 | Ga0207690_10000003 | 3300025932 | Bacteria | 783011 |
| 211 | Ga0207690_10000004 | 3300025932 | Bacteria | 746138 |
| 212 | Ga0207690_10044685 | 3300025932 | Bacteria | 2922 |
| 213 | Ga0207690_10142101 | 3300025932 | Bacteria | 1770 |
| 214 | Ga0207706_10001528 | 3300025933 | Bacteria | 22957 |
| 215 | Ga0207706_10009534 | 3300025933 | Bacteria | 8915 |
| 216 | Ga0207706_10023320 | 3300025933 | Bacteria | 5558 |
| 217 | Ga0207706_10027933 | 3300025933 | Bacteria | 5043 |
| 218 | Ga0207706_10045624 | 3300025933 | Bacteria | 3882 |
| 219 | Ga0207706_10143013 | 3300025933 | Bacteria | 2104 |
| 220 | Ga0207706_10145084 | 3300025933 | Bacteria | 2088 |
| 221 | Ga0207686_10009548 | 3300025934 | Bacteria | 5263 |
| 222 | Ga0207709_10000119 | 3300025935 | Bacteria | 121452 |
| 223 | Ga0207709_10346529 | 3300025935 | Bacteria | 1120 |
| 224 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 225 | Ga0207691_10009658 | 3300025940 | Bacteria | 9254 |
| 226 | Ga0207691_10065861 | 3300025940 | Bacteria | 3278 |
| 227 | Ga0207689_10043717 | 3300025942 | Bacteria | 3703 |
| 228 | Ga0207667_10000035 | 3300025949 | Bacteria | 301056 |
| 229 | Ga0207667_10028393 | 3300025949 | Bacteria | 6078 |
| 230 | Ga0207667_10082186 | 3300025949 | Bacteria | 3337 |
| 231 | Ga0207667_10376763 | 3300025949 | Bacteria | 1446 |
| 232 | Ga0207651_10000002 | 3300025960 | Bacteria | 427663 |
| 233 | Ga0207651_10028103 | 3300025960 | Bacteria | 3543 |
| 234 | Ga0207651_10112688 | 3300025960 | Bacteria | 2045 |
| 235 | Ga0207712_10350587 | 3300025961 | Bacteria | 1227 |
| 236 | Ga0207712_10391799 | 3300025961 | Bacteria | 1165 |
| 237 | Ga0207668_10000420 | 3300025972 | Bacteria | 26815 |
| 238 | Ga0207668_10029581 | 3300025972 | Bacteria | 3591 |
| 239 | Ga0207668_10211610 | 3300025972 | Bacteria | 1551 |
| 240 | Ga0207640_10002078 | 3300025981 | Bacteria | 10783 |
| 241 | Ga0207640_10045437 | 3300025981 | Bacteria | 2820 |
| 242 | Ga0207640_10104898 | 3300025981 | Bacteria | 1991 |
| 243 | Ga0207658_10000029 | 3300025986 | Bacteria | 171928 |
| 244 | Ga0207677_10000042 | 3300026023 | Bacteria | 110706 |
| 245 | Ga0207677_10000110 | 3300026023 | Bacteria | 66525 |
| 246 | Ga0207703_10150829 | 3300026035 | Bacteria | 2027 |
| 247 | Ga0207639_10003124 | 3300026041 | Bacteria | 11134 |
| 248 | Ga0207639_10003549 | 3300026041 | Bacteria | 10481 |
| 249 | Ga0207639_10021732 | 3300026041 | Bacteria | 4612 |
| 250 | Ga0207639_10205020 | 3300026041 | Bacteria | 1694 |
| 251 | Ga0207678_10006156 | 3300026067 | Bacteria | 10673 |
| 252 | Ga0207678_10028921 | 3300026067 | Bacteria | 4837 |
| 253 | Ga0207678_10104229 | 3300026067 | Bacteria | 2420 |
| 254 | Ga0207678_10284092 | 3300026067 | Bacteria | 1421 |
| 255 | Ga0207702_10007410 | 3300026078 | Bacteria | 9366 |
| 256 | Ga0207702_10016949 | 3300026078 | Bacteria | 6029 |
| 257 | Ga0207702_10037062 | 3300026078 | Bacteria | 4080 |
| 258 | Ga0207702_10048793 | 3300026078 | Bacteria | 3571 |
| 259 | Ga0207641_10000343 | 3300026088 | Bacteria | 56041 |
| 260 | Ga0207648_10000001 | 3300026089 | Bacteria | 427499 |
| 261 | Ga0207648_10003545 | 3300026089 | Bacteria | 16326 |
| 262 | Ga0207674_10011479 | 3300026116 | Bacteria | 9952 |
| 263 | Ga0207674_10021373 | 3300026116 | Bacteria | 6969 |
| 264 | Ga0207674_10031213 | 3300026116 | Bacteria | 5599 |
| 265 | Ga0207674_10076713 | 3300026116 | Bacteria | 3349 |
| 266 | Ga0207674_10149879 | 3300026116 | Bacteria | 2290 |
| 267 | Ga0207683_10004102 | 3300026121 | Bacteria | 12583 |
| 268 | Ga0207683_10038348 | 3300026121 | Bacteria | 4176 |
| 269 | Ga0207698_10001453 | 3300026142 | Bacteria | 13782 |
| 270 | Ga0207698_10023128 | 3300026142 | Bacteria | 4337 |
| 271 | Ga0207698_10196058 | 3300026142 | Bacteria | 1804 |
| 272 | Ga0207698_10286087 | 3300026142 | Bacteria | 1527 |
| 273 | Ga0209813_10000026 | 3300027866 | Bacteria | 71626 |
| 274 | Ga0209813_10000064 | 3300027866 | Bacteria | 43230 |
| 275 | Ga0268266_10000468 | 3300028379 | Bacteria | 58386 |
| 276 | Ga0268266_10006387 | 3300028379 | Bacteria | 10799 |
| 277 | Ga0268266_10012074 | 3300028379 | Bacteria | 7475 |
| 278 | Ga0268266_10060943 | 3300028379 | Bacteria | 3253 |
| 279 | Ga0268265_10036761 | 3300028380 | Bacteria | 3589 |
| 280 | Ga0268265_10505851 | 3300028380 | Bacteria | 1139 |
| 281 | Ga0268264_10025247 | 3300028381 | Bacteria | 4854 |
| 282 | Ga0316180_1175123 | 3300030736 | Bacteria | 1711 |
| 283 | Ga0307509_10172605 | 3300031507 | Bacteria | 2039 |
| 284 | Ga0307408_100076733 | 3300031548 | Bacteria | 2486 |
| 285 | Ga0307408_100091593 | 3300031548 | Bacteria | 2296 |
| 286 | Ga0307408_100296281 | 3300031548 | Bacteria | 1353 |
| 287 | Ga0307408_100303916 | 3300031548 | Bacteria | 1337 |
| 288 | Ga0307508_10040002 | 3300031616 | Bacteria | 4211 |
| 289 | Ga0307405_10015134 | 3300031731 | Bacteria | 4168 |
| 290 | Ga0307405_10062290 | 3300031731 | Bacteria | 2361 |
| 291 | Ga0307405_10097472 | 3300031731 | Bacteria | 1963 |
| 292 | Ga0307405_10140999 | 3300031731 | Bacteria | 1681 |
| 293 | Ga0307413_10025453 | 3300031824 | Bacteria | 3244 |
| 294 | Ga0307413_10031193 | 3300031824 | Bacteria | 3004 |
| 295 | Ga0307413_10065875 | 3300031824 | Bacteria | 2257 |
| 296 | Ga0307413_10075540 | 3300031824 | Bacteria | 2139 |
| 297 | Ga0307413_10115808 | 3300031824 | Bacteria | 1804 |
| 298 | Ga0307413_10161466 | 3300031824 | Bacteria | 1575 |
| 299 | Ga0307413_10303983 | 3300031824 | Bacteria | 1211 |
| 300 | Ga0307410_10013845 | 3300031852 | Bacteria | 4722 |
| 301 | Ga0307410_10023336 | 3300031852 | Bacteria | 3843 |
| 302 | Ga0307410_10233865 | 3300031852 | Bacteria | 1420 |
| 303 | Ga0307410_10250175 | 3300031852 | Bacteria | 1377 |
| 304 | Ga0307410_10308985 | 3300031852 | Bacteria | 1250 |
| 305 | Ga0307406_10044058 | 3300031901 | Bacteria | 2795 |
| 306 | Ga0307406_10165676 | 3300031901 | Bacteria | 1594 |
| 307 | Ga0307406_10208303 | 3300031901 | Bacteria | 1445 |
| 308 | Ga0307406_10333606 | 3300031901 | Bacteria | 1178 |
| 309 | Ga0307406_10396145 | 3300031901 | Bacteria | 1093 |
| 310 | Ga0307407_10032006 | 3300031903 | Bacteria | 2855 |
| 311 | Ga0307412_10001551 | 3300031911 | Bacteria | 12691 |
| 312 | Ga0307412_10014206 | 3300031911 | Bacteria | 4691 |
| 313 | Ga0307412_10084443 | 3300031911 | Bacteria | 2204 |
| 314 | Ga0307412_10206536 | 3300031911 | Bacteria | 1495 |
| 315 | Ga0307409_100030791 | 3300031995 | Bacteria | 3861 |
| 316 | Ga0307409_100152528 | 3300031995 | Bacteria | 2008 |
| 317 | Ga0307409_100161233 | 3300031995 | Bacteria | 1961 |
| 318 | Ga0307409_100165640 | 3300031995 | Bacteria | 1939 |
| 319 | Ga0307409_100298106 | 3300031995 | Bacteria | 1498 |
| 320 | Ga0307416_100035887 | 3300032002 | Bacteria | 3793 |
| 321 | Ga0307416_100040957 | 3300032002 | Bacteria | 3604 |
| 322 | Ga0307416_100083007 | 3300032002 | Bacteria | 2717 |
| 323 | Ga0307416_100092900 | 3300032002 | Bacteria | 2597 |
| 324 | Ga0307414_10000486 | 3300032004 | Bacteria | 20663 |
| 325 | Ga0307414_10000936 | 3300032004 | Bacteria | 14906 |
| 326 | Ga0307414_10005912 | 3300032004 | Bacteria | 6773 |
| 327 | Ga0307414_10040707 | 3300032004 | Bacteria | 3141 |
| 328 | Ga0307414_10041989 | 3300032004 | Bacteria | 3104 |
| 329 | Ga0307414_10043111 | 3300032004 | Bacteria | 3071 |
| 330 | Ga0307414_10053999 | 3300032004 | Bacteria | 2805 |
| 331 | Ga0307414_10082760 | 3300032004 | Bacteria | 2354 |
| 332 | Ga0307414_10125697 | 3300032004 | Bacteria | 1981 |
| 333 | Ga0307414_10165607 | 3300032004 | Bacteria | 1761 |
| 334 | Ga0307414_10203504 | 3300032004 | Bacteria | 1612 |
| 335 | Ga0307414_10301181 | 3300032004 | Bacteria | 1356 |
| 336 | Ga0307414_10480403 | 3300032004 | Bacteria | 1096 |
| 337 | Ga0307411_10067334 | 3300032005 | Bacteria | 2409 |
| 338 | Ga0307411_10179266 | 3300032005 | Bacteria | 1606 |
| 339 | Ga0307411_10207089 | 3300032005 | Bacteria | 1511 |
| 340 | Ga0307411_10280166 | 3300032005 | Bacteria | 1326 |
| 341 | Ga0307415_100034809 | 3300032126 | Bacteria | 3283 |
| 342 | Ga0307415_100079912 | 3300032126 | Bacteria | 2331 |
| 343 | Ga0307415_100123043 | 3300032126 | Bacteria | 1949 |
| 344 | Ga0307415_100137522 | 3300032126 | Bacteria | 1860 |
| 345 | Ga0316583_10000596 | 3300032133 | Bacteria | 10981 |
| 346 | Ga0316582_0009794 | 3300036647 | Bacteria | 5215 |
| 347 | Ga0316584_0068361 | 3300036712 | Bacteria | 2663 |
| 348 | Ga0316584_0123969 | 3300036712 | Bacteria | 1930 |
| 349 | Ga0395899_0002220 | 3300037312 | Bacteria | 15922 |
| 350 | Ga0395899_0097446 | 3300037312 | Bacteria | 2126 |
| 351 | Ga0395899_0311155 | 3300037312 | Bacteria | 1063 |
| 352 | Ga0395900_0001007 | 3300037418 | Bacteria | 36505 |
| 353 | Ga0395900_0199287 | 3300037418 | Bacteria | 2027 |
| 354 | Ga0395898_0121798 | 3300037466 | Bacteria | 2499 |
| 355 | Ga0395905_0342048 | 3300037471 | Bacteria | 1387 |
| 356 | Ga0395901_0001182 | 3300038443 | Bacteria | 27756 |
| 357 | Ga0395901_0128974 | 3300038443 | Bacteria | 2658 |
| 358 | Ga0395901_0367728 | 3300038443 | Bacteria | 1482 |
| 359 | Ga0439445_0000876 | 3300042004 | Bacteria | 6390 |
| 360 | Ga0439448_0000458 | 3300042005 | Bacteria | 9415 |
| 361 | Ga0439448_0006784 | 3300042005 | Bacteria | 3300 |
| 362 | Ga0439455_0000272 | 3300042012 | Bacteria | 6323 |
| 363 | Ga0439458_0000004 | 3300042157 | Bacteria | 32502 |
| 364 | Ga0439458_0000749 | 3300042157 | Bacteria | 8305 |
| 365 | Ga0466965_0169615 | 3300044683 | Bacteria | 1148 |
| 366 | Ga0466963_0000856 | 3300044694 | Bacteria | 15370 |
| 367 | Ga0466963_0043630 | 3300044694 | Bacteria | 2950 |
| 368 | Ga0466964_0027352 | 3300044706 | Bacteria | 2239 |
| 369 | Ga0453684_0355292 | 3300044712 | Bacteria | 1651 |
| 370 | Ga0466971_0017093 | 3300044719 | Bacteria | 3205 |
| 371 | Ga0466970_0018389 | 3300044765 | Bacteria | 3617 |
| 372 | Ga0466957_0042948 | 3300044842 | Bacteria | 2736 |
| 373 | Ga0466957_0284079 | 3300044842 | Bacteria | 1108 |
| 374 | Ga0466957_0303117 | 3300044842 | Bacteria | 1074 |
| 375 | Ga0451576_0000007 | 3300045051 | Bacteria | 782228 |
| 376 | Ga0451576_0355575 | 3300045051 | Bacteria | 1534 |
| 377 | Ga0466958_0000484 | 3300045836 | Bacteria | 16666 |
| 378 | Ga0495627_050423 | 3300046453 | Bacteria | 1254 |
| 379 | Ga0495638_0000016 | 3300046460 | Bacteria | 396505 |
| 380 | Ga0495650_0006895 | 3300046471 | Bacteria | 6967 |
| 381 | Ga0495584_0016538 | 3300046491 | Bacteria | 3761 |
| 382 | Ga0495583_0000094 | 3300046506 | Bacteria | 153549 |
| 383 | Ga0495583_0000111 | 3300046506 | Bacteria | 138300 |
| 384 | Ga0495606_0003328 | 3300046507 | Bacteria | 17157 |
| 385 | Ga0495606_0032322 | 3300046507 | Bacteria | 3627 |
| 386 | Ga0495606_0211594 | 3300046507 | Bacteria | 1098 |
| 387 | Ga0495610_0000068 | 3300046512 | Bacteria | 122949 |
| 388 | Ga0495616_0000187 | 3300046513 | Bacteria | 51726 |
| 389 | Ga0495632_0000007 | 3300046519 | Bacteria | 343246 |
| 390 | Ga0495632_0000132 | 3300046519 | Bacteria | 75720 |
| 391 | Ga0495637_0001444 | 3300046520 | Bacteria | 13998 |
| 392 | Ga0495637_0028044 | 3300046520 | Bacteria | 2516 |
| 393 | Ga0495643_0000005 | 3300046522 | Bacteria | 443135 |
| 394 | Ga0495648_0000013 | 3300046524 | Bacteria | 289090 |
| 395 | Ga0495648_0005335 | 3300046524 | Bacteria | 10713 |
| 396 | Ga0495648_0147619 | 3300046524 | Bacteria | 1230 |
| 397 | Ga0495663_0000005 | 3300046525 | Bacteria | 342265 |
| 398 | Ga0495663_0004691 | 3300046525 | Bacteria | 3827 |
| 399 | Ga0495621_0000114 | 3300046539 | Bacteria | 16945 |
| 400 | Ga0495621_0004060 | 3300046539 | Bacteria | 4074 |
| 401 | Ga0495633_0000550 | 3300046558 | Bacteria | 36970 |
| 402 | Ga0495633_0003251 | 3300046558 | Bacteria | 10950 |
| 403 | Ga0495633_0054574 | 3300046558 | Bacteria | 1880 |
| 404 | Ga0495633_0075134 | 3300046558 | Bacteria | 1574 |
| 405 | Ga0495668_0006493 | 3300046616 | Bacteria | 7651 |
| 406 | Ga0495625_0153119 | 3300046660 | Bacteria | 1549 |
| 407 | Ga0495661_0159931 | 3300046665 | Bacteria | 1210 |
| 408 | Ga0495669_0036416 | 3300046684 | Bacteria | 2175 |
| 409 | Ga0495669_0047432 | 3300046684 | Bacteria | 1919 |
| 410 | Ga0495669_0114361 | 3300046684 | Bacteria | 1262 |
| 411 | Ga0495671_0000007 | 3300046692 | Bacteria | 443069 |
| 412 | Ga0495671_0000018 | 3300046692 | Bacteria | 291470 |
| 413 | Ga0495649_0038408 | 3300046694 | Bacteria | 2627 |
| 414 | Ga0495660_0086531 | 3300046810 | Bacteria | 1636 |
| 415 | Ga0495673_0000029 | 3300047469 | Bacteria | 471019 |
| 416 | Ga0495681_0000055 | 3300047470 | Bacteria | 104502 |
| 417 | Ga0495681_0021318 | 3300047470 | Bacteria | 3495 |
| 418 | Ga0495686_0000149 | 3300047472 | Bacteria | 135332 |
| 419 | Ga0496100_0064217 | 3300048903 | Bacteria | 2428 |
| 420 | Ga0496102_0001063 | 3300048905 | Bacteria | 25467 |
| 421 | Ga0496103_0000195 | 3300048906 | Bacteria | 60384 |
| 422 | Ga0496104_0001584 | 3300048907 | Bacteria | 19588 |
| 423 | Ga0496108_0001477 | 3300048911 | Bacteria | 18569 |
| 424 | Ga0496110_0072683 | 3300048913 | Bacteria | 3052 |
| 425 | Ga0496110_0132503 | 3300048913 | Bacteria | 2251 |
| 426 | Ga0496111_0241371 | 3300048914 | Bacteria | 1342 |
| 427 | Ga0496112_0256132 | 3300048915 | Bacteria | 1700 |
| 428 | Ga0496113_0007041 | 3300048916 | Bacteria | 7194 |
| 429 | Ga0496116_0031777 | 3300048919 | Bacteria | 3773 |
| 430 | Ga0496116_0162943 | 3300048919 | Bacteria | 1220 |
| 431 | Ga0496116_0217906 | 3300048919 | Bacteria | 981 |
| 432 | Ga0496117_0004618 | 3300048920 | Bacteria | 15007 |
| 433 | Ga0496117_0011777 | 3300048920 | Bacteria | 7794 |
| 434 | Ga0496118_0027922 | 3300048921 | Bacteria | 4766 |
| 435 | Ga0496118_0033827 | 3300048921 | Bacteria | 4185 |
| 436 | Ga0496118_0078874 | 3300048921 | Bacteria | 2327 |
| 437 | Ga0496119_0016791 | 3300048922 | Bacteria | 5545 |
| 438 | Ga0496120_0001380 | 3300048923 | Bacteria | 29622 |
| 439 | Ga0496121_0000066 | 3300048924 | Bacteria | 267065 |
| 440 | Ga0496121_0035155 | 3300048924 | Bacteria | 4495 |
| 441 | Ga0496121_0295930 | 3300048924 | Bacteria | 1100 |
| 442 | Ga0496121_0295938 | 3300048924 | Bacteria | 1100 |
| 443 | Ga0496122_0002027 | 3300048925 | Bacteria | 30082 |
| 444 | Ga0496122_0040350 | 3300048925 | Bacteria | 3711 |
| 445 | Ga0496122_0049641 | 3300048925 | Bacteria | 3209 |
| 446 | Ga0496122_0107870 | 3300048925 | Bacteria | 1838 |
| 447 | Ga0496123_0007923 | 3300048926 | Bacteria | 9866 |
| 448 | Ga0496123_0039220 | 3300048926 | Bacteria | 3316 |
| 449 | Ga0496123_0042462 | 3300048926 | Bacteria | 3137 |
| 450 | Ga0496124_0046079 | 3300048927 | Bacteria | 3736 |
| 451 | Ga0496125_0032182 | 3300048928 | Bacteria | 4662 |
| 452 | Ga0496125_0046579 | 3300048928 | Bacteria | 3637 |
| 453 | Ga0496125_0123691 | 3300048928 | Bacteria | 1838 |
| 454 | Ga0496125_0170720 | 3300048928 | Bacteria | 1462 |
| 455 | Ga0496126_0000476 | 3300048929 | Bacteria | 79541 |
| 456 | Ga0496126_0003014 | 3300048929 | Bacteria | 21843 |
| 457 | Ga0496126_0033991 | 3300048929 | Bacteria | 4794 |
| 458 | Ga0496126_0110561 | 3300048929 | Bacteria | 2394 |
| 459 | Ga0496126_0115490 | 3300048929 | Bacteria | 2334 |
| 460 | Ga0496126_0232396 | 3300048929 | Bacteria | 1544 |
| 461 | Ga0495682_0005039 | 3300049460 | Bacteria | 5550 |
| 462 | Ga0501034_0049747 | 3300049571 | Bacteria | 4229 |
| 463 | Ga0501037_0259443 | 3300049573 | Bacteria | 1214 |
| 464 | Ga0501038_0013511 | 3300049574 | Bacteria | 7442 |
| 465 | Ga0501223_002201 | 3300049663 | Bacteria | 4370 |
| 466 | Ga0501224_000020 | 3300049664 | Bacteria | 74346 |
| 467 | Ga0501233_001289 | 3300049668 | Bacteria | 4287 |
| 468 | Ga0501235_022309 | 3300049669 | Bacteria | 1407 |
| 469 | Ga0501235_025515 | 3300049669 | Bacteria | 1322 |
| 470 | Ga0501255_002563 | 3300049684 | Bacteria | 1607 |
| 471 | Ga0501225_0000009 | 3300049705 | Bacteria | 90065 |
| 472 | Ga0501234_001287 | 3300049707 | Bacteria | 3927 |
| 473 | Ga0501267_005874 | 3300049764 | Bacteria | 1169 |
| 474 | Ga0501226_000136 | 3300049853 | Bacteria | 14145 |
| 475 | nmdc:mga03683_14295_c1 | 3300050489 | Bacteria | 2935 |
| 476 | nmdc:mga03n38_28530_c1 | 3300050490 | Bacteria | 2328 |
| 477 | nmdc:mga00v17_69844_c1 | 3300050491 | Bacteria | 2175 |
| 478 | nmdc:mga0yw44_159984_c1 | 3300050492 | Bacteria | 1474 |
| 479 | nmdc:mga0k408_1951_c1 | 3300050493 | Bacteria | 11058 |
| 480 | nmdc:mga0k408_79352_c1 | 3300050493 | Bacteria | 1921 |
| 481 | nmdc:mga06z11_1082_c1 | 3300050494 | Bacteria | 9916 |
| 482 | nmdc:mga06z11_19_c1 | 3300050494 | Bacteria | 76090 |
| 483 | nmdc:mga04h51_1318_c1 | 3300050495 | Bacteria | 5720 |
| 484 | nmdc:mga04h51_14_c1 | 3300050495 | Bacteria | 77981 |
| 485 | nmdc:mga07m45_27326_c1 | 3300050496 | Bacteria | 3142 |
| 486 | nmdc:mga07m45_55_c1 | 3300050496 | Bacteria | 47453 |
| 487 | nmdc:mga05p37_709579_c1 | 3300050507 | Bacteria | 1116 |
| 488 | nmdc:mga06r32_17760_c1 | 3300050510 | Bacteria | 6500 |
| 489 | nmdc:mga08y16_32648_c1 | 3300050511 | Bacteria | 5472 |
| 490 | nmdc:mga0sz30_8620_c1 | 3300050516 | Bacteria | 2087 |
| 491 | Ga0500643_000488 | 3300053087 | Bacteria | 28843 |
| 492 | Ga0500644_0028983 | 3300053088 | Bacteria | 1736 |
| 493 | Ga0500555_000403 | 3300053103 | Bacteria | 18009 |
| 494 | Ga0500595_009072 | 3300053119 | Bacteria | 4035 |
| 495 | Ga0500607_001592 | 3300053121 | Bacteria | 20060 |
| 496 | Ga0500608_000755 | 3300053122 | Bacteria | 11796 |
| 497 | Ga0500559_0000841 | 3300053136 | Bacteria | 19866 |
| 498 | Ga0500559_0015561 | 3300053136 | Bacteria | 3212 |
| 499 | Ga0500564_044774 | 3300053138 | Bacteria | 2031 |
| 500 | Ga0500568_0000708 | 3300053139 | Bacteria | 23914 |
| 501 | Ga0500604_0000004 | 3300053151 | Bacteria | 146374 |
| 502 | Ga0500616_0000195 | 3300053153 | Bacteria | 99188 |
| 503 | Ga0500622_0000145 | 3300053156 | Bacteria | 75417 |
| 504 | Ga0500624_000042 | 3300053157 | Bacteria | 90289 |
| 505 | Ga0500627_0002094 | 3300053158 | Bacteria | 5791 |
| 506 | Ga0500567_000039 | 3300053723 | Bacteria | 27122 |
| 507 | Ga0500625_000021 | 3300053729 | Bacteria | 83503 |
| 508 | Ga0500645_004302 | 3300053730 | Bacteria | 5492 |
| 509 | Ga0500661_000036 | 3300055283 | Bacteria | 19851 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046507 | Ga0495606_0211594 | Ga0495606_0211594_11_841 | 276 |
| 2 | 3300005455 | Ga0070663_100082667 | Ga0070663_1000826672 | 277 |
| 3 | 3300005539 | Ga0068853_100081996 | Ga0068853_1000819962 | 277 |
| 4 | 3300026041 | Ga0207639_10021732 | Ga0207639_100217326 | 277 |
| 5 | 3300026067 | Ga0207678_10028921 | Ga0207678_100289214 | 277 |
| 6 | 3300002075 | JGI24738J21930_10001900 | JGI24738J21930_100019008 | 279 |
| 7 | 3300005327 | Ga0070658_10087868 | Ga0070658_100878682 | 279 |
| 8 | 3300005344 | Ga0070661_100142822 | Ga0070661_1001428222 | 279 |
| 9 | 3300005578 | Ga0068854_100022168 | Ga0068854_1000221686 | 279 |
| 10 | 3300006237 | Ga0097621_100018847 | Ga0097621_1000188474 | 279 |
| 11 | 3300013296 | Ga0157374_10014340 | Ga0157374_100143404 | 279 |
| 12 | 3300013307 | Ga0157372_10134257 | Ga0157372_101342573 | 279 |
| 13 | 3300025981 | Ga0207640_10045437 | Ga0207640_100454372 | 279 |
| 14 | 3300046506 | Ga0495583_0000111 | Ga0495583_0000111_118757_119659 | 289 |
| 15 | 3300046665 | Ga0495661_0159931 | Ga0495661_0159931_103_1005 | 289 |
| 16 | 3300049460 | Ga0495682_0005039 | Ga0495682_0005039_3829_4731 | 289 |
| 17 | 3300053103 | Ga0500555_000403 | Ga0500555_000403_15370_16272 | 289 |
| 18 | iso_pu_bacteria | 2928959182 | 2928961640 | 292 |
| 19 | 3300014326 | Ga0157380_10336861 | Ga0157380_103368612 | 293 |
| 20 | 3300031901 | Ga0307406_10208303 | Ga0307406_102083032 | 294 |
| 21 | iso_pu_bacteria | 2896429255 | 2896430491 | 294 |
| 22 | 3300005293 | Ga0065715_10007256 | Ga0065715_100072563 | 295 |
| 23 | 3300005293 | Ga0065715_10177317 | Ga0065715_101773171 | 295 |
| 24 | 3300005328 | Ga0070676_10003595 | Ga0070676_100035954 | 295 |
| 25 | 3300005331 | Ga0070670_100004123 | Ga0070670_10000412310 | 295 |
| 26 | 3300005331 | Ga0070670_100010504 | Ga0070670_10001050410 | 295 |
| 27 | 3300005333 | Ga0070677_10020285 | Ga0070677_100202853 | 295 |
| 28 | 3300005334 | Ga0068869_100295187 | Ga0068869_1002951872 | 295 |
| 29 | 3300005345 | Ga0070692_10001570 | Ga0070692_100015705 | 295 |
| 30 | 3300005347 | Ga0070668_100232046 | Ga0070668_1002320462 | 295 |
| 31 | 3300005353 | Ga0070669_100001566 | Ga0070669_1000015662 | 295 |
| 32 | 3300005353 | Ga0070669_100112579 | Ga0070669_1001125792 | 295 |
| 33 | 3300005354 | Ga0070675_100070745 | Ga0070675_1000707453 | 295 |
| 34 | 3300005356 | Ga0070674_100108335 | Ga0070674_1001083353 | 295 |
| 35 | 3300005366 | Ga0070659_100114515 | Ga0070659_1001145152 | 295 |
| 36 | 3300005367 | Ga0070667_100244711 | Ga0070667_1002447112 | 295 |
| 37 | 3300005455 | Ga0070663_100080923 | Ga0070663_1000809232 | 295 |
| 38 | 3300005456 | Ga0070678_100010112 | Ga0070678_1000101123 | 295 |
| 39 | 3300005563 | Ga0068855_100190786 | Ga0068855_1001907862 | 295 |
| 40 | 3300005578 | Ga0068854_100002258 | Ga0068854_1000022589 | 295 |
| 41 | 3300005578 | Ga0068854_100100971 | Ga0068854_1001009712 | 295 |
| 42 | 3300005616 | Ga0068852_100441988 | Ga0068852_1004419882 | 295 |
| 43 | 3300005617 | Ga0068859_100011965 | Ga0068859_1000119654 | 295 |
| 44 | 3300005840 | Ga0068870_10234958 | Ga0068870_102349581 | 295 |
| 45 | 3300005844 | Ga0068862_100132541 | Ga0068862_1001325413 | 295 |
| 46 | 3300006931 | Ga0097620_100011965 | Ga0097620_1000119657 | 295 |
| 47 | 3300009148 | Ga0105243_10593154 | Ga0105243_105931541 | 295 |
| 48 | 3300009553 | Ga0105249_10065937 | Ga0105249_100659371 | 295 |
| 49 | 3300025315 | Ga0207697_10000801 | Ga0207697_100008014 | 295 |
| 50 | 3300025893 | Ga0207682_10001885 | Ga0207682_100018859 | 295 |
| 51 | 3300025901 | Ga0207688_10077798 | Ga0207688_100777982 | 295 |
| 52 | 3300025907 | Ga0207645_10001754 | Ga0207645_1000175416 | 295 |
| 53 | 3300025908 | Ga0207643_10130918 | Ga0207643_101309182 | 295 |
| 54 | 3300025923 | Ga0207681_10004478 | Ga0207681_100044789 | 295 |
| 55 | 3300025925 | Ga0207650_10001193 | Ga0207650_1000119310 | 295 |
| 56 | 3300025933 | Ga0207706_10001528 | Ga0207706_1000152813 | 295 |
| 57 | 3300025935 | Ga0207709_10346529 | Ga0207709_103465292 | 295 |
| 58 | 3300025940 | Ga0207691_10009658 | Ga0207691_100096582 | 295 |
| 59 | 3300025949 | Ga0207667_10028393 | Ga0207667_100283939 | 295 |
| 60 | 3300025960 | Ga0207651_10112688 | Ga0207651_101126882 | 295 |
| 61 | 3300025972 | Ga0207668_10211610 | Ga0207668_102116102 | 295 |
| 62 | 3300025981 | Ga0207640_10002078 | Ga0207640_1000207811 | 295 |
| 63 | 3300026121 | Ga0207683_10038348 | Ga0207683_100383486 | 295 |
| 64 | 3300028380 | Ga0268265_10036761 | Ga0268265_100367613 | 295 |
| 65 | 3300030736 | Ga0316180_1175123 | Ga0316180_11751232 | 295 |
| 66 | 3300031548 | Ga0307408_100076733 | Ga0307408_1000767334 | 295 |
| 67 | 3300031548 | Ga0307408_100296281 | Ga0307408_1002962811 | 295 |
| 68 | 3300031548 | Ga0307408_100303916 | Ga0307408_1003039161 | 295 |
| 69 | 3300031731 | Ga0307405_10097472 | Ga0307405_100974723 | 295 |
| 70 | 3300031731 | Ga0307405_10140999 | Ga0307405_101409992 | 295 |
| 71 | 3300031824 | Ga0307413_10025453 | Ga0307413_100254533 | 295 |
| 72 | 3300031824 | Ga0307413_10031193 | Ga0307413_100311933 | 295 |
| 73 | 3300031824 | Ga0307413_10065875 | Ga0307413_100658753 | 295 |
| 74 | 3300031824 | Ga0307413_10075540 | Ga0307413_100755403 | 295 |
| 75 | 3300031852 | Ga0307410_10250175 | Ga0307410_102501752 | 295 |
| 76 | 3300031901 | Ga0307406_10044058 | Ga0307406_100440582 | 295 |
| 77 | 3300031901 | Ga0307406_10396145 | Ga0307406_103961451 | 295 |
| 78 | 3300031903 | Ga0307407_10032006 | Ga0307407_100320062 | 295 |
| 79 | 3300031911 | Ga0307412_10084443 | Ga0307412_100844433 | 295 |
| 80 | 3300031911 | Ga0307412_10206536 | Ga0307412_102065362 | 295 |
| 81 | 3300031995 | Ga0307409_100030791 | Ga0307409_1000307912 | 295 |
| 82 | 3300031995 | Ga0307409_100165640 | Ga0307409_1001656402 | 295 |
| 83 | 3300032002 | Ga0307416_100092900 | Ga0307416_1000929004 | 295 |
| 84 | 3300032004 | Ga0307414_10040707 | Ga0307414_100407072 | 295 |
| 85 | 3300032004 | Ga0307414_10053999 | Ga0307414_100539992 | 295 |
| 86 | 3300032004 | Ga0307414_10203504 | Ga0307414_102035042 | 295 |
| 87 | 3300032004 | Ga0307414_10480403 | Ga0307414_104804031 | 295 |
| 88 | 3300032005 | Ga0307411_10067334 | Ga0307411_100673342 | 295 |
| 89 | 3300032005 | Ga0307411_10179266 | Ga0307411_101792662 | 295 |
| 90 | 3300032005 | Ga0307411_10207089 | Ga0307411_102070892 | 295 |
| 91 | 3300032005 | Ga0307411_10280166 | Ga0307411_102801662 | 295 |
| 92 | 3300032126 | Ga0307415_100034809 | Ga0307415_1000348092 | 295 |
| 93 | 3300032126 | Ga0307415_100079912 | Ga0307415_1000799123 | 295 |
| 94 | 3300032126 | Ga0307415_100137522 | Ga0307415_1001375222 | 295 |
| 95 | 3300037312 | Ga0395899_0097446 | Ga0395899_0097446_465_1370 | 295 |
| 96 | 3300037418 | Ga0395900_0001007 | Ga0395900_0001007_25767_26672 | 295 |
| 97 | 3300038443 | Ga0395901_0001182 | Ga0395901_0001182_12988_13893 | 295 |
| 98 | 3300042004 | Ga0439445_0000876 | Ga0439445_0000876_4824_5729 | 295 |
| 99 | 3300046539 | Ga0495621_0004060 | Ga0495621_0004060_125_1030 | 295 |
| 100 | 3300046558 | Ga0495633_0054574 | Ga0495633_0054574_527_1432 | 295 |
| 101 | 3300046684 | Ga0495669_0047432 | Ga0495669_0047432_64_969 | 295 |
| 102 | 3300046684 | Ga0495669_0114361 | Ga0495669_0114361_32_937 | 295 |
| 103 | 3300049764 | Ga0501267_005874 | Ga0501267_005874_64_969 | 295 |
| 104 | 3300050510 | nmdc:mga06r32_17760_c1 | nmdc:mga06r32_17760_c1_3757_4722 | 295 |
| 105 | 3300050511 | nmdc:mga08y16_32648_c1 | nmdc:mga08y16_32648_c1_2717_3622 | 295 |
| 106 | iso_pu_bacteria | 2885427238 | 2885428033 | 295 |
| 107 | iso_pu_bacteria | 2885429604 | 2885430125 | 295 |
| 108 | 2162886007 | SwRhRL2b_contig_261670 | SwRhRL2b_0404.00000730 | 296 |
| 109 | 3300001904 | JGI24736J21556_1001780 | JGI24736J21556_10017803 | 296 |
| 110 | 3300001915 | JGI24741J21665_1001479 | JGI24741J21665_10014794 | 296 |
| 111 | 3300001979 | JGI24740J21852_10006372 | JGI24740J21852_100063724 | 296 |
| 112 | 3300001979 | JGI24740J21852_10031551 | JGI24740J21852_100315512 | 296 |
| 113 | 3300001989 | JGI24739J22299_10002342 | JGI24739J22299_100023422 | 296 |
| 114 | 3300001989 | JGI24739J22299_10009438 | JGI24739J22299_100094384 | 296 |
| 115 | 3300001989 | JGI24739J22299_10009524 | JGI24739J22299_100095244 | 296 |
| 116 | 3300001989 | JGI24739J22299_10016224 | JGI24739J22299_100162243 | 296 |
| 117 | 3300001990 | JGI24737J22298_10010222 | JGI24737J22298_100102222 | 296 |
| 118 | 3300001990 | JGI24737J22298_10032405 | JGI24737J22298_100324052 | 296 |
| 119 | 3300002067 | JGI24735J21928_10002006 | JGI24735J21928_100020062 | 296 |
| 120 | 3300002067 | JGI24735J21928_10003706 | JGI24735J21928_100037063 | 296 |
| 121 | 3300002067 | JGI24735J21928_10003754 | JGI24735J21928_100037547 | 296 |
| 122 | 3300002067 | JGI24735J21928_10005739 | JGI24735J21928_100057394 | 296 |
| 123 | 3300002067 | JGI24735J21928_10006435 | JGI24735J21928_100064352 | 296 |
| 124 | 3300002067 | JGI24735J21928_10008583 | JGI24735J21928_100085832 | 296 |
| 125 | 3300002067 | JGI24735J21928_10022219 | JGI24735J21928_100222192 | 296 |
| 126 | 3300002067 | JGI24735J21928_10050663 | JGI24735J21928_100506632 | 296 |
| 127 | 3300002075 | JGI24738J21930_10001216 | JGI24738J21930_100012167 | 296 |
| 128 | 3300002075 | JGI24738J21930_10004560 | JGI24738J21930_100045603 | 296 |
| 129 | 3300002077 | JGI24744J21845_10000581 | JGI24744J21845_100005819 | 296 |
| 130 | 3300003214 | JGI25165J46597_1000216 | JGI25165J46597_100021653 | 296 |
| 131 | 3300003762 | Ga0055542_1009686 | Ga0055542_10096862 | 296 |
| 132 | 3300005289 | Ga0065704_10009711 | Ga0065704_100097113 | 296 |
| 133 | 3300005327 | Ga0070658_10000225 | Ga0070658_1000022527 | 296 |
| 134 | 3300005327 | Ga0070658_10003675 | Ga0070658_100036758 | 296 |
| 135 | 3300005327 | Ga0070658_10010960 | Ga0070658_100109603 | 296 |
| 136 | 3300005327 | Ga0070658_10099154 | Ga0070658_100991542 | 296 |
| 137 | 3300005328 | Ga0070676_10003004 | Ga0070676_100030042 | 296 |
| 138 | 3300005334 | Ga0068869_100031385 | Ga0068869_1000313856 | 296 |
| 139 | 3300005335 | Ga0070666_10008340 | Ga0070666_100083403 | 296 |
| 140 | 3300005339 | Ga0070660_100000480 | Ga0070660_10000048019 | 296 |
| 141 | 3300005339 | Ga0070660_100003063 | Ga0070660_10000306310 | 296 |
| 142 | 3300005339 | Ga0070660_100007497 | Ga0070660_1000074972 | 296 |
| 143 | 3300005339 | Ga0070660_100090434 | Ga0070660_1000904343 | 296 |
| 144 | 3300005339 | Ga0070660_100319444 | Ga0070660_1003194442 | 296 |
| 145 | 3300005344 | Ga0070661_100026948 | Ga0070661_1000269485 | 296 |
| 146 | 3300005344 | Ga0070661_100095028 | Ga0070661_1000950282 | 296 |
| 147 | 3300005344 | Ga0070661_100107355 | Ga0070661_1001073552 | 296 |
| 148 | 3300005347 | Ga0070668_100000099 | Ga0070668_10000009944 | 296 |
| 149 | 3300005353 | Ga0070669_100005241 | Ga0070669_1000052419 | 296 |
| 150 | 3300005353 | Ga0070669_100075689 | Ga0070669_1000756892 | 296 |
| 151 | 3300005353 | Ga0070669_100118421 | Ga0070669_1001184213 | 296 |
| 152 | 3300005355 | Ga0070671_100008949 | Ga0070671_1000089499 | 296 |
| 153 | 3300005355 | Ga0070671_100039990 | Ga0070671_1000399906 | 296 |
| 154 | 3300005364 | Ga0070673_100000003 | Ga0070673_100000003155 | 296 |
| 155 | 3300005366 | Ga0070659_100000001 | Ga0070659_100000001494 | 296 |
| 156 | 3300005366 | Ga0070659_100093509 | Ga0070659_1000935092 | 296 |
| 157 | 3300005366 | Ga0070659_100247101 | Ga0070659_1002471012 | 296 |
| 158 | 3300005366 | Ga0070659_100456107 | Ga0070659_1004561071 | 296 |
| 159 | 3300005367 | Ga0070667_100000038 | Ga0070667_100000038171 | 296 |
| 160 | 3300005455 | Ga0070663_100001752 | Ga0070663_1000017529 | 296 |
| 161 | 3300005455 | Ga0070663_100077079 | Ga0070663_1000770792 | 296 |
| 162 | 3300005456 | Ga0070678_100002547 | Ga0070678_1000025475 | 296 |
| 163 | 3300005457 | Ga0070662_100040636 | Ga0070662_1000406363 | 296 |
| 164 | 3300005459 | Ga0068867_100000001 | Ga0068867_100000001181 | 296 |
| 165 | 3300005539 | Ga0068853_100000230 | Ga0068853_10000023035 | 296 |
| 166 | 3300005539 | Ga0068853_100097855 | Ga0068853_1000978553 | 296 |
| 167 | 3300005539 | Ga0068853_100268703 | Ga0068853_1002687032 | 296 |
| 168 | 3300005543 | Ga0070672_100045704 | Ga0070672_1000457041 | 296 |
| 169 | 3300005548 | Ga0070665_100000075 | Ga0070665_10000007549 | 296 |
| 170 | 3300005548 | Ga0070665_100006857 | Ga0070665_1000068572 | 296 |
| 171 | 3300005548 | Ga0070665_100015442 | Ga0070665_1000154423 | 296 |
| 172 | 3300005548 | Ga0070665_100094479 | Ga0070665_1000944792 | 296 |
| 173 | 3300005563 | Ga0068855_100000253 | Ga0068855_10000025322 | 296 |
| 174 | 3300005564 | Ga0070664_100218089 | Ga0070664_1002180892 | 296 |
| 175 | 3300005564 | Ga0070664_100443421 | Ga0070664_1004434212 | 296 |
| 176 | 3300005577 | Ga0068857_100048655 | Ga0068857_1000486553 | 296 |
| 177 | 3300005614 | Ga0068856_100018056 | Ga0068856_1000180562 | 296 |
| 178 | 3300005614 | Ga0068856_100028579 | Ga0068856_1000285796 | 296 |
| 179 | 3300005614 | Ga0068856_100509549 | Ga0068856_1005095491 | 296 |
| 180 | 3300005614 | Ga0068856_100536279 | Ga0068856_1005362791 | 296 |
| 181 | 3300005616 | Ga0068852_100218489 | Ga0068852_1002184892 | 296 |
| 182 | 3300005616 | Ga0068852_100288924 | Ga0068852_1002889242 | 296 |
| 183 | 3300005616 | Ga0068852_100605073 | Ga0068852_1006050732 | 296 |
| 184 | 3300005617 | Ga0068859_100228656 | Ga0068859_1002286563 | 296 |
| 185 | 3300005834 | Ga0068851_10011589 | Ga0068851_100115892 | 296 |
| 186 | 3300005841 | Ga0068863_100000255 | Ga0068863_10000025546 | 296 |
| 187 | 3300005843 | Ga0068860_100049956 | Ga0068860_1000499564 | 296 |
| 188 | 3300005844 | Ga0068862_100690384 | Ga0068862_1006903841 | 296 |
| 189 | 3300006042 | Ga0075368_10000134 | Ga0075368_100001349 | 296 |
| 190 | 3300006048 | Ga0075363_100013689 | Ga0075363_1000136892 | 296 |
| 191 | 3300006178 | Ga0075367_10001817 | Ga0075367_1000181710 | 296 |
| 192 | 3300006186 | Ga0075369_10035734 | Ga0075369_100357342 | 296 |
| 193 | 3300006186 | Ga0075369_10055714 | Ga0075369_100557142 | 296 |
| 194 | 3300006881 | Ga0068865_100000011 | Ga0068865_10000001167 | 296 |
| 195 | 3300006931 | Ga0097620_100228649 | Ga0097620_1002286493 | 296 |
| 196 | 3300009093 | Ga0105240_10010869 | Ga0105240_100108697 | 296 |
| 197 | 3300009093 | Ga0105240_10062505 | Ga0105240_100625052 | 296 |
| 198 | 3300009093 | Ga0105240_10256881 | Ga0105240_102568812 | 296 |
| 199 | 3300009093 | Ga0105240_10333654 | Ga0105240_103336542 | 296 |
| 200 | 3300009148 | Ga0105243_10000241 | Ga0105243_1000024113 | 296 |
| 201 | 3300009176 | Ga0105242_10001038 | Ga0105242_100010388 | 296 |
| 202 | 3300009545 | Ga0105237_10057301 | Ga0105237_100573012 | 296 |
| 203 | 3300009551 | Ga0105238_10443384 | Ga0105238_104433841 | 296 |
| 204 | 3300010375 | Ga0105239_10000037 | Ga0105239_100000374 | 296 |
| 205 | 3300010375 | Ga0105239_10318812 | Ga0105239_103188122 | 296 |
| 206 | 3300010375 | Ga0105239_10722964 | Ga0105239_107229641 | 296 |
| 207 | 3300013100 | Ga0157373_10120531 | Ga0157373_101205312 | 296 |
| 208 | 3300013102 | Ga0157371_10081003 | Ga0157371_100810032 | 296 |
| 209 | 3300013104 | Ga0157370_10000008 | Ga0157370_10000008234 | 296 |
| 210 | 3300013104 | Ga0157370_10057631 | Ga0157370_100576315 | 296 |
| 211 | 3300013105 | Ga0157369_10008475 | Ga0157369_1000847510 | 296 |
| 212 | 3300013105 | Ga0157369_10365901 | Ga0157369_103659011 | 296 |
| 213 | 3300013105 | Ga0157369_10456374 | Ga0157369_104563741 | 296 |
| 214 | 3300013296 | Ga0157374_10003756 | Ga0157374_1000375612 | 296 |
| 215 | 3300013306 | Ga0163162_10489713 | Ga0163162_104897132 | 296 |
| 216 | 3300013307 | Ga0157372_10032282 | Ga0157372_100322825 | 296 |
| 217 | 3300013307 | Ga0157372_10090364 | Ga0157372_100903643 | 296 |
| 218 | 3300013307 | Ga0157372_10115473 | Ga0157372_101154734 | 296 |
| 219 | 3300013307 | Ga0157372_10123785 | Ga0157372_101237853 | 296 |
| 220 | 3300013307 | Ga0157372_10163739 | Ga0157372_101637393 | 296 |
| 221 | 3300013307 | Ga0157372_10185007 | Ga0157372_101850073 | 296 |
| 222 | 3300013308 | Ga0157375_10000902 | Ga0157375_1000090212 | 296 |
| 223 | 3300014969 | Ga0157376_10000192 | Ga0157376_1000019230 | 296 |
| 224 | 3300017792 | Ga0163161_10008263 | Ga0163161_100082635 | 296 |
| 225 | 3300025231 | Ga0207427_101279 | Ga0207427_1012799 | 296 |
| 226 | 3300025250 | Ga0209026_1002091 | Ga0209026_10020913 | 296 |
| 227 | 3300025254 | Ga0209148_1000117 | Ga0209148_1000117119 | 296 |
| 228 | 3300025254 | Ga0209148_1004843 | Ga0209148_10048434 | 296 |
| 229 | 3300025261 | Ga0209233_1000079 | Ga0209233_1000079287 | 296 |
| 230 | 3300025321 | Ga0207656_10007667 | Ga0207656_100076676 | 296 |
| 231 | 3300025711 | Ga0207696_1014984 | Ga0207696_10149841 | 296 |
| 232 | 3300025903 | Ga0207680_10005487 | Ga0207680_100054873 | 296 |
| 233 | 3300025904 | Ga0207647_10002429 | Ga0207647_1000242914 | 296 |
| 234 | 3300025904 | Ga0207647_10007383 | Ga0207647_100073833 | 296 |
| 235 | 3300025904 | Ga0207647_10018586 | Ga0207647_100185862 | 296 |
| 236 | 3300025904 | Ga0207647_10081317 | Ga0207647_100813172 | 296 |
| 237 | 3300025907 | Ga0207645_10004800 | Ga0207645_1000480012 | 296 |
| 238 | 3300025909 | Ga0207705_10000144 | Ga0207705_1000014449 | 296 |
| 239 | 3300025909 | Ga0207705_10000250 | Ga0207705_1000025020 | 296 |
| 240 | 3300025909 | Ga0207705_10002097 | Ga0207705_100020978 | 296 |
| 241 | 3300025909 | Ga0207705_10007210 | Ga0207705_100072102 | 296 |
| 242 | 3300025909 | Ga0207705_10174479 | Ga0207705_101744792 | 296 |
| 243 | 3300025911 | Ga0207654_10022885 | Ga0207654_100228853 | 296 |
| 244 | 3300025913 | Ga0207695_10004781 | Ga0207695_100047816 | 296 |
| 245 | 3300025913 | Ga0207695_10032478 | Ga0207695_100324786 | 296 |
| 246 | 3300025913 | Ga0207695_10109914 | Ga0207695_101099142 | 296 |
| 247 | 3300025914 | Ga0207671_10020643 | Ga0207671_100206433 | 296 |
| 248 | 3300025914 | Ga0207671_10352412 | Ga0207671_103524122 | 296 |
| 249 | 3300025919 | Ga0207657_10002199 | Ga0207657_100021995 | 296 |
| 250 | 3300025919 | Ga0207657_10003536 | Ga0207657_100035366 | 296 |
| 251 | 3300025919 | Ga0207657_10003878 | Ga0207657_1000387813 | 296 |
| 252 | 3300025919 | Ga0207657_10009183 | Ga0207657_100091836 | 296 |
| 253 | 3300025919 | Ga0207657_10050794 | Ga0207657_100507942 | 296 |
| 254 | 3300025919 | Ga0207657_10160289 | Ga0207657_101602892 | 296 |
| 255 | 3300025919 | Ga0207657_10174267 | Ga0207657_101742672 | 296 |
| 256 | 3300025919 | Ga0207657_10323734 | Ga0207657_103237341 | 296 |
| 257 | 3300025920 | Ga0207649_10002895 | Ga0207649_1000289510 | 296 |
| 258 | 3300025920 | Ga0207649_10078755 | Ga0207649_100787552 | 296 |
| 259 | 3300025920 | Ga0207649_10118340 | Ga0207649_101183402 | 296 |
| 260 | 3300025923 | Ga0207681_10000913 | Ga0207681_100009133 | 296 |
| 261 | 3300025923 | Ga0207681_10007249 | Ga0207681_100072492 | 296 |
| 262 | 3300025923 | Ga0207681_10065465 | Ga0207681_100654652 | 296 |
| 263 | 3300025923 | Ga0207681_10162404 | Ga0207681_101624041 | 296 |
| 264 | 3300025924 | Ga0207694_10111527 | Ga0207694_101115272 | 296 |
| 265 | 3300025925 | Ga0207650_10108592 | Ga0207650_101085923 | 296 |
| 266 | 3300025927 | Ga0207687_10013636 | Ga0207687_100136362 | 296 |
| 267 | 3300025927 | Ga0207687_10077920 | Ga0207687_100779202 | 296 |
| 268 | 3300025929 | Ga0207664_10366887 | Ga0207664_103668872 | 296 |
| 269 | 3300025931 | Ga0207644_10043239 | Ga0207644_100432393 | 296 |
| 270 | 3300025931 | Ga0207644_10166123 | Ga0207644_101661232 | 296 |
| 271 | 3300025932 | Ga0207690_10000001 | Ga0207690_10000001108 | 296 |
| 272 | 3300025932 | Ga0207690_10000002 | Ga0207690_10000002108 | 296 |
| 273 | 3300025932 | Ga0207690_10000003 | Ga0207690_10000003108 | 296 |
| 274 | 3300025932 | Ga0207690_10000004 | Ga0207690_10000004108 | 296 |
| 275 | 3300025932 | Ga0207690_10044685 | Ga0207690_100446854 | 296 |
| 276 | 3300025932 | Ga0207690_10142101 | Ga0207690_101421012 | 296 |
| 277 | 3300025933 | Ga0207706_10009534 | Ga0207706_100095342 | 296 |
| 278 | 3300025933 | Ga0207706_10023320 | Ga0207706_100233206 | 296 |
| 279 | 3300025933 | Ga0207706_10027933 | Ga0207706_100279333 | 296 |
| 280 | 3300025933 | Ga0207706_10045624 | Ga0207706_100456243 | 296 |
| 281 | 3300025933 | Ga0207706_10143013 | Ga0207706_101430133 | 296 |
| 282 | 3300025933 | Ga0207706_10145084 | Ga0207706_101450842 | 296 |
| 283 | 3300025934 | Ga0207686_10009548 | Ga0207686_100095484 | 296 |
| 284 | 3300025935 | Ga0207709_10000119 | Ga0207709_1000011966 | 296 |
| 285 | 3300025938 | Ga0207704_10000001 | Ga0207704_10000001599 | 296 |
| 286 | 3300025940 | Ga0207691_10065861 | Ga0207691_100658616 | 296 |
| 287 | 3300025942 | Ga0207689_10043717 | Ga0207689_100437176 | 296 |
| 288 | 3300025949 | Ga0207667_10000035 | Ga0207667_10000035269 | 296 |
| 289 | 3300025949 | Ga0207667_10082186 | Ga0207667_100821865 | 296 |
| 290 | 3300025949 | Ga0207667_10376763 | Ga0207667_103767631 | 296 |
| 291 | 3300025960 | Ga0207651_10000002 | Ga0207651_10000002268 | 296 |
| 292 | 3300025960 | Ga0207651_10028103 | Ga0207651_100281032 | 296 |
| 293 | 3300025961 | Ga0207712_10350587 | Ga0207712_103505872 | 296 |
| 294 | 3300025961 | Ga0207712_10391799 | Ga0207712_103917992 | 296 |
| 295 | 3300025972 | Ga0207668_10000420 | Ga0207668_100004203 | 296 |
| 296 | 3300025972 | Ga0207668_10029581 | Ga0207668_100295813 | 296 |
| 297 | 3300025981 | Ga0207640_10104898 | Ga0207640_101048981 | 296 |
| 298 | 3300025986 | Ga0207658_10000029 | Ga0207658_10000029169 | 296 |
| 299 | 3300026023 | Ga0207677_10000042 | Ga0207677_1000004265 | 296 |
| 300 | 3300026023 | Ga0207677_10000110 | Ga0207677_1000011049 | 296 |
| 301 | 3300026035 | Ga0207703_10150829 | Ga0207703_101508292 | 296 |
| 302 | 3300026041 | Ga0207639_10003124 | Ga0207639_100031249 | 296 |
| 303 | 3300026041 | Ga0207639_10003549 | Ga0207639_100035492 | 296 |
| 304 | 3300026041 | Ga0207639_10205020 | Ga0207639_102050202 | 296 |
| 305 | 3300026067 | Ga0207678_10006156 | Ga0207678_100061566 | 296 |
| 306 | 3300026067 | Ga0207678_10104229 | Ga0207678_101042292 | 296 |
| 307 | 3300026067 | Ga0207678_10284092 | Ga0207678_102840922 | 296 |
| 308 | 3300026078 | Ga0207702_10007410 | Ga0207702_100074108 | 296 |
| 309 | 3300026078 | Ga0207702_10016949 | Ga0207702_100169498 | 296 |
| 310 | 3300026078 | Ga0207702_10037062 | Ga0207702_100370624 | 296 |
| 311 | 3300026078 | Ga0207702_10048793 | Ga0207702_100487933 | 296 |
| 312 | 3300026088 | Ga0207641_10000343 | Ga0207641_1000034345 | 296 |
| 313 | 3300026089 | Ga0207648_10000001 | Ga0207648_10000001268 | 296 |
| 314 | 3300026089 | Ga0207648_10003545 | Ga0207648_1000354521 | 296 |
| 315 | 3300026116 | Ga0207674_10011479 | Ga0207674_1001147911 | 296 |
| 316 | 3300026116 | Ga0207674_10021373 | Ga0207674_100213738 | 296 |
| 317 | 3300026116 | Ga0207674_10031213 | Ga0207674_100312135 | 296 |
| 318 | 3300026116 | Ga0207674_10076713 | Ga0207674_100767133 | 296 |
| 319 | 3300026116 | Ga0207674_10149879 | Ga0207674_101498793 | 296 |
| 320 | 3300026121 | Ga0207683_10004102 | Ga0207683_100041027 | 296 |
| 321 | 3300026142 | Ga0207698_10001453 | Ga0207698_1000145312 | 296 |
| 322 | 3300026142 | Ga0207698_10023128 | Ga0207698_100231282 | 296 |
| 323 | 3300026142 | Ga0207698_10196058 | Ga0207698_101960582 | 296 |
| 324 | 3300026142 | Ga0207698_10286087 | Ga0207698_102860872 | 296 |
| 325 | 3300027866 | Ga0209813_10000026 | Ga0209813_1000002650 | 296 |
| 326 | 3300027866 | Ga0209813_10000064 | Ga0209813_1000006438 | 296 |
| 327 | 3300028379 | Ga0268266_10000468 | Ga0268266_100004689 | 296 |
| 328 | 3300028379 | Ga0268266_10006387 | Ga0268266_1000638714 | 296 |
| 329 | 3300028379 | Ga0268266_10012074 | Ga0268266_100120743 | 296 |
| 330 | 3300028379 | Ga0268266_10060943 | Ga0268266_100609432 | 296 |
| 331 | 3300028380 | Ga0268265_10505851 | Ga0268265_105058511 | 296 |
| 332 | 3300028381 | Ga0268264_10025247 | Ga0268264_100252473 | 296 |
| 333 | 3300031507 | Ga0307509_10172605 | Ga0307509_101726052 | 296 |
| 334 | 3300031548 | Ga0307408_100091593 | Ga0307408_1000915932 | 296 |
| 335 | 3300031616 | Ga0307508_10040002 | Ga0307508_100400022 | 296 |
| 336 | 3300031731 | Ga0307405_10015134 | Ga0307405_100151344 | 296 |
| 337 | 3300031731 | Ga0307405_10062290 | Ga0307405_100622903 | 296 |
| 338 | 3300031824 | Ga0307413_10115808 | Ga0307413_101158081 | 296 |
| 339 | 3300031824 | Ga0307413_10161466 | Ga0307413_101614661 | 296 |
| 340 | 3300031824 | Ga0307413_10303983 | Ga0307413_103039832 | 296 |
| 341 | 3300031852 | Ga0307410_10013845 | Ga0307410_100138455 | 296 |
| 342 | 3300031852 | Ga0307410_10023336 | Ga0307410_100233362 | 296 |
| 343 | 3300031852 | Ga0307410_10233865 | Ga0307410_102338652 | 296 |
| 344 | 3300031852 | Ga0307410_10308985 | Ga0307410_103089851 | 296 |
| 345 | 3300031901 | Ga0307406_10165676 | Ga0307406_101656762 | 296 |
| 346 | 3300031901 | Ga0307406_10333606 | Ga0307406_103336062 | 296 |
| 347 | 3300031911 | Ga0307412_10001551 | Ga0307412_100015516 | 296 |
| 348 | 3300031911 | Ga0307412_10014206 | Ga0307412_100142061 | 296 |
| 349 | 3300031995 | Ga0307409_100152528 | Ga0307409_1001525281 | 296 |
| 350 | 3300031995 | Ga0307409_100161233 | Ga0307409_1001612331 | 296 |
| 351 | 3300031995 | Ga0307409_100298106 | Ga0307409_1002981062 | 296 |
| 352 | 3300032002 | Ga0307416_100035887 | Ga0307416_1000358872 | 296 |
| 353 | 3300032002 | Ga0307416_100040957 | Ga0307416_1000409573 | 296 |
| 354 | 3300032002 | Ga0307416_100083007 | Ga0307416_1000830073 | 296 |
| 355 | 3300032004 | Ga0307414_10000486 | Ga0307414_100004867 | 296 |
| 356 | 3300032004 | Ga0307414_10000936 | Ga0307414_100009362 | 296 |
| 357 | 3300032004 | Ga0307414_10005912 | Ga0307414_100059126 | 296 |
| 358 | 3300032004 | Ga0307414_10041989 | Ga0307414_100419892 | 296 |
| 359 | 3300032004 | Ga0307414_10043111 | Ga0307414_100431112 | 296 |
| 360 | 3300032004 | Ga0307414_10082760 | Ga0307414_100827602 | 296 |
| 361 | 3300032004 | Ga0307414_10125697 | Ga0307414_101256972 | 296 |
| 362 | 3300032004 | Ga0307414_10165607 | Ga0307414_101656072 | 296 |
| 363 | 3300032004 | Ga0307414_10301181 | Ga0307414_103011812 | 296 |
| 364 | 3300032126 | Ga0307415_100123043 | Ga0307415_1001230432 | 296 |
| 365 | 3300032133 | Ga0316583_10000596 | Ga0316583_100005965 | 296 |
| 366 | 3300036647 | Ga0316582_0009794 | Ga0316582_0009794_3519_4427 | 296 |
| 367 | 3300036712 | Ga0316584_0068361 | Ga0316584_0068361_1589_2497 | 296 |
| 368 | 3300036712 | Ga0316584_0123969 | Ga0316584_0123969_371_1279 | 296 |
| 369 | 3300037312 | Ga0395899_0002220 | Ga0395899_0002220_4743_5648 | 296 |
| 370 | 3300037312 | Ga0395899_0311155 | Ga0395899_0311155_120_1037 | 296 |
| 371 | 3300037418 | Ga0395900_0199287 | Ga0395900_0199287_631_1536 | 296 |
| 372 | 3300037466 | Ga0395898_0121798 | Ga0395898_0121798_217_1134 | 296 |
| 373 | 3300037471 | Ga0395905_0342048 | Ga0395905_0342048_201_1118 | 296 |
| 374 | 3300038443 | Ga0395901_0128974 | Ga0395901_0128974_388_1305 | 296 |
| 375 | 3300038443 | Ga0395901_0367728 | Ga0395901_0367728_134_1039 | 296 |
| 376 | 3300042005 | Ga0439448_0000458 | Ga0439448_0000458_7214_8119 | 296 |
| 377 | 3300042005 | Ga0439448_0006784 | Ga0439448_0006784_591_1496 | 296 |
| 378 | 3300042012 | Ga0439455_0000272 | Ga0439455_0000272_1400_2305 | 296 |
| 379 | 3300042157 | Ga0439458_0000004 | Ga0439458_0000004_26216_27121 | 296 |
| 380 | 3300042157 | Ga0439458_0000749 | Ga0439458_0000749_5608_6513 | 296 |
| 381 | 3300044683 | Ga0466965_0169615 | Ga0466965_0169615_69_974 | 296 |
| 382 | 3300044694 | Ga0466963_0000856 | Ga0466963_0000856_3001_3906 | 296 |
| 383 | 3300044694 | Ga0466963_0043630 | Ga0466963_0043630_1320_2225 | 296 |
| 384 | 3300044706 | Ga0466964_0027352 | Ga0466964_0027352_35_940 | 296 |
| 385 | 3300044712 | Ga0453684_0355292 | Ga0453684_0355292_362_1267 | 296 |
| 386 | 3300044719 | Ga0466971_0017093 | Ga0466971_0017093_1173_2078 | 296 |
| 387 | 3300044765 | Ga0466970_0018389 | Ga0466970_0018389_1812_2717 | 296 |
| 388 | 3300044842 | Ga0466957_0042948 | Ga0466957_0042948_582_1487 | 296 |
| 389 | 3300044842 | Ga0466957_0284079 | Ga0466957_0284079_147_1052 | 296 |
| 390 | 3300044842 | Ga0466957_0303117 | Ga0466957_0303117_141_1058 | 296 |
| 391 | 3300045051 | Ga0451576_0000007 | Ga0451576_0000007_762508_763398 | 296 |
| 392 | 3300045051 | Ga0451576_0355575 | Ga0451576_0355575_418_1323 | 296 |
| 393 | 3300045836 | Ga0466958_0000484 | Ga0466958_0000484_5820_6725 | 296 |
| 394 | 3300046453 | Ga0495627_050423 | Ga0495627_050423_98_1006 | 296 |
| 395 | 3300046460 | Ga0495638_0000016 | Ga0495638_0000016_349118_350038 | 296 |
| 396 | 3300046471 | Ga0495650_0006895 | Ga0495650_0006895_370_1278 | 296 |
| 397 | 3300046491 | Ga0495584_0016538 | Ga0495584_0016538_931_1839 | 296 |
| 398 | 3300046506 | Ga0495583_0000094 | Ga0495583_0000094_104669_105589 | 296 |
| 399 | 3300046507 | Ga0495606_0003328 | Ga0495606_0003328_6072_7016 | 296 |
| 400 | 3300046507 | Ga0495606_0032322 | Ga0495606_0032322_1505_2437 | 296 |
| 401 | 3300046512 | Ga0495610_0000068 | Ga0495610_0000068_91497_92405 | 296 |
| 402 | 3300046513 | Ga0495616_0000187 | Ga0495616_0000187_33250_34164 | 296 |
| 403 | 3300046519 | Ga0495632_0000007 | Ga0495632_0000007_39800_40708 | 296 |
| 404 | 3300046519 | Ga0495632_0000132 | Ga0495632_0000132_44361_45281 | 296 |
| 405 | 3300046520 | Ga0495637_0001444 | Ga0495637_0001444_1073_1981 | 296 |
| 406 | 3300046520 | Ga0495637_0028044 | Ga0495637_0028044_768_1676 | 296 |
| 407 | 3300046522 | Ga0495643_0000005 | Ga0495643_0000005_126675_127583 | 296 |
| 408 | 3300046524 | Ga0495648_0000013 | Ga0495648_0000013_46468_47388 | 296 |
| 409 | 3300046524 | Ga0495648_0005335 | Ga0495648_0005335_7648_8556 | 296 |
| 410 | 3300046524 | Ga0495648_0147619 | Ga0495648_0147619_187_1119 | 296 |
| 411 | 3300046525 | Ga0495663_0000005 | Ga0495663_0000005_38819_39727 | 296 |
| 412 | 3300046525 | Ga0495663_0004691 | Ga0495663_0004691_1249_2172 | 296 |
| 413 | 3300046539 | Ga0495621_0000114 | Ga0495621_0000114_9153_10070 | 296 |
| 414 | 3300046558 | Ga0495633_0000550 | Ga0495633_0000550_13324_14256 | 296 |
| 415 | 3300046558 | Ga0495633_0003251 | Ga0495633_0003251_3718_4626 | 296 |
| 416 | 3300046558 | Ga0495633_0075134 | Ga0495633_0075134_76_984 | 296 |
| 417 | 3300046616 | Ga0495668_0006493 | Ga0495668_0006493_4241_5155 | 296 |
| 418 | 3300046660 | Ga0495625_0153119 | Ga0495625_0153119_79_987 | 296 |
| 419 | 3300046684 | Ga0495669_0036416 | Ga0495669_0036416_629_1555 | 296 |
| 420 | 3300046692 | Ga0495671_0000007 | Ga0495671_0000007_126675_127583 | 296 |
| 421 | 3300046692 | Ga0495671_0000018 | Ga0495671_0000018_47957_48877 | 296 |
| 422 | 3300046694 | Ga0495649_0038408 | Ga0495649_0038408_613_1518 | 296 |
| 423 | 3300046810 | Ga0495660_0086531 | Ga0495660_0086531_402_1310 | 296 |
| 424 | 3300047469 | Ga0495673_0000029 | Ga0495673_0000029_412237_413157 | 296 |
| 425 | 3300047470 | Ga0495681_0000055 | Ga0495681_0000055_51341_52249 | 296 |
| 426 | 3300047470 | Ga0495681_0021318 | Ga0495681_0021318_1486_2394 | 296 |
| 427 | 3300047472 | Ga0495686_0000149 | Ga0495686_0000149_16752_17684 | 296 |
| 428 | 3300048903 | Ga0496100_0064217 | Ga0496100_0064217_990_1895 | 296 |
| 429 | 3300048905 | Ga0496102_0001063 | Ga0496102_0001063_1344_2249 | 296 |
| 430 | 3300048906 | Ga0496103_0000195 | Ga0496103_0000195_15451_16356 | 296 |
| 431 | 3300048907 | Ga0496104_0001584 | Ga0496104_0001584_3370_4275 | 296 |
| 432 | 3300048911 | Ga0496108_0001477 | Ga0496108_0001477_2695_3585 | 296 |
| 433 | 3300048913 | Ga0496110_0072683 | Ga0496110_0072683_633_1538 | 296 |
| 434 | 3300048913 | Ga0496110_0132503 | Ga0496110_0132503_1081_1974 | 296 |
| 435 | 3300048914 | Ga0496111_0241371 | Ga0496111_0241371_435_1328 | 296 |
| 436 | 3300048915 | Ga0496112_0256132 | Ga0496112_0256132_56_961 | 296 |
| 437 | 3300048916 | Ga0496113_0007041 | Ga0496113_0007041_1005_1910 | 296 |
| 438 | 3300048919 | Ga0496116_0031777 | Ga0496116_0031777_761_1669 | 296 |
| 439 | 3300048919 | Ga0496116_0162943 | Ga0496116_0162943_142_1032 | 296 |
| 440 | 3300048919 | Ga0496116_0217906 | Ga0496116_0217906_29_934 | 296 |
| 441 | 3300048920 | Ga0496117_0004618 | Ga0496117_0004618_9812_10717 | 296 |
| 442 | 3300048920 | Ga0496117_0011777 | Ga0496117_0011777_2065_2973 | 296 |
| 443 | 3300048921 | Ga0496118_0027922 | Ga0496118_0027922_1241_2146 | 296 |
| 444 | 3300048921 | Ga0496118_0033827 | Ga0496118_0033827_2580_3485 | 296 |
| 445 | 3300048921 | Ga0496118_0078874 | Ga0496118_0078874_1227_2132 | 296 |
| 446 | 3300048922 | Ga0496119_0016791 | Ga0496119_0016791_4502_5407 | 296 |
| 447 | 3300048923 | Ga0496120_0001380 | Ga0496120_0001380_15271_16176 | 296 |
| 448 | 3300048924 | Ga0496121_0000066 | Ga0496121_0000066_198044_198949 | 296 |
| 449 | 3300048924 | Ga0496121_0035155 | Ga0496121_0035155_553_1458 | 296 |
| 450 | 3300048924 | Ga0496121_0295930 | Ga0496121_0295930_48_953 | 296 |
| 451 | 3300048924 | Ga0496121_0295938 | Ga0496121_0295938_48_953 | 296 |
| 452 | 3300048925 | Ga0496122_0002027 | Ga0496122_0002027_12778_13683 | 296 |
| 453 | 3300048925 | Ga0496122_0040350 | Ga0496122_0040350_1344_2249 | 296 |
| 454 | 3300048925 | Ga0496122_0049641 | Ga0496122_0049641_1482_2387 | 296 |
| 455 | 3300048925 | Ga0496122_0107870 | Ga0496122_0107870_377_1282 | 296 |
| 456 | 3300048926 | Ga0496123_0007923 | Ga0496123_0007923_4987_5892 | 296 |
| 457 | 3300048926 | Ga0496123_0039220 | Ga0496123_0039220_932_1837 | 296 |
| 458 | 3300048926 | Ga0496123_0042462 | Ga0496123_0042462_2185_3090 | 296 |
| 459 | 3300048927 | Ga0496124_0046079 | Ga0496124_0046079_1815_2723 | 296 |
| 460 | 3300048928 | Ga0496125_0032182 | Ga0496125_0032182_1962_2855 | 296 |
| 461 | 3300048928 | Ga0496125_0046579 | Ga0496125_0046579_546_1451 | 296 |
| 462 | 3300048928 | Ga0496125_0123691 | Ga0496125_0123691_377_1282 | 296 |
| 463 | 3300048928 | Ga0496125_0170720 | Ga0496125_0170720_132_1022 | 296 |
| 464 | 3300048929 | Ga0496126_0000476 | Ga0496126_0000476_63299_64204 | 296 |
| 465 | 3300048929 | Ga0496126_0003014 | Ga0496126_0003014_13048_13953 | 296 |
| 466 | 3300048929 | Ga0496126_0033991 | Ga0496126_0033991_465_1376 | 296 |
| 467 | 3300048929 | Ga0496126_0110561 | Ga0496126_0110561_642_1532 | 296 |
| 468 | 3300048929 | Ga0496126_0115490 | Ga0496126_0115490_1007_1912 | 296 |
| 469 | 3300048929 | Ga0496126_0232396 | Ga0496126_0232396_597_1502 | 296 |
| 470 | 3300049571 | Ga0501034_0049747 | Ga0501034_0049747_2374_3282 | 296 |
| 471 | 3300049573 | Ga0501037_0259443 | Ga0501037_0259443_59_964 | 296 |
| 472 | 3300049574 | Ga0501038_0013511 | Ga0501038_0013511_5710_6615 | 296 |
| 473 | 3300049663 | Ga0501223_002201 | Ga0501223_002201_1481_2389 | 296 |
| 474 | 3300049664 | Ga0501224_000020 | Ga0501224_000020_5788_6696 | 296 |
| 475 | 3300049668 | Ga0501233_001289 | Ga0501233_001289_2080_2988 | 296 |
| 476 | 3300049669 | Ga0501235_022309 | Ga0501235_022309_42_950 | 296 |
| 477 | 3300049669 | Ga0501235_025515 | Ga0501235_025515_95_1003 | 296 |
| 478 | 3300049684 | Ga0501255_002563 | Ga0501255_002563_216_1124 | 296 |
| 479 | 3300049705 | Ga0501225_0000009 | Ga0501225_0000009_48218_49126 | 296 |
| 480 | 3300049707 | Ga0501234_001287 | Ga0501234_001287_1725_2633 | 296 |
| 481 | 3300049853 | Ga0501226_000136 | Ga0501226_000136_11284_12192 | 296 |
| 482 | 3300050489 | nmdc:mga03683_14295_c1 | nmdc:mga03683_14295_c1_1279_2184 | 296 |
| 483 | 3300050490 | nmdc:mga03n38_28530_c1 | nmdc:mga03n38_28530_c1_672_1577 | 296 |
| 484 | 3300050491 | nmdc:mga00v17_69844_c1 | nmdc:mga00v17_69844_c1_1232_2137 | 296 |
| 485 | 3300050492 | nmdc:mga0yw44_159984_c1 | nmdc:mga0yw44_159984_c1_139_1044 | 296 |
| 486 | 3300050493 | nmdc:mga0k408_1951_c1 | nmdc:mga0k408_1951_c1_3887_4792 | 296 |
| 487 | 3300050493 | nmdc:mga0k408_79352_c1 | nmdc:mga0k408_79352_c1_618_1523 | 296 |
| 488 | 3300050494 | nmdc:mga06z11_1082_c1 | nmdc:mga06z11_1082_c1_8366_9271 | 296 |
| 489 | 3300050494 | nmdc:mga06z11_19_c1 | nmdc:mga06z11_19_c1_60631_61524 | 296 |
| 490 | 3300050495 | nmdc:mga04h51_1318_c1 | nmdc:mga04h51_1318_c1_369_1274 | 296 |
| 491 | 3300050495 | nmdc:mga04h51_14_c1 | nmdc:mga04h51_14_c1_22838_23731 | 296 |
| 492 | 3300050496 | nmdc:mga07m45_27326_c1 | nmdc:mga07m45_27326_c1_1850_2755 | 296 |
| 493 | 3300050496 | nmdc:mga07m45_55_c1 | nmdc:mga07m45_55_c1_31287_32192 | 296 |
| 494 | 3300050507 | nmdc:mga05p37_709579_c1 | nmdc:mga05p37_709579_c1_53_961 | 296 |
| 495 | 3300050516 | nmdc:mga0sz30_8620_c1 | nmdc:mga0sz30_8620_c1_431_1336 | 296 |
| 496 | 3300053087 | Ga0500643_000488 | Ga0500643_000488_5362_6270 | 296 |
| 497 | 3300053088 | Ga0500644_0028983 | Ga0500644_0028983_653_1573 | 296 |
| 498 | 3300053119 | Ga0500595_009072 | Ga0500595_009072_2557_3462 | 296 |
| 499 | 3300053121 | Ga0500607_001592 | Ga0500607_001592_8941_9846 | 296 |
| 500 | 3300053122 | Ga0500608_000755 | Ga0500608_000755_2140_3045 | 296 |
| 501 | 3300053136 | Ga0500559_0000841 | Ga0500559_0000841_17063_17971 | 296 |
| 502 | 3300053136 | Ga0500559_0015561 | Ga0500559_0015561_334_1239 | 296 |
| 503 | 3300053138 | Ga0500564_044774 | Ga0500564_044774_1038_1943 | 296 |
| 504 | 3300053139 | Ga0500568_0000708 | Ga0500568_0000708_20356_21261 | 296 |
| 505 | 3300053151 | Ga0500604_0000004 | Ga0500604_0000004_101967_102872 | 296 |
| 506 | 3300053153 | Ga0500616_0000195 | Ga0500616_0000195_35807_36712 | 296 |
| 507 | 3300053156 | Ga0500622_0000145 | Ga0500622_0000145_35922_36827 | 296 |
| 508 | 3300053157 | Ga0500624_000042 | Ga0500624_000042_56490_57398 | 296 |
| 509 | 3300053158 | Ga0500627_0002094 | Ga0500627_0002094_1581_2495 | 296 |
| 510 | 3300053723 | Ga0500567_000039 | Ga0500567_000039_20960_21865 | 296 |
| 511 | 3300053729 | Ga0500625_000021 | Ga0500625_000021_45347_46252 | 296 |
| 512 | 3300053730 | Ga0500645_004302 | Ga0500645_004302_3593_4531 | 296 |
| 513 | 3300055283 | Ga0500661_000036 | Ga0500661_000036_14358_15266 | 296 |
| 514 | iso_pu_bacteria | 2512564014 | 2512643761 | 296 |
| 515 | iso_pu_bacteria | 2738541275 | 2738711557 | 296 |
| 516 | iso_pu_bacteria | 2738541301 | 2738849982 | 296 |
| 517 | iso_pu_bacteria | 2738541304 | 2738865711 | 296 |
| 518 | iso_pu_bacteria | 2738543022 | 2739298229 | 296 |
| 519 | iso_pu_bacteria | 2738543033 | 2739359907 | 296 |
| 520 | iso_pu_bacteria | 2739367664 | 2739649121 | 296 |
| 521 | iso_pu_bacteria | 2739367865 | 2740027594 | 296 |
| 522 | iso_pu_bacteria | 2775507255 | 2778124694 | 296 |
| 523 | iso_pu_bacteria | 2895880812 | 2895884251 | 296 |
| 524 | iso_pu_bacteria | 2896184354 | 2896187225 | 296 |
| 525 | iso_pu_bacteria | 2928100450 | 2928104175 | 296 |
| 526 | iso_pu_bacteria | 3000865235 | 3000866320 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uai-assembly1.cif.gz_A | crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa | 0.9291 | 2 | 296 |
| 5uai-assembly1.cif.gz_A | crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa | 0.9232 | 2 | 296 |
| 2fmt-assembly2.cif.gz_B | methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet | 0.921 | 2 | 296 |
| 4iqf-assembly2.cif.gz_B | crystal structure of methyionyl-trna formyltransferase from bacillus anthracis | 0.9174 | 1 | 295 |
| 2fmt-assembly2.cif.gz_B | methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet | 0.9151 | 2 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WND3_1_310_3.40.50.12230 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9382 | 2 | 286 | 3.40.50.12230 |
| 5uaiB02 | Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain | 0.9251 | 198 | 294 | 3.10.25.10 |
| 3tqqA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9227 | 2 | 197 | 3.40.50.170 |
| 3q0iA02 | Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain | 0.9162 | 198 | 294 | 3.10.25.10 |
| af_B4FRN6_28_246_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9147 | 1 | 197 | 3.40.50.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B0SIC4-F1-model_v4 | Methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.9732 | 195 | 296 |
GO:0004479
|
| AF-A0A1H9TCB6-F1-model_v4 | Methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.969 | 1 | 296 |
GO:0004479
GO:0005829 |
| AF-A0A1H9TCB6-F1-model_v4 | Methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.9657 | 1 | 296 |
GO:0004479
GO:0005829 |
| AF-A0A3D0WA23-F1-model_v4 | Methionyl-tRNA formyltransferase | 0.965 | 104 | 296 |
GO:0004479
GO:0005829 |
| AF-A0A8A8PN39-F1-model_v4 | deleted | 0.9582 | 195 | 296 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar