F459429

General Info

Members Datasets Scaffolds Average Seq Length
526 267 509 302

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10208303|Ga0307406_102083032
Length 300
Sequence MRIIFMGSPEFAVPTLDALVAAGHEVVAAYTQPPRPAGRGKAERPTAVEVRARALGIEVRCPRSLKGAEEQAAFAALGADVAVVAAYGLILPQAVLDAPAHGCLNVHASLLPRWRGAAPVQRAIMAGDQVTGVTIMAMEAGLDTGPMVARREVPIGDKNAAQVTAELAEVGAALTVETLASGVFDGEPQPDAGATYAAKISKAEARIDWTRSAAEVVRQVQGLAPFPGAWLEVADERIKLLAAEAVDASAAAGAVIDDRLTIACGEQAIRPSLLQRAGHKALPLDEFLRGFAIPAGTLLA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
4 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
5 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
6 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
7 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
8 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
9 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
10 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
11 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
12 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
13 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
14 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
15 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
16 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
17 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
18 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
19 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
20 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
27 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
28 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
170 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
194 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
203 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
230 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
231 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
232 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
233 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
234 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
235 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
236 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
237 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
238 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
239 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
242 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
250 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
251 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
252 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
253 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
254 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
255 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
256 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
257 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
263 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
264 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
265 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 0
Isolates 3.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.56
Nodule 0
Rhizoplane 1.9
Rhizosphere 80.99
Stem 0
Stem Tuber 0.19
Unclassified 8.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_261670 2162886007 Bacteria 4460
2 JGI24736J21556_1001780 3300001904 Bacteria 3879
3 JGI24741J21665_1001479 3300001915 Bacteria 6703
4 JGI24740J21852_10006372 3300001979 Bacteria 4894
5 JGI24740J21852_10031551 3300001979 Bacteria 1707
6 JGI24739J22299_10002342 3300001989 Bacteria 7300
7 JGI24739J22299_10009438 3300001989 Bacteria 3635
8 JGI24739J22299_10009524 3300001989 Bacteria 3618
9 JGI24739J22299_10016224 3300001989 Bacteria 2697
10 JGI24737J22298_10010222 3300001990 Bacteria 3102
11 JGI24737J22298_10032405 3300001990 Bacteria 1627
12 JGI24735J21928_10002006 3300002067 Bacteria 7156
13 JGI24735J21928_10003706 3300002067 Bacteria 5183
14 JGI24735J21928_10003754 3300002067 Bacteria 5151
15 JGI24735J21928_10005739 3300002067 Bacteria 4104
16 JGI24735J21928_10006435 3300002067 Bacteria 3865
17 JGI24735J21928_10008583 3300002067 Bacteria 3299
18 JGI24735J21928_10022219 3300002067 Bacteria 1933
19 JGI24735J21928_10050663 3300002067 Bacteria 1199
20 JGI24738J21930_10001216 3300002075 Bacteria 7228
21 JGI24738J21930_10001900 3300002075 Bacteria 5644
22 JGI24738J21930_10004560 3300002075 Bacteria 3383
23 JGI24744J21845_10000581 3300002077 Bacteria 6562
24 JGI25165J46597_1000216 3300003214 Bacteria 81261
25 Ga0055542_1009686 3300003762 Bacteria 1803
26 Ga0065704_10009711 3300005289 Bacteria 3283
27 Ga0065715_10007256 3300005293 Bacteria 2697
28 Ga0065715_10177317 3300005293 Bacteria 1501
29 Ga0070658_10000225 3300005327 Bacteria 50444
30 Ga0070658_10003675 3300005327 Bacteria 12560
31 Ga0070658_10010960 3300005327 Bacteria 7266
32 Ga0070658_10087868 3300005327 Bacteria 2559
33 Ga0070658_10099154 3300005327 Bacteria 2407
34 Ga0070676_10003004 3300005328 Bacteria 8723
35 Ga0070676_10003595 3300005328 Bacteria 8103
36 Ga0070670_100004123 3300005331 Bacteria 12146
37 Ga0070670_100010504 3300005331 Bacteria 7903
38 Ga0070677_10020285 3300005333 Bacteria 2419
39 Ga0068869_100031385 3300005334 Bacteria 3737
40 Ga0068869_100295187 3300005334 Bacteria 1307
41 Ga0070666_10008340 3300005335 Bacteria 6427
42 Ga0070660_100000480 3300005339 Bacteria 26717
43 Ga0070660_100003063 3300005339 Bacteria 11487
44 Ga0070660_100007497 3300005339 Bacteria 7606
45 Ga0070660_100090434 3300005339 Bacteria 2413
46 Ga0070660_100319444 3300005339 Bacteria 1275
47 Ga0070661_100026948 3300005344 Bacteria 4137
48 Ga0070661_100095028 3300005344 Bacteria 2210
49 Ga0070661_100107355 3300005344 Bacteria 2082
50 Ga0070661_100142822 3300005344 Bacteria 1805
51 Ga0070692_10001570 3300005345 Bacteria 8386
52 Ga0070668_100000099 3300005347 Bacteria 52778
53 Ga0070668_100232046 3300005347 Bacteria 1526
54 Ga0070669_100001566 3300005353 Bacteria 16566
55 Ga0070669_100005241 3300005353 Bacteria 9364
56 Ga0070669_100075689 3300005353 Bacteria 2497
57 Ga0070669_100112579 3300005353 Bacteria 2067
58 Ga0070669_100118421 3300005353 Bacteria 2017
59 Ga0070675_100070745 3300005354 Bacteria 2892
60 Ga0070671_100008949 3300005355 Bacteria 8034
61 Ga0070671_100039990 3300005355 Bacteria 3893
62 Ga0070674_100108335 3300005356 Bacteria 2036
63 Ga0070673_100000003 3300005364 Bacteria 216759
64 Ga0070659_100000001 3300005366 Bacteria 576390
65 Ga0070659_100093509 3300005366 Bacteria 2413
66 Ga0070659_100114515 3300005366 Bacteria 2179
67 Ga0070659_100247101 3300005366 Bacteria 1478
68 Ga0070659_100456107 3300005366 Bacteria 1085
69 Ga0070667_100000038 3300005367 Bacteria 171914
70 Ga0070667_100244711 3300005367 Bacteria 1602
71 Ga0070663_100001752 3300005455 Bacteria 12072
72 Ga0070663_100077079 3300005455 Bacteria 2439
73 Ga0070663_100080923 3300005455 Bacteria 2386
74 Ga0070663_100082667 3300005455 Bacteria 2363
75 Ga0070678_100002547 3300005456 Bacteria 10000
76 Ga0070678_100010112 3300005456 Bacteria 5745
77 Ga0070662_100040636 3300005457 Bacteria 3313
78 Ga0068867_100000001 3300005459 Bacteria 427563
79 Ga0068853_100000230 3300005539 Bacteria 39593
80 Ga0068853_100081996 3300005539 Bacteria 2825
81 Ga0068853_100097855 3300005539 Bacteria 2591
82 Ga0068853_100268703 3300005539 Bacteria 1570
83 Ga0070672_100045704 3300005543 Bacteria 3389
84 Ga0070665_100000075 3300005548 Bacteria 189496
85 Ga0070665_100006857 3300005548 Bacteria 11581
86 Ga0070665_100015442 3300005548 Bacteria 7670
87 Ga0070665_100094479 3300005548 Bacteria 2995
88 Ga0068855_100000253 3300005563 Bacteria 67247
89 Ga0068855_100190786 3300005563 Bacteria 2312
90 Ga0070664_100218089 3300005564 Bacteria 1706
91 Ga0070664_100443421 3300005564 Bacteria 1191
92 Ga0068857_100048655 3300005577 Bacteria 3763
93 Ga0068854_100002258 3300005578 Bacteria 11855
94 Ga0068854_100022168 3300005578 Bacteria 4322
95 Ga0068854_100100971 3300005578 Bacteria 2163
96 Ga0068856_100018056 3300005614 Bacteria 6840
97 Ga0068856_100028579 3300005614 Bacteria 5445
98 Ga0068856_100509549 3300005614 Bacteria 1224
99 Ga0068856_100536279 3300005614 Bacteria 1191
100 Ga0068852_100218489 3300005616 Bacteria 1811
101 Ga0068852_100288924 3300005616 Bacteria 1583
102 Ga0068852_100441988 3300005616 Bacteria 1286
103 Ga0068852_100605073 3300005616 Bacteria 1100
104 Ga0068859_100011965 3300005617 Bacteria 8715
105 Ga0068859_100228656 3300005617 Bacteria 1948
106 Ga0068851_10011589 3300005834 Bacteria 4137
107 Ga0068870_10234958 3300005840 Bacteria 1129
108 Ga0068863_100000255 3300005841 Bacteria 55911
109 Ga0068860_100049956 3300005843 Bacteria 3983
110 Ga0068862_100132541 3300005844 Bacteria 2205
111 Ga0068862_100690384 3300005844 Bacteria 988
112 Ga0075368_10000134 3300006042 Bacteria 19630
113 Ga0075363_100013689 3300006048 Bacteria 3943
114 Ga0075367_10001817 3300006178 Bacteria 9398
115 Ga0075369_10035734 3300006186 Bacteria 2113
116 Ga0075369_10055714 3300006186 Bacteria 1718
117 Ga0097621_100018847 3300006237 Bacteria 5283
118 Ga0068865_100000011 3300006881 Bacteria 154581
119 Ga0097620_100011965 3300006931 Bacteria 8715
120 Ga0097620_100228649 3300006931 Bacteria 1948
121 Ga0105240_10010869 3300009093 Bacteria 12751
122 Ga0105240_10062505 3300009093 Bacteria 4636
123 Ga0105240_10256881 3300009093 Bacteria 2018
124 Ga0105240_10333654 3300009093 Bacteria 1725
125 Ga0105243_10000241 3300009148 Bacteria 62487
126 Ga0105243_10593154 3300009148 Bacteria 1065
127 Ga0105242_10001038 3300009176 Bacteria 21821
128 Ga0105237_10057301 3300009545 Bacteria 3900
129 Ga0105238_10443384 3300009551 Bacteria 1295
130 Ga0105249_10065937 3300009553 Bacteria 3332
131 Ga0105239_10000037 3300010375 Bacteria 206779
132 Ga0105239_10318812 3300010375 Bacteria 1752
133 Ga0105239_10722964 3300010375 Bacteria 1139
134 Ga0157373_10120531 3300013100 Bacteria 1844
135 Ga0157371_10081003 3300013102 Bacteria 2299
136 Ga0157370_10000008 3300013104 Bacteria 240668
137 Ga0157370_10057631 3300013104 Bacteria 3693
138 Ga0157369_10008475 3300013105 Bacteria 11790
139 Ga0157369_10365901 3300013105 Bacteria 1497
140 Ga0157369_10456374 3300013105 Bacteria 1323
141 Ga0157374_10003756 3300013296 Bacteria 12761
142 Ga0157374_10014340 3300013296 Bacteria 6935
143 Ga0163162_10489713 3300013306 Bacteria 1361
144 Ga0157372_10032282 3300013307 Bacteria 5740
145 Ga0157372_10090364 3300013307 Bacteria 3481
146 Ga0157372_10115473 3300013307 Bacteria 3078
147 Ga0157372_10123785 3300013307 Bacteria 2972
148 Ga0157372_10134257 3300013307 Bacteria 2849
149 Ga0157372_10163739 3300013307 Bacteria 2571
150 Ga0157372_10185007 3300013307 Bacteria 2412
151 Ga0157375_10000902 3300013308 Bacteria 25835
152 Ga0157380_10336861 3300014326 Bacteria 1405
153 Ga0157376_10000192 3300014969 Bacteria 42285
154 Ga0163161_10008263 3300017792 Bacteria 7200
155 Ga0207427_101279 3300025231 Bacteria 9572
156 Ga0209026_1002091 3300025250 Bacteria 7853
157 Ga0209148_1000117 3300025254 Bacteria 188938
158 Ga0209148_1004843 3300025254 Bacteria 3205
159 Ga0209233_1000079 3300025261 Bacteria 346944
160 Ga0207697_10000801 3300025315 Bacteria 17856
161 Ga0207656_10007667 3300025321 Bacteria 3943
162 Ga0207696_1014984 3300025711 Bacteria 2640
163 Ga0207682_10001885 3300025893 Bacteria 9542
164 Ga0207688_10077798 3300025901 Bacteria 1891
165 Ga0207680_10005487 3300025903 Bacteria 6064
166 Ga0207647_10002429 3300025904 Bacteria 14133
167 Ga0207647_10007383 3300025904 Bacteria 7948
168 Ga0207647_10018586 3300025904 Bacteria 4696
169 Ga0207647_10081317 3300025904 Bacteria 1941
170 Ga0207645_10001754 3300025907 Bacteria 17601
171 Ga0207645_10004800 3300025907 Bacteria 9940
172 Ga0207643_10130918 3300025908 Bacteria 1493
173 Ga0207705_10000144 3300025909 Bacteria 76661
174 Ga0207705_10000250 3300025909 Bacteria 52558
175 Ga0207705_10002097 3300025909 Bacteria 15501
176 Ga0207705_10007210 3300025909 Bacteria 8187
177 Ga0207705_10174479 3300025909 Bacteria 1620
178 Ga0207654_10022885 3300025911 Bacteria 3340
179 Ga0207695_10004781 3300025913 Bacteria 18319
180 Ga0207695_10032478 3300025913 Bacteria 5711
181 Ga0207695_10109914 3300025913 Bacteria 2737
182 Ga0207671_10020643 3300025914 Bacteria 5010
183 Ga0207671_10352412 3300025914 Bacteria 1167
184 Ga0207657_10002199 3300025919 Bacteria 21137
185 Ga0207657_10003536 3300025919 Bacteria 16692
186 Ga0207657_10003878 3300025919 Bacteria 15869
187 Ga0207657_10009183 3300025919 Bacteria 9970
188 Ga0207657_10050794 3300025919 Bacteria 3606
189 Ga0207657_10160289 3300025919 Bacteria 1828
190 Ga0207657_10174267 3300025919 Bacteria 1742
191 Ga0207657_10323734 3300025919 Bacteria 1218
192 Ga0207649_10002895 3300025920 Bacteria 9443
193 Ga0207649_10078755 3300025920 Bacteria 2127
194 Ga0207649_10118340 3300025920 Bacteria 1782
195 Ga0207681_10000913 3300025923 Bacteria 19294
196 Ga0207681_10004478 3300025923 Bacteria 8601
197 Ga0207681_10007249 3300025923 Bacteria 6798
198 Ga0207681_10065465 3300025923 Bacteria 2513
199 Ga0207681_10162404 3300025923 Bacteria 1685
200 Ga0207694_10111527 3300025924 Bacteria 2176
201 Ga0207650_10001193 3300025925 Bacteria 19077
202 Ga0207650_10108592 3300025925 Bacteria 2145
203 Ga0207687_10013636 3300025927 Bacteria 5305
204 Ga0207687_10077920 3300025927 Bacteria 2385
205 Ga0207664_10366887 3300025929 Bacteria 1276
206 Ga0207644_10043239 3300025931 Bacteria 3196
207 Ga0207644_10166123 3300025931 Bacteria 1719
208 Ga0207690_10000001 3300025932 Bacteria 807539
209 Ga0207690_10000002 3300025932 Bacteria 807473
210 Ga0207690_10000003 3300025932 Bacteria 783011
211 Ga0207690_10000004 3300025932 Bacteria 746138
212 Ga0207690_10044685 3300025932 Bacteria 2922
213 Ga0207690_10142101 3300025932 Bacteria 1770
214 Ga0207706_10001528 3300025933 Bacteria 22957
215 Ga0207706_10009534 3300025933 Bacteria 8915
216 Ga0207706_10023320 3300025933 Bacteria 5558
217 Ga0207706_10027933 3300025933 Bacteria 5043
218 Ga0207706_10045624 3300025933 Bacteria 3882
219 Ga0207706_10143013 3300025933 Bacteria 2104
220 Ga0207706_10145084 3300025933 Bacteria 2088
221 Ga0207686_10009548 3300025934 Bacteria 5263
222 Ga0207709_10000119 3300025935 Bacteria 121452
223 Ga0207709_10346529 3300025935 Bacteria 1120
224 Ga0207704_10000001 3300025938 Bacteria 716296
225 Ga0207691_10009658 3300025940 Bacteria 9254
226 Ga0207691_10065861 3300025940 Bacteria 3278
227 Ga0207689_10043717 3300025942 Bacteria 3703
228 Ga0207667_10000035 3300025949 Bacteria 301056
229 Ga0207667_10028393 3300025949 Bacteria 6078
230 Ga0207667_10082186 3300025949 Bacteria 3337
231 Ga0207667_10376763 3300025949 Bacteria 1446
232 Ga0207651_10000002 3300025960 Bacteria 427663
233 Ga0207651_10028103 3300025960 Bacteria 3543
234 Ga0207651_10112688 3300025960 Bacteria 2045
235 Ga0207712_10350587 3300025961 Bacteria 1227
236 Ga0207712_10391799 3300025961 Bacteria 1165
237 Ga0207668_10000420 3300025972 Bacteria 26815
238 Ga0207668_10029581 3300025972 Bacteria 3591
239 Ga0207668_10211610 3300025972 Bacteria 1551
240 Ga0207640_10002078 3300025981 Bacteria 10783
241 Ga0207640_10045437 3300025981 Bacteria 2820
242 Ga0207640_10104898 3300025981 Bacteria 1991
243 Ga0207658_10000029 3300025986 Bacteria 171928
244 Ga0207677_10000042 3300026023 Bacteria 110706
245 Ga0207677_10000110 3300026023 Bacteria 66525
246 Ga0207703_10150829 3300026035 Bacteria 2027
247 Ga0207639_10003124 3300026041 Bacteria 11134
248 Ga0207639_10003549 3300026041 Bacteria 10481
249 Ga0207639_10021732 3300026041 Bacteria 4612
250 Ga0207639_10205020 3300026041 Bacteria 1694
251 Ga0207678_10006156 3300026067 Bacteria 10673
252 Ga0207678_10028921 3300026067 Bacteria 4837
253 Ga0207678_10104229 3300026067 Bacteria 2420
254 Ga0207678_10284092 3300026067 Bacteria 1421
255 Ga0207702_10007410 3300026078 Bacteria 9366
256 Ga0207702_10016949 3300026078 Bacteria 6029
257 Ga0207702_10037062 3300026078 Bacteria 4080
258 Ga0207702_10048793 3300026078 Bacteria 3571
259 Ga0207641_10000343 3300026088 Bacteria 56041
260 Ga0207648_10000001 3300026089 Bacteria 427499
261 Ga0207648_10003545 3300026089 Bacteria 16326
262 Ga0207674_10011479 3300026116 Bacteria 9952
263 Ga0207674_10021373 3300026116 Bacteria 6969
264 Ga0207674_10031213 3300026116 Bacteria 5599
265 Ga0207674_10076713 3300026116 Bacteria 3349
266 Ga0207674_10149879 3300026116 Bacteria 2290
267 Ga0207683_10004102 3300026121 Bacteria 12583
268 Ga0207683_10038348 3300026121 Bacteria 4176
269 Ga0207698_10001453 3300026142 Bacteria 13782
270 Ga0207698_10023128 3300026142 Bacteria 4337
271 Ga0207698_10196058 3300026142 Bacteria 1804
272 Ga0207698_10286087 3300026142 Bacteria 1527
273 Ga0209813_10000026 3300027866 Bacteria 71626
274 Ga0209813_10000064 3300027866 Bacteria 43230
275 Ga0268266_10000468 3300028379 Bacteria 58386
276 Ga0268266_10006387 3300028379 Bacteria 10799
277 Ga0268266_10012074 3300028379 Bacteria 7475
278 Ga0268266_10060943 3300028379 Bacteria 3253
279 Ga0268265_10036761 3300028380 Bacteria 3589
280 Ga0268265_10505851 3300028380 Bacteria 1139
281 Ga0268264_10025247 3300028381 Bacteria 4854
282 Ga0316180_1175123 3300030736 Bacteria 1711
283 Ga0307509_10172605 3300031507 Bacteria 2039
284 Ga0307408_100076733 3300031548 Bacteria 2486
285 Ga0307408_100091593 3300031548 Bacteria 2296
286 Ga0307408_100296281 3300031548 Bacteria 1353
287 Ga0307408_100303916 3300031548 Bacteria 1337
288 Ga0307508_10040002 3300031616 Bacteria 4211
289 Ga0307405_10015134 3300031731 Bacteria 4168
290 Ga0307405_10062290 3300031731 Bacteria 2361
291 Ga0307405_10097472 3300031731 Bacteria 1963
292 Ga0307405_10140999 3300031731 Bacteria 1681
293 Ga0307413_10025453 3300031824 Bacteria 3244
294 Ga0307413_10031193 3300031824 Bacteria 3004
295 Ga0307413_10065875 3300031824 Bacteria 2257
296 Ga0307413_10075540 3300031824 Bacteria 2139
297 Ga0307413_10115808 3300031824 Bacteria 1804
298 Ga0307413_10161466 3300031824 Bacteria 1575
299 Ga0307413_10303983 3300031824 Bacteria 1211
300 Ga0307410_10013845 3300031852 Bacteria 4722
301 Ga0307410_10023336 3300031852 Bacteria 3843
302 Ga0307410_10233865 3300031852 Bacteria 1420
303 Ga0307410_10250175 3300031852 Bacteria 1377
304 Ga0307410_10308985 3300031852 Bacteria 1250
305 Ga0307406_10044058 3300031901 Bacteria 2795
306 Ga0307406_10165676 3300031901 Bacteria 1594
307 Ga0307406_10208303 3300031901 Bacteria 1445
308 Ga0307406_10333606 3300031901 Bacteria 1178
309 Ga0307406_10396145 3300031901 Bacteria 1093
310 Ga0307407_10032006 3300031903 Bacteria 2855
311 Ga0307412_10001551 3300031911 Bacteria 12691
312 Ga0307412_10014206 3300031911 Bacteria 4691
313 Ga0307412_10084443 3300031911 Bacteria 2204
314 Ga0307412_10206536 3300031911 Bacteria 1495
315 Ga0307409_100030791 3300031995 Bacteria 3861
316 Ga0307409_100152528 3300031995 Bacteria 2008
317 Ga0307409_100161233 3300031995 Bacteria 1961
318 Ga0307409_100165640 3300031995 Bacteria 1939
319 Ga0307409_100298106 3300031995 Bacteria 1498
320 Ga0307416_100035887 3300032002 Bacteria 3793
321 Ga0307416_100040957 3300032002 Bacteria 3604
322 Ga0307416_100083007 3300032002 Bacteria 2717
323 Ga0307416_100092900 3300032002 Bacteria 2597
324 Ga0307414_10000486 3300032004 Bacteria 20663
325 Ga0307414_10000936 3300032004 Bacteria 14906
326 Ga0307414_10005912 3300032004 Bacteria 6773
327 Ga0307414_10040707 3300032004 Bacteria 3141
328 Ga0307414_10041989 3300032004 Bacteria 3104
329 Ga0307414_10043111 3300032004 Bacteria 3071
330 Ga0307414_10053999 3300032004 Bacteria 2805
331 Ga0307414_10082760 3300032004 Bacteria 2354
332 Ga0307414_10125697 3300032004 Bacteria 1981
333 Ga0307414_10165607 3300032004 Bacteria 1761
334 Ga0307414_10203504 3300032004 Bacteria 1612
335 Ga0307414_10301181 3300032004 Bacteria 1356
336 Ga0307414_10480403 3300032004 Bacteria 1096
337 Ga0307411_10067334 3300032005 Bacteria 2409
338 Ga0307411_10179266 3300032005 Bacteria 1606
339 Ga0307411_10207089 3300032005 Bacteria 1511
340 Ga0307411_10280166 3300032005 Bacteria 1326
341 Ga0307415_100034809 3300032126 Bacteria 3283
342 Ga0307415_100079912 3300032126 Bacteria 2331
343 Ga0307415_100123043 3300032126 Bacteria 1949
344 Ga0307415_100137522 3300032126 Bacteria 1860
345 Ga0316583_10000596 3300032133 Bacteria 10981
346 Ga0316582_0009794 3300036647 Bacteria 5215
347 Ga0316584_0068361 3300036712 Bacteria 2663
348 Ga0316584_0123969 3300036712 Bacteria 1930
349 Ga0395899_0002220 3300037312 Bacteria 15922
350 Ga0395899_0097446 3300037312 Bacteria 2126
351 Ga0395899_0311155 3300037312 Bacteria 1063
352 Ga0395900_0001007 3300037418 Bacteria 36505
353 Ga0395900_0199287 3300037418 Bacteria 2027
354 Ga0395898_0121798 3300037466 Bacteria 2499
355 Ga0395905_0342048 3300037471 Bacteria 1387
356 Ga0395901_0001182 3300038443 Bacteria 27756
357 Ga0395901_0128974 3300038443 Bacteria 2658
358 Ga0395901_0367728 3300038443 Bacteria 1482
359 Ga0439445_0000876 3300042004 Bacteria 6390
360 Ga0439448_0000458 3300042005 Bacteria 9415
361 Ga0439448_0006784 3300042005 Bacteria 3300
362 Ga0439455_0000272 3300042012 Bacteria 6323
363 Ga0439458_0000004 3300042157 Bacteria 32502
364 Ga0439458_0000749 3300042157 Bacteria 8305
365 Ga0466965_0169615 3300044683 Bacteria 1148
366 Ga0466963_0000856 3300044694 Bacteria 15370
367 Ga0466963_0043630 3300044694 Bacteria 2950
368 Ga0466964_0027352 3300044706 Bacteria 2239
369 Ga0453684_0355292 3300044712 Bacteria 1651
370 Ga0466971_0017093 3300044719 Bacteria 3205
371 Ga0466970_0018389 3300044765 Bacteria 3617
372 Ga0466957_0042948 3300044842 Bacteria 2736
373 Ga0466957_0284079 3300044842 Bacteria 1108
374 Ga0466957_0303117 3300044842 Bacteria 1074
375 Ga0451576_0000007 3300045051 Bacteria 782228
376 Ga0451576_0355575 3300045051 Bacteria 1534
377 Ga0466958_0000484 3300045836 Bacteria 16666
378 Ga0495627_050423 3300046453 Bacteria 1254
379 Ga0495638_0000016 3300046460 Bacteria 396505
380 Ga0495650_0006895 3300046471 Bacteria 6967
381 Ga0495584_0016538 3300046491 Bacteria 3761
382 Ga0495583_0000094 3300046506 Bacteria 153549
383 Ga0495583_0000111 3300046506 Bacteria 138300
384 Ga0495606_0003328 3300046507 Bacteria 17157
385 Ga0495606_0032322 3300046507 Bacteria 3627
386 Ga0495606_0211594 3300046507 Bacteria 1098
387 Ga0495610_0000068 3300046512 Bacteria 122949
388 Ga0495616_0000187 3300046513 Bacteria 51726
389 Ga0495632_0000007 3300046519 Bacteria 343246
390 Ga0495632_0000132 3300046519 Bacteria 75720
391 Ga0495637_0001444 3300046520 Bacteria 13998
392 Ga0495637_0028044 3300046520 Bacteria 2516
393 Ga0495643_0000005 3300046522 Bacteria 443135
394 Ga0495648_0000013 3300046524 Bacteria 289090
395 Ga0495648_0005335 3300046524 Bacteria 10713
396 Ga0495648_0147619 3300046524 Bacteria 1230
397 Ga0495663_0000005 3300046525 Bacteria 342265
398 Ga0495663_0004691 3300046525 Bacteria 3827
399 Ga0495621_0000114 3300046539 Bacteria 16945
400 Ga0495621_0004060 3300046539 Bacteria 4074
401 Ga0495633_0000550 3300046558 Bacteria 36970
402 Ga0495633_0003251 3300046558 Bacteria 10950
403 Ga0495633_0054574 3300046558 Bacteria 1880
404 Ga0495633_0075134 3300046558 Bacteria 1574
405 Ga0495668_0006493 3300046616 Bacteria 7651
406 Ga0495625_0153119 3300046660 Bacteria 1549
407 Ga0495661_0159931 3300046665 Bacteria 1210
408 Ga0495669_0036416 3300046684 Bacteria 2175
409 Ga0495669_0047432 3300046684 Bacteria 1919
410 Ga0495669_0114361 3300046684 Bacteria 1262
411 Ga0495671_0000007 3300046692 Bacteria 443069
412 Ga0495671_0000018 3300046692 Bacteria 291470
413 Ga0495649_0038408 3300046694 Bacteria 2627
414 Ga0495660_0086531 3300046810 Bacteria 1636
415 Ga0495673_0000029 3300047469 Bacteria 471019
416 Ga0495681_0000055 3300047470 Bacteria 104502
417 Ga0495681_0021318 3300047470 Bacteria 3495
418 Ga0495686_0000149 3300047472 Bacteria 135332
419 Ga0496100_0064217 3300048903 Bacteria 2428
420 Ga0496102_0001063 3300048905 Bacteria 25467
421 Ga0496103_0000195 3300048906 Bacteria 60384
422 Ga0496104_0001584 3300048907 Bacteria 19588
423 Ga0496108_0001477 3300048911 Bacteria 18569
424 Ga0496110_0072683 3300048913 Bacteria 3052
425 Ga0496110_0132503 3300048913 Bacteria 2251
426 Ga0496111_0241371 3300048914 Bacteria 1342
427 Ga0496112_0256132 3300048915 Bacteria 1700
428 Ga0496113_0007041 3300048916 Bacteria 7194
429 Ga0496116_0031777 3300048919 Bacteria 3773
430 Ga0496116_0162943 3300048919 Bacteria 1220
431 Ga0496116_0217906 3300048919 Bacteria 981
432 Ga0496117_0004618 3300048920 Bacteria 15007
433 Ga0496117_0011777 3300048920 Bacteria 7794
434 Ga0496118_0027922 3300048921 Bacteria 4766
435 Ga0496118_0033827 3300048921 Bacteria 4185
436 Ga0496118_0078874 3300048921 Bacteria 2327
437 Ga0496119_0016791 3300048922 Bacteria 5545
438 Ga0496120_0001380 3300048923 Bacteria 29622
439 Ga0496121_0000066 3300048924 Bacteria 267065
440 Ga0496121_0035155 3300048924 Bacteria 4495
441 Ga0496121_0295930 3300048924 Bacteria 1100
442 Ga0496121_0295938 3300048924 Bacteria 1100
443 Ga0496122_0002027 3300048925 Bacteria 30082
444 Ga0496122_0040350 3300048925 Bacteria 3711
445 Ga0496122_0049641 3300048925 Bacteria 3209
446 Ga0496122_0107870 3300048925 Bacteria 1838
447 Ga0496123_0007923 3300048926 Bacteria 9866
448 Ga0496123_0039220 3300048926 Bacteria 3316
449 Ga0496123_0042462 3300048926 Bacteria 3137
450 Ga0496124_0046079 3300048927 Bacteria 3736
451 Ga0496125_0032182 3300048928 Bacteria 4662
452 Ga0496125_0046579 3300048928 Bacteria 3637
453 Ga0496125_0123691 3300048928 Bacteria 1838
454 Ga0496125_0170720 3300048928 Bacteria 1462
455 Ga0496126_0000476 3300048929 Bacteria 79541
456 Ga0496126_0003014 3300048929 Bacteria 21843
457 Ga0496126_0033991 3300048929 Bacteria 4794
458 Ga0496126_0110561 3300048929 Bacteria 2394
459 Ga0496126_0115490 3300048929 Bacteria 2334
460 Ga0496126_0232396 3300048929 Bacteria 1544
461 Ga0495682_0005039 3300049460 Bacteria 5550
462 Ga0501034_0049747 3300049571 Bacteria 4229
463 Ga0501037_0259443 3300049573 Bacteria 1214
464 Ga0501038_0013511 3300049574 Bacteria 7442
465 Ga0501223_002201 3300049663 Bacteria 4370
466 Ga0501224_000020 3300049664 Bacteria 74346
467 Ga0501233_001289 3300049668 Bacteria 4287
468 Ga0501235_022309 3300049669 Bacteria 1407
469 Ga0501235_025515 3300049669 Bacteria 1322
470 Ga0501255_002563 3300049684 Bacteria 1607
471 Ga0501225_0000009 3300049705 Bacteria 90065
472 Ga0501234_001287 3300049707 Bacteria 3927
473 Ga0501267_005874 3300049764 Bacteria 1169
474 Ga0501226_000136 3300049853 Bacteria 14145
475 nmdc:mga03683_14295_c1 3300050489 Bacteria 2935
476 nmdc:mga03n38_28530_c1 3300050490 Bacteria 2328
477 nmdc:mga00v17_69844_c1 3300050491 Bacteria 2175
478 nmdc:mga0yw44_159984_c1 3300050492 Bacteria 1474
479 nmdc:mga0k408_1951_c1 3300050493 Bacteria 11058
480 nmdc:mga0k408_79352_c1 3300050493 Bacteria 1921
481 nmdc:mga06z11_1082_c1 3300050494 Bacteria 9916
482 nmdc:mga06z11_19_c1 3300050494 Bacteria 76090
483 nmdc:mga04h51_1318_c1 3300050495 Bacteria 5720
484 nmdc:mga04h51_14_c1 3300050495 Bacteria 77981
485 nmdc:mga07m45_27326_c1 3300050496 Bacteria 3142
486 nmdc:mga07m45_55_c1 3300050496 Bacteria 47453
487 nmdc:mga05p37_709579_c1 3300050507 Bacteria 1116
488 nmdc:mga06r32_17760_c1 3300050510 Bacteria 6500
489 nmdc:mga08y16_32648_c1 3300050511 Bacteria 5472
490 nmdc:mga0sz30_8620_c1 3300050516 Bacteria 2087
491 Ga0500643_000488 3300053087 Bacteria 28843
492 Ga0500644_0028983 3300053088 Bacteria 1736
493 Ga0500555_000403 3300053103 Bacteria 18009
494 Ga0500595_009072 3300053119 Bacteria 4035
495 Ga0500607_001592 3300053121 Bacteria 20060
496 Ga0500608_000755 3300053122 Bacteria 11796
497 Ga0500559_0000841 3300053136 Bacteria 19866
498 Ga0500559_0015561 3300053136 Bacteria 3212
499 Ga0500564_044774 3300053138 Bacteria 2031
500 Ga0500568_0000708 3300053139 Bacteria 23914
501 Ga0500604_0000004 3300053151 Bacteria 146374
502 Ga0500616_0000195 3300053153 Bacteria 99188
503 Ga0500622_0000145 3300053156 Bacteria 75417
504 Ga0500624_000042 3300053157 Bacteria 90289
505 Ga0500627_0002094 3300053158 Bacteria 5791
506 Ga0500567_000039 3300053723 Bacteria 27122
507 Ga0500625_000021 3300053729 Bacteria 83503
508 Ga0500645_004302 3300053730 Bacteria 5492
509 Ga0500661_000036 3300055283 Bacteria 19851

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0211594 Ga0495606_0211594_11_841 276
2 3300005455 Ga0070663_100082667 Ga0070663_1000826672 277
3 3300005539 Ga0068853_100081996 Ga0068853_1000819962 277
4 3300026041 Ga0207639_10021732 Ga0207639_100217326 277
5 3300026067 Ga0207678_10028921 Ga0207678_100289214 277
6 3300002075 JGI24738J21930_10001900 JGI24738J21930_100019008 279
7 3300005327 Ga0070658_10087868 Ga0070658_100878682 279
8 3300005344 Ga0070661_100142822 Ga0070661_1001428222 279
9 3300005578 Ga0068854_100022168 Ga0068854_1000221686 279
10 3300006237 Ga0097621_100018847 Ga0097621_1000188474 279
11 3300013296 Ga0157374_10014340 Ga0157374_100143404 279
12 3300013307 Ga0157372_10134257 Ga0157372_101342573 279
13 3300025981 Ga0207640_10045437 Ga0207640_100454372 279
14 3300046506 Ga0495583_0000111 Ga0495583_0000111_118757_119659 289
15 3300046665 Ga0495661_0159931 Ga0495661_0159931_103_1005 289
16 3300049460 Ga0495682_0005039 Ga0495682_0005039_3829_4731 289
17 3300053103 Ga0500555_000403 Ga0500555_000403_15370_16272 289
18 iso_pu_bacteria 2928959182 2928961640 292
19 3300014326 Ga0157380_10336861 Ga0157380_103368612 293
20 3300031901 Ga0307406_10208303 Ga0307406_102083032 294
21 iso_pu_bacteria 2896429255 2896430491 294
22 3300005293 Ga0065715_10007256 Ga0065715_100072563 295
23 3300005293 Ga0065715_10177317 Ga0065715_101773171 295
24 3300005328 Ga0070676_10003595 Ga0070676_100035954 295
25 3300005331 Ga0070670_100004123 Ga0070670_10000412310 295
26 3300005331 Ga0070670_100010504 Ga0070670_10001050410 295
27 3300005333 Ga0070677_10020285 Ga0070677_100202853 295
28 3300005334 Ga0068869_100295187 Ga0068869_1002951872 295
29 3300005345 Ga0070692_10001570 Ga0070692_100015705 295
30 3300005347 Ga0070668_100232046 Ga0070668_1002320462 295
31 3300005353 Ga0070669_100001566 Ga0070669_1000015662 295
32 3300005353 Ga0070669_100112579 Ga0070669_1001125792 295
33 3300005354 Ga0070675_100070745 Ga0070675_1000707453 295
34 3300005356 Ga0070674_100108335 Ga0070674_1001083353 295
35 3300005366 Ga0070659_100114515 Ga0070659_1001145152 295
36 3300005367 Ga0070667_100244711 Ga0070667_1002447112 295
37 3300005455 Ga0070663_100080923 Ga0070663_1000809232 295
38 3300005456 Ga0070678_100010112 Ga0070678_1000101123 295
39 3300005563 Ga0068855_100190786 Ga0068855_1001907862 295
40 3300005578 Ga0068854_100002258 Ga0068854_1000022589 295
41 3300005578 Ga0068854_100100971 Ga0068854_1001009712 295
42 3300005616 Ga0068852_100441988 Ga0068852_1004419882 295
43 3300005617 Ga0068859_100011965 Ga0068859_1000119654 295
44 3300005840 Ga0068870_10234958 Ga0068870_102349581 295
45 3300005844 Ga0068862_100132541 Ga0068862_1001325413 295
46 3300006931 Ga0097620_100011965 Ga0097620_1000119657 295
47 3300009148 Ga0105243_10593154 Ga0105243_105931541 295
48 3300009553 Ga0105249_10065937 Ga0105249_100659371 295
49 3300025315 Ga0207697_10000801 Ga0207697_100008014 295
50 3300025893 Ga0207682_10001885 Ga0207682_100018859 295
51 3300025901 Ga0207688_10077798 Ga0207688_100777982 295
52 3300025907 Ga0207645_10001754 Ga0207645_1000175416 295
53 3300025908 Ga0207643_10130918 Ga0207643_101309182 295
54 3300025923 Ga0207681_10004478 Ga0207681_100044789 295
55 3300025925 Ga0207650_10001193 Ga0207650_1000119310 295
56 3300025933 Ga0207706_10001528 Ga0207706_1000152813 295
57 3300025935 Ga0207709_10346529 Ga0207709_103465292 295
58 3300025940 Ga0207691_10009658 Ga0207691_100096582 295
59 3300025949 Ga0207667_10028393 Ga0207667_100283939 295
60 3300025960 Ga0207651_10112688 Ga0207651_101126882 295
61 3300025972 Ga0207668_10211610 Ga0207668_102116102 295
62 3300025981 Ga0207640_10002078 Ga0207640_1000207811 295
63 3300026121 Ga0207683_10038348 Ga0207683_100383486 295
64 3300028380 Ga0268265_10036761 Ga0268265_100367613 295
65 3300030736 Ga0316180_1175123 Ga0316180_11751232 295
66 3300031548 Ga0307408_100076733 Ga0307408_1000767334 295
67 3300031548 Ga0307408_100296281 Ga0307408_1002962811 295
68 3300031548 Ga0307408_100303916 Ga0307408_1003039161 295
69 3300031731 Ga0307405_10097472 Ga0307405_100974723 295
70 3300031731 Ga0307405_10140999 Ga0307405_101409992 295
71 3300031824 Ga0307413_10025453 Ga0307413_100254533 295
72 3300031824 Ga0307413_10031193 Ga0307413_100311933 295
73 3300031824 Ga0307413_10065875 Ga0307413_100658753 295
74 3300031824 Ga0307413_10075540 Ga0307413_100755403 295
75 3300031852 Ga0307410_10250175 Ga0307410_102501752 295
76 3300031901 Ga0307406_10044058 Ga0307406_100440582 295
77 3300031901 Ga0307406_10396145 Ga0307406_103961451 295
78 3300031903 Ga0307407_10032006 Ga0307407_100320062 295
79 3300031911 Ga0307412_10084443 Ga0307412_100844433 295
80 3300031911 Ga0307412_10206536 Ga0307412_102065362 295
81 3300031995 Ga0307409_100030791 Ga0307409_1000307912 295
82 3300031995 Ga0307409_100165640 Ga0307409_1001656402 295
83 3300032002 Ga0307416_100092900 Ga0307416_1000929004 295
84 3300032004 Ga0307414_10040707 Ga0307414_100407072 295
85 3300032004 Ga0307414_10053999 Ga0307414_100539992 295
86 3300032004 Ga0307414_10203504 Ga0307414_102035042 295
87 3300032004 Ga0307414_10480403 Ga0307414_104804031 295
88 3300032005 Ga0307411_10067334 Ga0307411_100673342 295
89 3300032005 Ga0307411_10179266 Ga0307411_101792662 295
90 3300032005 Ga0307411_10207089 Ga0307411_102070892 295
91 3300032005 Ga0307411_10280166 Ga0307411_102801662 295
92 3300032126 Ga0307415_100034809 Ga0307415_1000348092 295
93 3300032126 Ga0307415_100079912 Ga0307415_1000799123 295
94 3300032126 Ga0307415_100137522 Ga0307415_1001375222 295
95 3300037312 Ga0395899_0097446 Ga0395899_0097446_465_1370 295
96 3300037418 Ga0395900_0001007 Ga0395900_0001007_25767_26672 295
97 3300038443 Ga0395901_0001182 Ga0395901_0001182_12988_13893 295
98 3300042004 Ga0439445_0000876 Ga0439445_0000876_4824_5729 295
99 3300046539 Ga0495621_0004060 Ga0495621_0004060_125_1030 295
100 3300046558 Ga0495633_0054574 Ga0495633_0054574_527_1432 295
101 3300046684 Ga0495669_0047432 Ga0495669_0047432_64_969 295
102 3300046684 Ga0495669_0114361 Ga0495669_0114361_32_937 295
103 3300049764 Ga0501267_005874 Ga0501267_005874_64_969 295
104 3300050510 nmdc:mga06r32_17760_c1 nmdc:mga06r32_17760_c1_3757_4722 295
105 3300050511 nmdc:mga08y16_32648_c1 nmdc:mga08y16_32648_c1_2717_3622 295
106 iso_pu_bacteria 2885427238 2885428033 295
107 iso_pu_bacteria 2885429604 2885430125 295
108 2162886007 SwRhRL2b_contig_261670 SwRhRL2b_0404.00000730 296
109 3300001904 JGI24736J21556_1001780 JGI24736J21556_10017803 296
110 3300001915 JGI24741J21665_1001479 JGI24741J21665_10014794 296
111 3300001979 JGI24740J21852_10006372 JGI24740J21852_100063724 296
112 3300001979 JGI24740J21852_10031551 JGI24740J21852_100315512 296
113 3300001989 JGI24739J22299_10002342 JGI24739J22299_100023422 296
114 3300001989 JGI24739J22299_10009438 JGI24739J22299_100094384 296
115 3300001989 JGI24739J22299_10009524 JGI24739J22299_100095244 296
116 3300001989 JGI24739J22299_10016224 JGI24739J22299_100162243 296
117 3300001990 JGI24737J22298_10010222 JGI24737J22298_100102222 296
118 3300001990 JGI24737J22298_10032405 JGI24737J22298_100324052 296
119 3300002067 JGI24735J21928_10002006 JGI24735J21928_100020062 296
120 3300002067 JGI24735J21928_10003706 JGI24735J21928_100037063 296
121 3300002067 JGI24735J21928_10003754 JGI24735J21928_100037547 296
122 3300002067 JGI24735J21928_10005739 JGI24735J21928_100057394 296
123 3300002067 JGI24735J21928_10006435 JGI24735J21928_100064352 296
124 3300002067 JGI24735J21928_10008583 JGI24735J21928_100085832 296
125 3300002067 JGI24735J21928_10022219 JGI24735J21928_100222192 296
126 3300002067 JGI24735J21928_10050663 JGI24735J21928_100506632 296
127 3300002075 JGI24738J21930_10001216 JGI24738J21930_100012167 296
128 3300002075 JGI24738J21930_10004560 JGI24738J21930_100045603 296
129 3300002077 JGI24744J21845_10000581 JGI24744J21845_100005819 296
130 3300003214 JGI25165J46597_1000216 JGI25165J46597_100021653 296
131 3300003762 Ga0055542_1009686 Ga0055542_10096862 296
132 3300005289 Ga0065704_10009711 Ga0065704_100097113 296
133 3300005327 Ga0070658_10000225 Ga0070658_1000022527 296
134 3300005327 Ga0070658_10003675 Ga0070658_100036758 296
135 3300005327 Ga0070658_10010960 Ga0070658_100109603 296
136 3300005327 Ga0070658_10099154 Ga0070658_100991542 296
137 3300005328 Ga0070676_10003004 Ga0070676_100030042 296
138 3300005334 Ga0068869_100031385 Ga0068869_1000313856 296
139 3300005335 Ga0070666_10008340 Ga0070666_100083403 296
140 3300005339 Ga0070660_100000480 Ga0070660_10000048019 296
141 3300005339 Ga0070660_100003063 Ga0070660_10000306310 296
142 3300005339 Ga0070660_100007497 Ga0070660_1000074972 296
143 3300005339 Ga0070660_100090434 Ga0070660_1000904343 296
144 3300005339 Ga0070660_100319444 Ga0070660_1003194442 296
145 3300005344 Ga0070661_100026948 Ga0070661_1000269485 296
146 3300005344 Ga0070661_100095028 Ga0070661_1000950282 296
147 3300005344 Ga0070661_100107355 Ga0070661_1001073552 296
148 3300005347 Ga0070668_100000099 Ga0070668_10000009944 296
149 3300005353 Ga0070669_100005241 Ga0070669_1000052419 296
150 3300005353 Ga0070669_100075689 Ga0070669_1000756892 296
151 3300005353 Ga0070669_100118421 Ga0070669_1001184213 296
152 3300005355 Ga0070671_100008949 Ga0070671_1000089499 296
153 3300005355 Ga0070671_100039990 Ga0070671_1000399906 296
154 3300005364 Ga0070673_100000003 Ga0070673_100000003155 296
155 3300005366 Ga0070659_100000001 Ga0070659_100000001494 296
156 3300005366 Ga0070659_100093509 Ga0070659_1000935092 296
157 3300005366 Ga0070659_100247101 Ga0070659_1002471012 296
158 3300005366 Ga0070659_100456107 Ga0070659_1004561071 296
159 3300005367 Ga0070667_100000038 Ga0070667_100000038171 296
160 3300005455 Ga0070663_100001752 Ga0070663_1000017529 296
161 3300005455 Ga0070663_100077079 Ga0070663_1000770792 296
162 3300005456 Ga0070678_100002547 Ga0070678_1000025475 296
163 3300005457 Ga0070662_100040636 Ga0070662_1000406363 296
164 3300005459 Ga0068867_100000001 Ga0068867_100000001181 296
165 3300005539 Ga0068853_100000230 Ga0068853_10000023035 296
166 3300005539 Ga0068853_100097855 Ga0068853_1000978553 296
167 3300005539 Ga0068853_100268703 Ga0068853_1002687032 296
168 3300005543 Ga0070672_100045704 Ga0070672_1000457041 296
169 3300005548 Ga0070665_100000075 Ga0070665_10000007549 296
170 3300005548 Ga0070665_100006857 Ga0070665_1000068572 296
171 3300005548 Ga0070665_100015442 Ga0070665_1000154423 296
172 3300005548 Ga0070665_100094479 Ga0070665_1000944792 296
173 3300005563 Ga0068855_100000253 Ga0068855_10000025322 296
174 3300005564 Ga0070664_100218089 Ga0070664_1002180892 296
175 3300005564 Ga0070664_100443421 Ga0070664_1004434212 296
176 3300005577 Ga0068857_100048655 Ga0068857_1000486553 296
177 3300005614 Ga0068856_100018056 Ga0068856_1000180562 296
178 3300005614 Ga0068856_100028579 Ga0068856_1000285796 296
179 3300005614 Ga0068856_100509549 Ga0068856_1005095491 296
180 3300005614 Ga0068856_100536279 Ga0068856_1005362791 296
181 3300005616 Ga0068852_100218489 Ga0068852_1002184892 296
182 3300005616 Ga0068852_100288924 Ga0068852_1002889242 296
183 3300005616 Ga0068852_100605073 Ga0068852_1006050732 296
184 3300005617 Ga0068859_100228656 Ga0068859_1002286563 296
185 3300005834 Ga0068851_10011589 Ga0068851_100115892 296
186 3300005841 Ga0068863_100000255 Ga0068863_10000025546 296
187 3300005843 Ga0068860_100049956 Ga0068860_1000499564 296
188 3300005844 Ga0068862_100690384 Ga0068862_1006903841 296
189 3300006042 Ga0075368_10000134 Ga0075368_100001349 296
190 3300006048 Ga0075363_100013689 Ga0075363_1000136892 296
191 3300006178 Ga0075367_10001817 Ga0075367_1000181710 296
192 3300006186 Ga0075369_10035734 Ga0075369_100357342 296
193 3300006186 Ga0075369_10055714 Ga0075369_100557142 296
194 3300006881 Ga0068865_100000011 Ga0068865_10000001167 296
195 3300006931 Ga0097620_100228649 Ga0097620_1002286493 296
196 3300009093 Ga0105240_10010869 Ga0105240_100108697 296
197 3300009093 Ga0105240_10062505 Ga0105240_100625052 296
198 3300009093 Ga0105240_10256881 Ga0105240_102568812 296
199 3300009093 Ga0105240_10333654 Ga0105240_103336542 296
200 3300009148 Ga0105243_10000241 Ga0105243_1000024113 296
201 3300009176 Ga0105242_10001038 Ga0105242_100010388 296
202 3300009545 Ga0105237_10057301 Ga0105237_100573012 296
203 3300009551 Ga0105238_10443384 Ga0105238_104433841 296
204 3300010375 Ga0105239_10000037 Ga0105239_100000374 296
205 3300010375 Ga0105239_10318812 Ga0105239_103188122 296
206 3300010375 Ga0105239_10722964 Ga0105239_107229641 296
207 3300013100 Ga0157373_10120531 Ga0157373_101205312 296
208 3300013102 Ga0157371_10081003 Ga0157371_100810032 296
209 3300013104 Ga0157370_10000008 Ga0157370_10000008234 296
210 3300013104 Ga0157370_10057631 Ga0157370_100576315 296
211 3300013105 Ga0157369_10008475 Ga0157369_1000847510 296
212 3300013105 Ga0157369_10365901 Ga0157369_103659011 296
213 3300013105 Ga0157369_10456374 Ga0157369_104563741 296
214 3300013296 Ga0157374_10003756 Ga0157374_1000375612 296
215 3300013306 Ga0163162_10489713 Ga0163162_104897132 296
216 3300013307 Ga0157372_10032282 Ga0157372_100322825 296
217 3300013307 Ga0157372_10090364 Ga0157372_100903643 296
218 3300013307 Ga0157372_10115473 Ga0157372_101154734 296
219 3300013307 Ga0157372_10123785 Ga0157372_101237853 296
220 3300013307 Ga0157372_10163739 Ga0157372_101637393 296
221 3300013307 Ga0157372_10185007 Ga0157372_101850073 296
222 3300013308 Ga0157375_10000902 Ga0157375_1000090212 296
223 3300014969 Ga0157376_10000192 Ga0157376_1000019230 296
224 3300017792 Ga0163161_10008263 Ga0163161_100082635 296
225 3300025231 Ga0207427_101279 Ga0207427_1012799 296
226 3300025250 Ga0209026_1002091 Ga0209026_10020913 296
227 3300025254 Ga0209148_1000117 Ga0209148_1000117119 296
228 3300025254 Ga0209148_1004843 Ga0209148_10048434 296
229 3300025261 Ga0209233_1000079 Ga0209233_1000079287 296
230 3300025321 Ga0207656_10007667 Ga0207656_100076676 296
231 3300025711 Ga0207696_1014984 Ga0207696_10149841 296
232 3300025903 Ga0207680_10005487 Ga0207680_100054873 296
233 3300025904 Ga0207647_10002429 Ga0207647_1000242914 296
234 3300025904 Ga0207647_10007383 Ga0207647_100073833 296
235 3300025904 Ga0207647_10018586 Ga0207647_100185862 296
236 3300025904 Ga0207647_10081317 Ga0207647_100813172 296
237 3300025907 Ga0207645_10004800 Ga0207645_1000480012 296
238 3300025909 Ga0207705_10000144 Ga0207705_1000014449 296
239 3300025909 Ga0207705_10000250 Ga0207705_1000025020 296
240 3300025909 Ga0207705_10002097 Ga0207705_100020978 296
241 3300025909 Ga0207705_10007210 Ga0207705_100072102 296
242 3300025909 Ga0207705_10174479 Ga0207705_101744792 296
243 3300025911 Ga0207654_10022885 Ga0207654_100228853 296
244 3300025913 Ga0207695_10004781 Ga0207695_100047816 296
245 3300025913 Ga0207695_10032478 Ga0207695_100324786 296
246 3300025913 Ga0207695_10109914 Ga0207695_101099142 296
247 3300025914 Ga0207671_10020643 Ga0207671_100206433 296
248 3300025914 Ga0207671_10352412 Ga0207671_103524122 296
249 3300025919 Ga0207657_10002199 Ga0207657_100021995 296
250 3300025919 Ga0207657_10003536 Ga0207657_100035366 296
251 3300025919 Ga0207657_10003878 Ga0207657_1000387813 296
252 3300025919 Ga0207657_10009183 Ga0207657_100091836 296
253 3300025919 Ga0207657_10050794 Ga0207657_100507942 296
254 3300025919 Ga0207657_10160289 Ga0207657_101602892 296
255 3300025919 Ga0207657_10174267 Ga0207657_101742672 296
256 3300025919 Ga0207657_10323734 Ga0207657_103237341 296
257 3300025920 Ga0207649_10002895 Ga0207649_1000289510 296
258 3300025920 Ga0207649_10078755 Ga0207649_100787552 296
259 3300025920 Ga0207649_10118340 Ga0207649_101183402 296
260 3300025923 Ga0207681_10000913 Ga0207681_100009133 296
261 3300025923 Ga0207681_10007249 Ga0207681_100072492 296
262 3300025923 Ga0207681_10065465 Ga0207681_100654652 296
263 3300025923 Ga0207681_10162404 Ga0207681_101624041 296
264 3300025924 Ga0207694_10111527 Ga0207694_101115272 296
265 3300025925 Ga0207650_10108592 Ga0207650_101085923 296
266 3300025927 Ga0207687_10013636 Ga0207687_100136362 296
267 3300025927 Ga0207687_10077920 Ga0207687_100779202 296
268 3300025929 Ga0207664_10366887 Ga0207664_103668872 296
269 3300025931 Ga0207644_10043239 Ga0207644_100432393 296
270 3300025931 Ga0207644_10166123 Ga0207644_101661232 296
271 3300025932 Ga0207690_10000001 Ga0207690_10000001108 296
272 3300025932 Ga0207690_10000002 Ga0207690_10000002108 296
273 3300025932 Ga0207690_10000003 Ga0207690_10000003108 296
274 3300025932 Ga0207690_10000004 Ga0207690_10000004108 296
275 3300025932 Ga0207690_10044685 Ga0207690_100446854 296
276 3300025932 Ga0207690_10142101 Ga0207690_101421012 296
277 3300025933 Ga0207706_10009534 Ga0207706_100095342 296
278 3300025933 Ga0207706_10023320 Ga0207706_100233206 296
279 3300025933 Ga0207706_10027933 Ga0207706_100279333 296
280 3300025933 Ga0207706_10045624 Ga0207706_100456243 296
281 3300025933 Ga0207706_10143013 Ga0207706_101430133 296
282 3300025933 Ga0207706_10145084 Ga0207706_101450842 296
283 3300025934 Ga0207686_10009548 Ga0207686_100095484 296
284 3300025935 Ga0207709_10000119 Ga0207709_1000011966 296
285 3300025938 Ga0207704_10000001 Ga0207704_10000001599 296
286 3300025940 Ga0207691_10065861 Ga0207691_100658616 296
287 3300025942 Ga0207689_10043717 Ga0207689_100437176 296
288 3300025949 Ga0207667_10000035 Ga0207667_10000035269 296
289 3300025949 Ga0207667_10082186 Ga0207667_100821865 296
290 3300025949 Ga0207667_10376763 Ga0207667_103767631 296
291 3300025960 Ga0207651_10000002 Ga0207651_10000002268 296
292 3300025960 Ga0207651_10028103 Ga0207651_100281032 296
293 3300025961 Ga0207712_10350587 Ga0207712_103505872 296
294 3300025961 Ga0207712_10391799 Ga0207712_103917992 296
295 3300025972 Ga0207668_10000420 Ga0207668_100004203 296
296 3300025972 Ga0207668_10029581 Ga0207668_100295813 296
297 3300025981 Ga0207640_10104898 Ga0207640_101048981 296
298 3300025986 Ga0207658_10000029 Ga0207658_10000029169 296
299 3300026023 Ga0207677_10000042 Ga0207677_1000004265 296
300 3300026023 Ga0207677_10000110 Ga0207677_1000011049 296
301 3300026035 Ga0207703_10150829 Ga0207703_101508292 296
302 3300026041 Ga0207639_10003124 Ga0207639_100031249 296
303 3300026041 Ga0207639_10003549 Ga0207639_100035492 296
304 3300026041 Ga0207639_10205020 Ga0207639_102050202 296
305 3300026067 Ga0207678_10006156 Ga0207678_100061566 296
306 3300026067 Ga0207678_10104229 Ga0207678_101042292 296
307 3300026067 Ga0207678_10284092 Ga0207678_102840922 296
308 3300026078 Ga0207702_10007410 Ga0207702_100074108 296
309 3300026078 Ga0207702_10016949 Ga0207702_100169498 296
310 3300026078 Ga0207702_10037062 Ga0207702_100370624 296
311 3300026078 Ga0207702_10048793 Ga0207702_100487933 296
312 3300026088 Ga0207641_10000343 Ga0207641_1000034345 296
313 3300026089 Ga0207648_10000001 Ga0207648_10000001268 296
314 3300026089 Ga0207648_10003545 Ga0207648_1000354521 296
315 3300026116 Ga0207674_10011479 Ga0207674_1001147911 296
316 3300026116 Ga0207674_10021373 Ga0207674_100213738 296
317 3300026116 Ga0207674_10031213 Ga0207674_100312135 296
318 3300026116 Ga0207674_10076713 Ga0207674_100767133 296
319 3300026116 Ga0207674_10149879 Ga0207674_101498793 296
320 3300026121 Ga0207683_10004102 Ga0207683_100041027 296
321 3300026142 Ga0207698_10001453 Ga0207698_1000145312 296
322 3300026142 Ga0207698_10023128 Ga0207698_100231282 296
323 3300026142 Ga0207698_10196058 Ga0207698_101960582 296
324 3300026142 Ga0207698_10286087 Ga0207698_102860872 296
325 3300027866 Ga0209813_10000026 Ga0209813_1000002650 296
326 3300027866 Ga0209813_10000064 Ga0209813_1000006438 296
327 3300028379 Ga0268266_10000468 Ga0268266_100004689 296
328 3300028379 Ga0268266_10006387 Ga0268266_1000638714 296
329 3300028379 Ga0268266_10012074 Ga0268266_100120743 296
330 3300028379 Ga0268266_10060943 Ga0268266_100609432 296
331 3300028380 Ga0268265_10505851 Ga0268265_105058511 296
332 3300028381 Ga0268264_10025247 Ga0268264_100252473 296
333 3300031507 Ga0307509_10172605 Ga0307509_101726052 296
334 3300031548 Ga0307408_100091593 Ga0307408_1000915932 296
335 3300031616 Ga0307508_10040002 Ga0307508_100400022 296
336 3300031731 Ga0307405_10015134 Ga0307405_100151344 296
337 3300031731 Ga0307405_10062290 Ga0307405_100622903 296
338 3300031824 Ga0307413_10115808 Ga0307413_101158081 296
339 3300031824 Ga0307413_10161466 Ga0307413_101614661 296
340 3300031824 Ga0307413_10303983 Ga0307413_103039832 296
341 3300031852 Ga0307410_10013845 Ga0307410_100138455 296
342 3300031852 Ga0307410_10023336 Ga0307410_100233362 296
343 3300031852 Ga0307410_10233865 Ga0307410_102338652 296
344 3300031852 Ga0307410_10308985 Ga0307410_103089851 296
345 3300031901 Ga0307406_10165676 Ga0307406_101656762 296
346 3300031901 Ga0307406_10333606 Ga0307406_103336062 296
347 3300031911 Ga0307412_10001551 Ga0307412_100015516 296
348 3300031911 Ga0307412_10014206 Ga0307412_100142061 296
349 3300031995 Ga0307409_100152528 Ga0307409_1001525281 296
350 3300031995 Ga0307409_100161233 Ga0307409_1001612331 296
351 3300031995 Ga0307409_100298106 Ga0307409_1002981062 296
352 3300032002 Ga0307416_100035887 Ga0307416_1000358872 296
353 3300032002 Ga0307416_100040957 Ga0307416_1000409573 296
354 3300032002 Ga0307416_100083007 Ga0307416_1000830073 296
355 3300032004 Ga0307414_10000486 Ga0307414_100004867 296
356 3300032004 Ga0307414_10000936 Ga0307414_100009362 296
357 3300032004 Ga0307414_10005912 Ga0307414_100059126 296
358 3300032004 Ga0307414_10041989 Ga0307414_100419892 296
359 3300032004 Ga0307414_10043111 Ga0307414_100431112 296
360 3300032004 Ga0307414_10082760 Ga0307414_100827602 296
361 3300032004 Ga0307414_10125697 Ga0307414_101256972 296
362 3300032004 Ga0307414_10165607 Ga0307414_101656072 296
363 3300032004 Ga0307414_10301181 Ga0307414_103011812 296
364 3300032126 Ga0307415_100123043 Ga0307415_1001230432 296
365 3300032133 Ga0316583_10000596 Ga0316583_100005965 296
366 3300036647 Ga0316582_0009794 Ga0316582_0009794_3519_4427 296
367 3300036712 Ga0316584_0068361 Ga0316584_0068361_1589_2497 296
368 3300036712 Ga0316584_0123969 Ga0316584_0123969_371_1279 296
369 3300037312 Ga0395899_0002220 Ga0395899_0002220_4743_5648 296
370 3300037312 Ga0395899_0311155 Ga0395899_0311155_120_1037 296
371 3300037418 Ga0395900_0199287 Ga0395900_0199287_631_1536 296
372 3300037466 Ga0395898_0121798 Ga0395898_0121798_217_1134 296
373 3300037471 Ga0395905_0342048 Ga0395905_0342048_201_1118 296
374 3300038443 Ga0395901_0128974 Ga0395901_0128974_388_1305 296
375 3300038443 Ga0395901_0367728 Ga0395901_0367728_134_1039 296
376 3300042005 Ga0439448_0000458 Ga0439448_0000458_7214_8119 296
377 3300042005 Ga0439448_0006784 Ga0439448_0006784_591_1496 296
378 3300042012 Ga0439455_0000272 Ga0439455_0000272_1400_2305 296
379 3300042157 Ga0439458_0000004 Ga0439458_0000004_26216_27121 296
380 3300042157 Ga0439458_0000749 Ga0439458_0000749_5608_6513 296
381 3300044683 Ga0466965_0169615 Ga0466965_0169615_69_974 296
382 3300044694 Ga0466963_0000856 Ga0466963_0000856_3001_3906 296
383 3300044694 Ga0466963_0043630 Ga0466963_0043630_1320_2225 296
384 3300044706 Ga0466964_0027352 Ga0466964_0027352_35_940 296
385 3300044712 Ga0453684_0355292 Ga0453684_0355292_362_1267 296
386 3300044719 Ga0466971_0017093 Ga0466971_0017093_1173_2078 296
387 3300044765 Ga0466970_0018389 Ga0466970_0018389_1812_2717 296
388 3300044842 Ga0466957_0042948 Ga0466957_0042948_582_1487 296
389 3300044842 Ga0466957_0284079 Ga0466957_0284079_147_1052 296
390 3300044842 Ga0466957_0303117 Ga0466957_0303117_141_1058 296
391 3300045051 Ga0451576_0000007 Ga0451576_0000007_762508_763398 296
392 3300045051 Ga0451576_0355575 Ga0451576_0355575_418_1323 296
393 3300045836 Ga0466958_0000484 Ga0466958_0000484_5820_6725 296
394 3300046453 Ga0495627_050423 Ga0495627_050423_98_1006 296
395 3300046460 Ga0495638_0000016 Ga0495638_0000016_349118_350038 296
396 3300046471 Ga0495650_0006895 Ga0495650_0006895_370_1278 296
397 3300046491 Ga0495584_0016538 Ga0495584_0016538_931_1839 296
398 3300046506 Ga0495583_0000094 Ga0495583_0000094_104669_105589 296
399 3300046507 Ga0495606_0003328 Ga0495606_0003328_6072_7016 296
400 3300046507 Ga0495606_0032322 Ga0495606_0032322_1505_2437 296
401 3300046512 Ga0495610_0000068 Ga0495610_0000068_91497_92405 296
402 3300046513 Ga0495616_0000187 Ga0495616_0000187_33250_34164 296
403 3300046519 Ga0495632_0000007 Ga0495632_0000007_39800_40708 296
404 3300046519 Ga0495632_0000132 Ga0495632_0000132_44361_45281 296
405 3300046520 Ga0495637_0001444 Ga0495637_0001444_1073_1981 296
406 3300046520 Ga0495637_0028044 Ga0495637_0028044_768_1676 296
407 3300046522 Ga0495643_0000005 Ga0495643_0000005_126675_127583 296
408 3300046524 Ga0495648_0000013 Ga0495648_0000013_46468_47388 296
409 3300046524 Ga0495648_0005335 Ga0495648_0005335_7648_8556 296
410 3300046524 Ga0495648_0147619 Ga0495648_0147619_187_1119 296
411 3300046525 Ga0495663_0000005 Ga0495663_0000005_38819_39727 296
412 3300046525 Ga0495663_0004691 Ga0495663_0004691_1249_2172 296
413 3300046539 Ga0495621_0000114 Ga0495621_0000114_9153_10070 296
414 3300046558 Ga0495633_0000550 Ga0495633_0000550_13324_14256 296
415 3300046558 Ga0495633_0003251 Ga0495633_0003251_3718_4626 296
416 3300046558 Ga0495633_0075134 Ga0495633_0075134_76_984 296
417 3300046616 Ga0495668_0006493 Ga0495668_0006493_4241_5155 296
418 3300046660 Ga0495625_0153119 Ga0495625_0153119_79_987 296
419 3300046684 Ga0495669_0036416 Ga0495669_0036416_629_1555 296
420 3300046692 Ga0495671_0000007 Ga0495671_0000007_126675_127583 296
421 3300046692 Ga0495671_0000018 Ga0495671_0000018_47957_48877 296
422 3300046694 Ga0495649_0038408 Ga0495649_0038408_613_1518 296
423 3300046810 Ga0495660_0086531 Ga0495660_0086531_402_1310 296
424 3300047469 Ga0495673_0000029 Ga0495673_0000029_412237_413157 296
425 3300047470 Ga0495681_0000055 Ga0495681_0000055_51341_52249 296
426 3300047470 Ga0495681_0021318 Ga0495681_0021318_1486_2394 296
427 3300047472 Ga0495686_0000149 Ga0495686_0000149_16752_17684 296
428 3300048903 Ga0496100_0064217 Ga0496100_0064217_990_1895 296
429 3300048905 Ga0496102_0001063 Ga0496102_0001063_1344_2249 296
430 3300048906 Ga0496103_0000195 Ga0496103_0000195_15451_16356 296
431 3300048907 Ga0496104_0001584 Ga0496104_0001584_3370_4275 296
432 3300048911 Ga0496108_0001477 Ga0496108_0001477_2695_3585 296
433 3300048913 Ga0496110_0072683 Ga0496110_0072683_633_1538 296
434 3300048913 Ga0496110_0132503 Ga0496110_0132503_1081_1974 296
435 3300048914 Ga0496111_0241371 Ga0496111_0241371_435_1328 296
436 3300048915 Ga0496112_0256132 Ga0496112_0256132_56_961 296
437 3300048916 Ga0496113_0007041 Ga0496113_0007041_1005_1910 296
438 3300048919 Ga0496116_0031777 Ga0496116_0031777_761_1669 296
439 3300048919 Ga0496116_0162943 Ga0496116_0162943_142_1032 296
440 3300048919 Ga0496116_0217906 Ga0496116_0217906_29_934 296
441 3300048920 Ga0496117_0004618 Ga0496117_0004618_9812_10717 296
442 3300048920 Ga0496117_0011777 Ga0496117_0011777_2065_2973 296
443 3300048921 Ga0496118_0027922 Ga0496118_0027922_1241_2146 296
444 3300048921 Ga0496118_0033827 Ga0496118_0033827_2580_3485 296
445 3300048921 Ga0496118_0078874 Ga0496118_0078874_1227_2132 296
446 3300048922 Ga0496119_0016791 Ga0496119_0016791_4502_5407 296
447 3300048923 Ga0496120_0001380 Ga0496120_0001380_15271_16176 296
448 3300048924 Ga0496121_0000066 Ga0496121_0000066_198044_198949 296
449 3300048924 Ga0496121_0035155 Ga0496121_0035155_553_1458 296
450 3300048924 Ga0496121_0295930 Ga0496121_0295930_48_953 296
451 3300048924 Ga0496121_0295938 Ga0496121_0295938_48_953 296
452 3300048925 Ga0496122_0002027 Ga0496122_0002027_12778_13683 296
453 3300048925 Ga0496122_0040350 Ga0496122_0040350_1344_2249 296
454 3300048925 Ga0496122_0049641 Ga0496122_0049641_1482_2387 296
455 3300048925 Ga0496122_0107870 Ga0496122_0107870_377_1282 296
456 3300048926 Ga0496123_0007923 Ga0496123_0007923_4987_5892 296
457 3300048926 Ga0496123_0039220 Ga0496123_0039220_932_1837 296
458 3300048926 Ga0496123_0042462 Ga0496123_0042462_2185_3090 296
459 3300048927 Ga0496124_0046079 Ga0496124_0046079_1815_2723 296
460 3300048928 Ga0496125_0032182 Ga0496125_0032182_1962_2855 296
461 3300048928 Ga0496125_0046579 Ga0496125_0046579_546_1451 296
462 3300048928 Ga0496125_0123691 Ga0496125_0123691_377_1282 296
463 3300048928 Ga0496125_0170720 Ga0496125_0170720_132_1022 296
464 3300048929 Ga0496126_0000476 Ga0496126_0000476_63299_64204 296
465 3300048929 Ga0496126_0003014 Ga0496126_0003014_13048_13953 296
466 3300048929 Ga0496126_0033991 Ga0496126_0033991_465_1376 296
467 3300048929 Ga0496126_0110561 Ga0496126_0110561_642_1532 296
468 3300048929 Ga0496126_0115490 Ga0496126_0115490_1007_1912 296
469 3300048929 Ga0496126_0232396 Ga0496126_0232396_597_1502 296
470 3300049571 Ga0501034_0049747 Ga0501034_0049747_2374_3282 296
471 3300049573 Ga0501037_0259443 Ga0501037_0259443_59_964 296
472 3300049574 Ga0501038_0013511 Ga0501038_0013511_5710_6615 296
473 3300049663 Ga0501223_002201 Ga0501223_002201_1481_2389 296
474 3300049664 Ga0501224_000020 Ga0501224_000020_5788_6696 296
475 3300049668 Ga0501233_001289 Ga0501233_001289_2080_2988 296
476 3300049669 Ga0501235_022309 Ga0501235_022309_42_950 296
477 3300049669 Ga0501235_025515 Ga0501235_025515_95_1003 296
478 3300049684 Ga0501255_002563 Ga0501255_002563_216_1124 296
479 3300049705 Ga0501225_0000009 Ga0501225_0000009_48218_49126 296
480 3300049707 Ga0501234_001287 Ga0501234_001287_1725_2633 296
481 3300049853 Ga0501226_000136 Ga0501226_000136_11284_12192 296
482 3300050489 nmdc:mga03683_14295_c1 nmdc:mga03683_14295_c1_1279_2184 296
483 3300050490 nmdc:mga03n38_28530_c1 nmdc:mga03n38_28530_c1_672_1577 296
484 3300050491 nmdc:mga00v17_69844_c1 nmdc:mga00v17_69844_c1_1232_2137 296
485 3300050492 nmdc:mga0yw44_159984_c1 nmdc:mga0yw44_159984_c1_139_1044 296
486 3300050493 nmdc:mga0k408_1951_c1 nmdc:mga0k408_1951_c1_3887_4792 296
487 3300050493 nmdc:mga0k408_79352_c1 nmdc:mga0k408_79352_c1_618_1523 296
488 3300050494 nmdc:mga06z11_1082_c1 nmdc:mga06z11_1082_c1_8366_9271 296
489 3300050494 nmdc:mga06z11_19_c1 nmdc:mga06z11_19_c1_60631_61524 296
490 3300050495 nmdc:mga04h51_1318_c1 nmdc:mga04h51_1318_c1_369_1274 296
491 3300050495 nmdc:mga04h51_14_c1 nmdc:mga04h51_14_c1_22838_23731 296
492 3300050496 nmdc:mga07m45_27326_c1 nmdc:mga07m45_27326_c1_1850_2755 296
493 3300050496 nmdc:mga07m45_55_c1 nmdc:mga07m45_55_c1_31287_32192 296
494 3300050507 nmdc:mga05p37_709579_c1 nmdc:mga05p37_709579_c1_53_961 296
495 3300050516 nmdc:mga0sz30_8620_c1 nmdc:mga0sz30_8620_c1_431_1336 296
496 3300053087 Ga0500643_000488 Ga0500643_000488_5362_6270 296
497 3300053088 Ga0500644_0028983 Ga0500644_0028983_653_1573 296
498 3300053119 Ga0500595_009072 Ga0500595_009072_2557_3462 296
499 3300053121 Ga0500607_001592 Ga0500607_001592_8941_9846 296
500 3300053122 Ga0500608_000755 Ga0500608_000755_2140_3045 296
501 3300053136 Ga0500559_0000841 Ga0500559_0000841_17063_17971 296
502 3300053136 Ga0500559_0015561 Ga0500559_0015561_334_1239 296
503 3300053138 Ga0500564_044774 Ga0500564_044774_1038_1943 296
504 3300053139 Ga0500568_0000708 Ga0500568_0000708_20356_21261 296
505 3300053151 Ga0500604_0000004 Ga0500604_0000004_101967_102872 296
506 3300053153 Ga0500616_0000195 Ga0500616_0000195_35807_36712 296
507 3300053156 Ga0500622_0000145 Ga0500622_0000145_35922_36827 296
508 3300053157 Ga0500624_000042 Ga0500624_000042_56490_57398 296
509 3300053158 Ga0500627_0002094 Ga0500627_0002094_1581_2495 296
510 3300053723 Ga0500567_000039 Ga0500567_000039_20960_21865 296
511 3300053729 Ga0500625_000021 Ga0500625_000021_45347_46252 296
512 3300053730 Ga0500645_004302 Ga0500645_004302_3593_4531 296
513 3300055283 Ga0500661_000036 Ga0500661_000036_14358_15266 296
514 iso_pu_bacteria 2512564014 2512643761 296
515 iso_pu_bacteria 2738541275 2738711557 296
516 iso_pu_bacteria 2738541301 2738849982 296
517 iso_pu_bacteria 2738541304 2738865711 296
518 iso_pu_bacteria 2738543022 2739298229 296
519 iso_pu_bacteria 2738543033 2739359907 296
520 iso_pu_bacteria 2739367664 2739649121 296
521 iso_pu_bacteria 2739367865 2740027594 296
522 iso_pu_bacteria 2775507255 2778124694 296
523 iso_pu_bacteria 2895880812 2895884251 296
524 iso_pu_bacteria 2896184354 2896187225 296
525 iso_pu_bacteria 2928100450 2928104175 296
526 iso_pu_bacteria 3000865235 3000866320 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

199

292

0.95

PF00551

Formyl_trans_N

Formyl transferase

1

179

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9291 2 296
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9232 2 296
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.921 2 296
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9174 1 295
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9151 2 296
ID Description Score Start End Superfamily
af_P9WND3_1_310_3.40.50.12230 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9382 2 286 3.40.50.12230
5uaiB02 Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain 0.9251 198 294 3.10.25.10
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9227 2 197 3.40.50.170
3q0iA02 Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain 0.9162 198 294 3.10.25.10
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9147 1 197 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A3B0SIC4-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9732 195 296 GO:0004479
AF-A0A1H9TCB6-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.969 1 296 GO:0004479
GO:0005829
AF-A0A1H9TCB6-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9657 1 296 GO:0004479
GO:0005829
AF-A0A3D0WA23-F1-model_v4 Methionyl-tRNA formyltransferase 0.965 104 296 GO:0004479
GO:0005829
AF-A0A8A8PN39-F1-model_v4 deleted 0.9582 195 296

Feature Viewer

pLDDT pTM Quality
94.33 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map