F459394

General Info

Members Datasets Scaffolds Average Seq Length
526 355 485 339

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10217028|Ga0114129_102170282
Length 381
Sequence LLVLRRVSDLVLAIPEDICHRKNRSPSIERRKPSKSHQGAAAGMGHPFRIRAIAQQAGLSEATVDRVLNNRGGVRTDTVREVHQAVADLERQRTQLRLGGRTFVIDVVMQAPDRFSSAVRRALEAELPALRPAVIRSRFHFRETGPLADLTATLDRIASRGSQGVIIKAPDVPEITEAVARVVAAGIPVLTLVTDLPASRRLAYVGIDNRAAGATAAYLIGQWLGDKPGNVLVTLSRGFFRGEEEREMGFRSAMRSRYPDRSLVEIDNSDGLDETMRGLVLSALDSDPAINAVYSIGGGNVAIGEAFVSMRRTCSVFIAHDLDQDNIRLLRDGHLSAVLMRRACHFIMQAHRALPGAASSWPSNIQVITPYNTPIPVTFEP

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
3 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
6 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
7 2643221647 Streptomyces sp. Root369 Isolate Unclassified
8 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
9 2643221714 Streptomyces sp. Root264 Isolate Unclassified
10 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
11 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
12 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
13 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
14 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
15 2808606448 Streptomyces sp. 193411 Isolate Unclassified
16 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
17 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
18 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
19 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
20 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
21 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
22 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
23 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
24 2922554459 Rhodococcus sp. 66b Isolate Unclassified
25 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
26 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
27 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
28 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
29 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
30 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
31 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
32 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
33 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
34 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
35 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
36 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
37 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
38 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
39 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
40 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
41 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
42 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
43 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
44 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
45 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
46 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
50 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
53 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
59 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
63 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
64 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
76 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
77 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
78 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
79 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
80 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
81 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
82 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
83 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
84 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
152 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
156 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
157 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
158 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
159 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
160 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
214 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
215 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
230 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
231 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
232 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
245 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
246 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
247 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
248 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
249 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
252 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
253 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
254 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
255 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
256 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
257 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
258 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
259 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
260 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
261 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
262 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
263 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
264 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
265 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
266 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
281 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
282 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
286 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
287 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
288 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
340 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
341 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
342 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
343 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
344 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
345 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
346 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
347 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
348 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
349 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
352 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
353 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
354 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
355 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.83
Metatranscriptomes 0.38
Isolates 7.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.75
Nodule 0
Rhizoplane 8.37
Rhizosphere 74.71
Stem 0
Stem Tuber 0
Unclassified 8.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1005288 3300000549 Bacteria 1645
2 JGI24743J22301_10020017 3300001991 Bacteria 1273
3 JGI25158J39367_1000032 3300002739 Bacteria 30976
4 JGI25152J39213_1006252 3300002773 Bacteria 3292
5 JGI25159J45721_1001948 3300002987 Bacteria 8221
6 JGI25159J45721_1004540 3300002987 Bacteria 4584
7 JGI25153J46596_10003140 3300003215 Bacteria 9317
8 rootH1_10000180 3300003316 Bacteria 19593
9 rootH2_10014605 3300003320 Bacteria 8359
10 rootL2_10017864 3300003322 Bacteria 7993
11 rootH1_10022852 3300003323 Bacteria 10309
12 rootH1_10028509 3300003323 Bacteria 5441
13 JGI25160J50197_1016954 3300003354 Bacteria 2327
14 JGI25161J50226_1000129 3300003374 Bacteria 53598
15 Ga0055526_1013602 3300003771 Bacteria 3427
16 Ga0055543_1000029 3300004625 Bacteria 131452
17 Ga0065165_1011090 3300005262 Bacteria 3808
18 Ga0070658_10004588 3300005327 Bacteria 11224
19 Ga0070676_10014748 3300005328 Bacteria 4299
20 Ga0070670_100060122 3300005331 Bacteria 3262
21 Ga0068869_100004228 3300005334 Bacteria 8909
22 Ga0070680_100003234 3300005336 Bacteria 12124
23 Ga0070680_100074541 3300005336 Bacteria 2792
24 Ga0070682_100002451 3300005337 Bacteria 10247
25 Ga0070682_100013826 3300005337 Bacteria 4653
26 Ga0070682_100120104 3300005337 Bacteria 1763
27 Ga0068868_100005180 3300005338 Bacteria 9150
28 Ga0070660_100029230 3300005339 Bacteria 4128
29 Ga0070660_100161196 3300005339 Bacteria 1807
30 Ga0070689_100052309 3300005340 Bacteria 3159
31 Ga0070691_10005633 3300005341 Bacteria 5706
32 Ga0070687_100116342 3300005343 Bacteria 1522
33 Ga0070687_100179073 3300005343 Bacteria 1268
34 Ga0070661_100050120 3300005344 Bacteria 3055
35 Ga0070692_10017388 3300005345 Bacteria 3438
36 Ga0070692_10119983 3300005345 Bacteria 1465
37 Ga0070668_100038719 3300005347 Bacteria 3645
38 Ga0070668_100043684 3300005347 Bacteria 3437
39 Ga0070668_100260790 3300005347 Bacteria 1441
40 Ga0070669_100180476 3300005353 Bacteria 1651
41 Ga0070675_100005835 3300005354 Bacteria 9430
42 Ga0070675_100045723 3300005354 Bacteria 3583
43 Ga0070675_100090936 3300005354 Bacteria 2556
44 Ga0070671_100002212 3300005355 Bacteria 15019
45 Ga0070674_100214725 3300005356 Bacteria 1493
46 Ga0070673_100125409 3300005364 Bacteria 2148
47 Ga0070659_100039165 3300005366 Bacteria 3699
48 Ga0070667_100323165 3300005367 Bacteria 1393
49 Ga0070709_10135093 3300005434 Bacteria 1688
50 Ga0070714_100178055 3300005435 Bacteria 1933
51 Ga0070713_100001480 3300005436 Bacteria 14974
52 Ga0070710_10041143 3300005437 Bacteria 2550
53 Ga0070701_10100200 3300005438 Bacteria 1603
54 Ga0070705_100146845 3300005440 Bacteria 1559
55 Ga0070700_100188770 3300005441 Bacteria 1439
56 Ga0070663_100006626 3300005455 Bacteria 6982
57 Ga0070663_100017480 3300005455 Bacteria 4681
58 Ga0070678_100008130 3300005456 Bacteria 6267
59 Ga0070681_10172122 3300005458 Bacteria 2087
60 Ga0068867_100070328 3300005459 Bacteria 2616
61 Ga0070698_100049412 3300005471 Bacteria 4293
62 Ga0070698_100076215 3300005471 Bacteria 3356
63 Ga0070679_100028110 3300005530 Bacteria 5542
64 Ga0068853_100539299 3300005539 Bacteria 1104
65 Ga0070686_100296778 3300005544 Bacteria 1197
66 Ga0070693_100005315 3300005547 Bacteria 6172
67 Ga0068855_100137621 3300005563 Bacteria 2785
68 Ga0068855_100169094 3300005563 Bacteria 2476
69 Ga0070664_100031524 3300005564 Bacteria 4429
70 Ga0068857_100067487 3300005577 Bacteria 3184
71 Ga0068857_100071257 3300005577 Bacteria 3096
72 Ga0068857_100167480 3300005577 Bacteria 1996
73 Ga0068857_100372821 3300005577 Bacteria 1324
74 Ga0068854_100042922 3300005578 Bacteria 3203
75 Ga0068856_100019295 3300005614 Bacteria 6618
76 Ga0068856_100021793 3300005614 Bacteria 6227
77 Ga0068856_100056231 3300005614 Bacteria 3882
78 Ga0068856_100148950 3300005614 Bacteria 2348
79 Ga0070702_100000382 3300005615 Bacteria 15658
80 Ga0070702_100157787 3300005615 Bacteria 1463
81 Ga0068852_100056400 3300005616 Bacteria 3395
82 Ga0068852_100091633 3300005616 Bacteria 2720
83 Ga0068852_100208037 3300005616 Bacteria 1855
84 Ga0068859_100508877 3300005617 Bacteria 1299
85 Ga0068864_100006746 3300005618 Bacteria 9403
86 Ga0068861_100036423 3300005719 Bacteria 3651
87 Ga0068861_100053596 3300005719 Bacteria 3069
88 Ga0068851_10005204 3300005834 Bacteria 5902
89 Ga0068870_10002737 3300005840 Bacteria 7400
90 Ga0068863_100035875 3300005841 Bacteria 4722
91 Ga0068863_100118855 3300005841 Bacteria 2519
92 Ga0068858_100032402 3300005842 Bacteria 4853
93 Ga0068860_100015607 3300005843 Bacteria 7418
94 Ga0068860_100172475 3300005843 Bacteria 2090
95 Ga0070717_10150150 3300006028 Bacteria 2015
96 Ga0070717_10202837 3300006028 Bacteria 1738
97 Ga0075365_10018647 3300006038 Bacteria 4271
98 Ga0075368_10003495 3300006042 Bacteria 5255
99 Ga0075363_100005240 3300006048 Bacteria 5748
100 Ga0075363_100040774 3300006048 Bacteria 2448
101 Ga0075363_100089417 3300006048 Bacteria 1693
102 Ga0075364_10025809 3300006051 Bacteria 3743
103 Ga0075364_10067995 3300006051 Bacteria 2342
104 Ga0075432_10033856 3300006058 Bacteria 1773
105 Ga0070715_10024740 3300006163 Bacteria 2370
106 Ga0070716_100063237 3300006173 Bacteria 2148
107 Ga0070716_100153417 3300006173 Bacteria 1484
108 Ga0070712_100047555 3300006175 Bacteria 2970
109 Ga0075367_10001135 3300006178 Bacteria 11089
110 Ga0097621_100025526 3300006237 Bacteria 4623
111 Ga0097621_100403929 3300006237 Bacteria 1223
112 Ga0068871_100027176 3300006358 Bacteria 4472
113 Ga0075428_100034036 3300006844 Bacteria 5620
114 Ga0075428_100041100 3300006844 Bacteria 5086
115 Ga0075428_100098914 3300006844 Bacteria 3181
116 Ga0075428_100134317 3300006844 Bacteria 2690
117 Ga0075428_100440234 3300006844 Bacteria 1396
118 Ga0075430_100045193 3300006846 Bacteria 3721
119 Ga0075431_100015673 3300006847 Bacteria 7684
120 Ga0075431_100016777 3300006847 Bacteria 7438
121 Ga0075431_100081480 3300006847 Bacteria 3342
122 Ga0075433_10002396 3300006852 Bacteria 14261
123 Ga0075434_100122558 3300006871 Bacteria 2616
124 Ga0075429_100037077 3300006880 Bacteria 4243
125 Ga0068865_100021006 3300006881 Bacteria 4243
126 Ga0075436_100015557 3300006914 Bacteria 5208
127 Ga0075436_100085053 3300006914 Bacteria 2195
128 Ga0097620_100508927 3300006931 Bacteria 1299
129 Ga0075435_100001480 3300007076 Bacteria 15092
130 Ga0075435_100022856 3300007076 Bacteria 4827
131 Ga0105250_10023373 3300009092 Bacteria 2489
132 Ga0111539_10004308 3300009094 Bacteria 18616
133 Ga0111539_10188424 3300009094 Bacteria 2408
134 Ga0105245_10010965 3300009098 Bacteria 7886
135 Ga0105245_10019373 3300009098 Bacteria 5959
136 Ga0105245_10130157 3300009098 Bacteria 2359
137 Ga0105245_10233685 3300009098 Bacteria 1779
138 Ga0105245_10265589 3300009098 Bacteria 1672
139 Ga0105245_10305973 3300009098 Bacteria 1561
140 Ga0105247_10033037 3300009101 Bacteria 3146
141 Ga0114129_10001574 3300009147 Bacteria 30996
142 Ga0114129_10217028 3300009147 Bacteria 2583
143 Ga0105243_10065300 3300009148 Bacteria 2923
144 Ga0105243_10097192 3300009148 Bacteria 2437
145 Ga0105243_10372912 3300009148 Bacteria 1317
146 Ga0105241_10015740 3300009174 Bacteria 5541
147 Ga0105242_10141097 3300009176 Bacteria 2091
148 Ga0105238_10195887 3300009551 Bacteria 1996
149 Ga0105249_10384603 3300009553 Bacteria 1430
150 Ga0105239_10063676 3300010375 Bacteria 4049
151 Ga0105246_10009444 3300011119 Bacteria 6010
152 Ga0105246_10057428 3300011119 Bacteria 2693
153 Ga0105246_10194529 3300011119 Bacteria 1572
154 Ga0105246_10255150 3300011119 Bacteria 1394
155 Ga0157371_10039980 3300013102 Bacteria 3352
156 Ga0157371_10067514 3300013102 Bacteria 2531
157 Ga0157370_10007445 3300013104 Bacteria 11901
158 Ga0157370_10018705 3300013104 Bacteria 6966
159 Ga0157369_10207022 3300013105 Bacteria 2057
160 Ga0157374_10129419 3300013296 Bacteria 2442
161 Ga0157372_10287763 3300013307 Bacteria 1911
162 Ga0157375_10057178 3300013308 Bacteria 3855
163 Ga0163163_10062366 3300014325 Bacteria 3694
164 Ga0163163_10147351 3300014325 Bacteria 2398
165 Ga0182008_10001253 3300014497 Bacteria 17425
166 Ga0157377_10004325 3300014745 Bacteria 6522
167 Ga0157377_10108768 3300014745 Bacteria 1663
168 Ga0157379_10149139 3300014968 Bacteria 2109
169 Ga0157379_10392033 3300014968 Bacteria 1275
170 Ga0157376_10093168 3300014969 Bacteria 2614
171 Ga0182007_10006831 3300015262 Bacteria 4855
172 Ga0183367_1001 3300015688 Bacteria 1225545
173 Ga0163161_10073330 3300017792 Bacteria 2508
174 Ga0163161_10173543 3300017792 Bacteria 1649
175 Ga0206353_10439816 3300020082 Bacteria 3360
176 Ga0206353_11470034 3300020082 Bacteria 1511
177 Ga0213875_10003363 3300021388 Bacteria 9116
178 Ga0224572_1000112 3300024225 Bacteria 6382
179 Ga0209436_100026 3300025208 Bacteria 90859
180 Ga0209129_1000755 3300025258 Bacteria 20560
181 Ga0209233_1000068 3300025261 Bacteria 377969
182 Ga0209130_1000030 3300025284 Bacteria 323323
183 Ga0209758_1000586 3300025297 Bacteria 56819
184 Ga0207426_1000047 3300025302 Bacteria 417011
185 Ga0209051_1003256 3300025303 Bacteria 10787
186 Ga0209257_1013019 3300025304 Bacteria 3754
187 Ga0207656_10094493 3300025321 Bacteria 1362
188 Ga0207692_10018764 3300025898 Bacteria 3111
189 Ga0207688_10009664 3300025901 Bacteria 5251
190 Ga0207688_10013825 3300025901 Bacteria 4386
191 Ga0207688_10023013 3300025901 Bacteria 3410
192 Ga0207688_10145131 3300025901 Bacteria 1399
193 Ga0207688_10153747 3300025901 Bacteria 1360
194 Ga0207647_10015251 3300025904 Bacteria 5275
195 Ga0207685_10056463 3300025905 Bacteria 1537
196 Ga0207645_10048199 3300025907 Bacteria 2720
197 Ga0207645_10085247 3300025907 Bacteria 2028
198 Ga0207643_10000027 3300025908 Bacteria 99423
199 Ga0207643_10048642 3300025908 Bacteria 2402
200 Ga0207705_10056214 3300025909 Bacteria 2837
201 Ga0207707_10035341 3300025912 Bacteria 4370
202 Ga0207707_10221652 3300025912 Bacteria 1646
203 Ga0207693_10095241 3300025915 Bacteria 2334
204 Ga0207693_10179859 3300025915 Bacteria 1664
205 Ga0207693_10196769 3300025915 Bacteria 1585
206 Ga0207660_10218384 3300025917 Bacteria 1495
207 Ga0207662_10022691 3300025918 Bacteria 3601
208 Ga0207657_10115225 3300025919 Bacteria 2215
209 Ga0207657_10234530 3300025919 Bacteria 1467
210 Ga0207649_10003298 3300025920 Bacteria 8835
211 Ga0207652_10004900 3300025921 Bacteria 10831
212 Ga0207650_10001414 3300025925 Bacteria 17301
213 Ga0207659_10028183 3300025926 Bacteria 3814
214 Ga0207687_10108804 3300025927 Bacteria 2053
215 Ga0207687_10113803 3300025927 Bacteria 2013
216 Ga0207687_10144169 3300025927 Bacteria 1810
217 Ga0207687_10291035 3300025927 Bacteria 1313
218 Ga0207700_10030399 3300025928 Bacteria 3825
219 Ga0207700_10135387 3300025928 Bacteria 2017
220 Ga0207700_10206722 3300025928 Bacteria 1657
221 Ga0207664_10056401 3300025929 Bacteria 3120
222 Ga0207690_10107085 3300025932 Bacteria 2007
223 Ga0207686_10165987 3300025934 Bacteria 1552
224 Ga0207704_10207412 3300025938 Bacteria 1439
225 Ga0207665_10160472 3300025939 Bacteria 1617
226 Ga0207691_10081164 3300025940 Bacteria 2915
227 Ga0207691_10091483 3300025940 Bacteria 2726
228 Ga0207711_10372192 3300025941 Bacteria 1325
229 Ga0207689_10004346 3300025942 Bacteria 12911
230 Ga0207689_10077742 3300025942 Bacteria 2727
231 Ga0207661_10012002 3300025944 Bacteria 6294
232 Ga0207661_10044055 3300025944 Bacteria 3524
233 Ga0207661_10278701 3300025944 Bacteria 1494
234 Ga0207679_10009014 3300025945 Bacteria 6377
235 Ga0207667_10048066 3300025949 Bacteria 4513
236 Ga0207651_10037039 3300025960 Bacteria 3192
237 Ga0207668_10028898 3300025972 Bacteria 3630
238 Ga0207668_10212793 3300025972 Bacteria 1547
239 Ga0207640_10057346 3300025981 Bacteria 2561
240 Ga0207640_10156958 3300025981 Bacteria 1678
241 Ga0207658_10120660 3300025986 Bacteria 2090
242 Ga0207658_10172866 3300025986 Bacteria 1782
243 Ga0207703_10050888 3300026035 Bacteria 3354
244 Ga0207639_10452868 3300026041 Bacteria 1165
245 Ga0207678_10000662 3300026067 Bacteria 31648
246 Ga0207708_10018814 3300026075 Bacteria 5203
247 Ga0207708_10066883 3300026075 Bacteria 2748
248 Ga0207708_10067211 3300026075 Bacteria 2742
249 Ga0207702_10001188 3300026078 Bacteria 26420
250 Ga0207702_10010960 3300026078 Bacteria 7562
251 Ga0207702_10020919 3300026078 Bacteria 5414
252 Ga0207641_10042523 3300026088 Bacteria 3812
253 Ga0207676_10011868 3300026095 Bacteria 6234
254 Ga0207674_10006429 3300026116 Bacteria 13816
255 Ga0207674_10242599 3300026116 Bacteria 1749
256 Ga0207674_10478507 3300026116 Bacteria 1204
257 Ga0207675_100012606 3300026118 Bacteria 7897
258 Ga0207675_100061836 3300026118 Bacteria 3496
259 Ga0207683_10002218 3300026121 Bacteria 17085
260 Ga0207683_10279266 3300026121 Bacteria 1526
261 Ga0207698_10025400 3300026142 Bacteria 4173
262 Ga0207698_10081872 3300026142 Bacteria 2607
263 Ga0207428_10002503 3300027907 Bacteria 18349
264 Ga0207428_10056489 3300027907 Bacteria 3119
265 Ga0268266_10056653 3300028379 Bacteria 3372
266 Ga0268264_10035849 3300028381 Bacteria 4085
267 Ga0307517_10022489 3300028786 Bacteria 7895
268 Ga0307515_10022984 3300028794 Bacteria 10961
269 Ga0307515_10067479 3300028794 Bacteria 4932
270 Ga0307512_10014920 3300030522 Bacteria 7222
271 Ga0307513_10183056 3300031456 Bacteria 1956
272 Ga0307408_100246880 3300031548 Bacteria 1470
273 Ga0307508_10005047 3300031616 Bacteria 12676
274 Ga0307508_10009146 3300031616 Bacteria 9123
275 Ga0307508_10017515 3300031616 Bacteria 6512
276 Ga0307516_10001110 3300031730 Bacteria 37506
277 Ga0307516_10010982 3300031730 Bacteria 9898
278 Ga0307516_10035268 3300031730 Bacteria 5021
279 Ga0307516_10077394 3300031730 Bacteria 3175
280 Ga0307410_10147355 3300031852 Bacteria 1748
281 Ga0307406_10054115 3300031901 Bacteria 2560
282 Ga0307406_10090429 3300031901 Bacteria 2060
283 Ga0307407_10006926 3300031903 Bacteria 5093
284 Ga0307412_10302409 3300031911 Bacteria 1265
285 Ga0307409_100192151 3300031995 Bacteria 1818
286 Ga0307409_100254357 3300031995 Bacteria 1608
287 Ga0307409_100450271 3300031995 Bacteria 1242
288 Ga0307416_100053639 3300032002 Bacteria 3236
289 Ga0307416_100055376 3300032002 Bacteria 3194
290 Ga0307414_10037088 3300032004 Bacteria 3261
291 Ga0307414_10177682 3300032004 Bacteria 1709
292 Ga0307411_10056093 3300032005 Bacteria 2595
293 Ga0307415_100106504 3300032126 Bacteria 2070
294 Ga0373950_0008549 3300034818 Bacteria 1614
295 Ga0373959_0024467 3300034820 Bacteria 1180
296 Ga0373938_0022720 3300034957 Bacteria 1284
297 Ga0373951_0000019 3300035091 Bacteria 63710
298 Ga0373936_0070667 3300035113 Bacteria 1438
299 Ga0373943_0096884 3300035170 Bacteria 1536
300 Ga0373962_0040318 3300035242 Bacteria 1313
301 Ga0373947_0199820 3300035725 Bacteria 1308
302 Ga0373937_0452341 3300036401 Bacteria 1219
303 Ga0395899_0021027 3300037312 Bacteria 4949
304 Ga0395900_0010983 3300037418 Bacteria 9262
305 Ga0395900_0066140 3300037418 Bacteria 3715
306 Ga0395898_0002705 3300037466 Bacteria 20474
307 Ga0395898_0023284 3300037466 Bacteria 6258
308 Ga0395898_0025073 3300037466 Bacteria 6012
309 Ga0395898_0123469 3300037466 Bacteria 2481
310 Ga0395905_0004921 3300037471 Bacteria 13759
311 Ga0436364_0286659 3300037853 Bacteria 12967
312 Ga0436364_0625262 3300037853 Bacteria 1711
313 Ga0395901_0009925 3300038443 Bacteria 9651
314 Ga0395901_0034769 3300038443 Bacteria 5206
315 Ga0395901_0066621 3300038443 Bacteria 3751
316 Ga0395901_0148884 3300038443 Bacteria 2460
317 Ga0395901_0192661 3300038443 Bacteria 2138
318 Ga0451789_1275942 3300041443 Bacteria 1608
319 Ga0451793_0901224 3300041452 Bacteria 8183
320 Ga0451793_1621772 3300041452 Bacteria 3881
321 Ga0451833_1195762 3300041491 Bacteria 1991
322 Ga0451841_0566005 3300041498 Bacteria 1743
323 Ga0451849_0096531 3300041505 Bacteria 1710
324 Ga0451843_1637094 3300041509 Bacteria 3976
325 Ga0451853_0970575 3300041512 Bacteria 10503
326 Ga0451853_2069982 3300041512 Bacteria 5911
327 Ga0439448_0002961 3300042005 Bacteria 4659
328 Ga0439448_0025371 3300042005 Bacteria 1859
329 Ga0439463_004853 3300042016 Bacteria 3361
330 Ga0450903_000618 3300042138 Bacteria 7184
331 Ga0439458_0020604 3300042157 Bacteria 1523
332 Ga0439459_0000765 3300042438 Bacteria 4420
333 Ga0439464_0002766 3300042439 Bacteria 4353
334 Ga0439440_0040691 3300042993 Bacteria 1132
335 Ga0466969_0049026 3300044656 Bacteria 2086
336 Ga0466972_0014799 3300044658 Bacteria 3903
337 Ga0466965_0000288 3300044683 Bacteria 16687
338 Ga0466965_0080537 3300044683 Bacteria 1646
339 Ga0466966_0008623 3300044684 Bacteria 6748
340 Ga0466966_0059431 3300044684 Bacteria 2414
341 Ga0466961_0016710 3300044693 Bacteria 4718
342 Ga0466963_0000407 3300044694 Bacteria 19711
343 Ga0466963_0007390 3300044694 Bacteria 6545
344 Ga0466963_0213299 3300044694 Bacteria 1351
345 Ga0466964_0003528 3300044706 Bacteria 5715
346 Ga0466971_0001045 3300044719 Bacteria 11476
347 Ga0466970_0001450 3300044765 Bacteria 11479
348 Ga0466957_0004375 3300044842 Bacteria 7857
349 Ga0466957_0337542 3300044842 Bacteria 1020
350 Ga0466960_0011604 3300044901 Bacteria 3693
351 Ga0466959_0007571 3300045049 Bacteria 7631
352 Ga0466967_0011811 3300045976 Bacteria 6642
353 Ga0466967_0013565 3300045976 Bacteria 6303
354 Ga0466967_0028970 3300045976 Bacteria 4629
355 Ga0466967_0029886 3300045976 Bacteria 4566
356 Ga0466967_0114834 3300045976 Bacteria 2479
357 Ga0495651_0056912 3300046462 Bacteria 3002
358 Ga0495653_0047675 3300046463 Bacteria 3313
359 Ga0495643_0002710 3300046522 Bacteria 13641
360 Ga0495652_0136576 3300046529 Bacteria 1934
361 Ga0495665_0094501 3300046531 Bacteria 1570
362 Ga0495668_0000128 3300046616 Bacteria 113090
363 Ga0495625_0125867 3300046660 Bacteria 1740
364 Ga0495658_0102803 3300046683 Bacteria 1708
365 Ga0495670_0007291 3300046691 Bacteria 5435
366 Ga0495589_0061645 3300046794 Bacteria 1840
367 Ga0495581_0200255 3300047315 Bacteria 1168
368 Ga0495636_0031973 3300047318 Bacteria 2158
369 Ga0495676_0093852 3300047321 Bacteria 2237
370 Ga0495676_0210146 3300047321 Bacteria 1347
371 Ga0495680_0106760 3300047322 Bacteria 2080
372 Ga0495687_011432 3300047443 Bacteria 4775
373 Ga0495687_013809 3300047443 Bacteria 4191
374 Ga0495679_016103 3300047446 Bacteria 2713
375 Ga0495685_002934 3300047447 Bacteria 5394
376 Ga0495685_015891 3300047447 Bacteria 2571
377 Ga0495681_0014664 3300047470 Bacteria 4479
378 Ga0495602_0226640 3300048088 Bacteria 1407
379 Ga0496100_0045427 3300048903 Bacteria 2819
380 Ga0496100_0080594 3300048903 Bacteria 2197
381 Ga0496100_0235502 3300048903 Bacteria 1349
382 Ga0496101_0152973 3300048904 Bacteria 1765
383 Ga0496102_0126871 3300048905 Bacteria 2386
384 Ga0496102_0159203 3300048905 Bacteria 2123
385 Ga0496102_0192978 3300048905 Bacteria 1919
386 Ga0496103_0031484 3300048906 Bacteria 3232
387 Ga0496103_0094506 3300048906 Bacteria 1889
388 Ga0496103_0178663 3300048906 Bacteria 1364
389 Ga0496104_0001170 3300048907 Bacteria 22501
390 Ga0496104_0142839 3300048907 Bacteria 2300
391 Ga0496105_0006599 3300048908 Bacteria 8934
392 Ga0496106_0008317 3300048909 Bacteria 7678
393 Ga0496106_0045013 3300048909 Bacteria 3314
394 Ga0496106_0051565 3300048909 Bacteria 3103
395 Ga0496107_0022541 3300048910 Bacteria 4450
396 Ga0496107_0114771 3300048910 Bacteria 1982
397 Ga0496108_0002125 3300048911 Bacteria 15875
398 Ga0496108_0072797 3300048911 Bacteria 2901
399 Ga0496108_0080775 3300048911 Bacteria 2755
400 Ga0496109_0050350 3300048912 Bacteria 3794
401 Ga0496109_0055058 3300048912 Bacteria 3629
402 Ga0496109_0115719 3300048912 Bacteria 2495
403 Ga0496109_0189088 3300048912 Bacteria 1935
404 Ga0496110_0002646 3300048913 Bacteria 13499
405 Ga0496110_0111410 3300048913 Bacteria 2460
406 Ga0496110_0125156 3300048913 Bacteria 2319
407 Ga0496110_0322680 3300048913 Bacteria 1407
408 Ga0496111_0356391 3300048914 Bacteria 1083
409 Ga0496112_0043873 3300048915 Bacteria 4378
410 Ga0496112_0109233 3300048915 Bacteria 2736
411 Ga0496113_0044877 3300048916 Bacteria 3275
412 Ga0496114_0036187 3300048917 Bacteria 4080
413 Ga0496114_0072364 3300048917 Bacteria 2899
414 Ga0496114_0088731 3300048917 Bacteria 2623
415 Ga0496114_0130995 3300048917 Bacteria 2165
416 Ga0496114_0187933 3300048917 Bacteria 1806
417 Ga0496114_0357499 3300048917 Bacteria 1292
418 Ga0496114_0680413 3300048917 Bacteria 903
419 Ga0496115_0045886 3300048918 Bacteria 3490
420 Ga0496126_0000013 3300048929 Bacteria 690046
421 Ga0501031_0006068 3300049568 Bacteria 7889
422 Ga0501032_0098136 3300049569 Bacteria 1941
423 Ga0501033_0022434 3300049570 Bacteria 4762
424 Ga0501033_0033137 3300049570 Bacteria 3879
425 Ga0501033_0131872 3300049570 Bacteria 1810
426 Ga0501034_0035780 3300049571 Bacteria 5033
427 Ga0501034_0053350 3300049571 Bacteria 4071
428 Ga0501034_0095213 3300049571 Bacteria 2974
429 Ga0501036_0117493 3300049572 Bacteria 2246
430 Ga0501037_0042996 3300049573 Bacteria 3320
431 Ga0501039_0170821 3300049575 Bacteria 1709
432 Ga0501042_0004136 3300049578 Bacteria 9225
433 Ga0501043_0016086 3300049579 Bacteria 5867
434 Ga0501043_0063003 3300049579 Bacteria 2912
435 Ga0501047_0031348 3300049581 Bacteria 5126
436 Ga0501047_0079054 3300049581 Bacteria 3162
437 Ga0501047_0187906 3300049581 Bacteria 1930
438 Ga0501048_0078871 3300049582 Bacteria 2324
439 Ga0501067_0000945 3300049583 Bacteria 15577
440 Ga0501069_0106308 3300049585 Bacteria 1595
441 Ga0501073_0350211 3300049589 Bacteria 1020
442 Ga0501209_035382 3300049656 Bacteria 1293
443 Ga0501035_0063613 3300049822 Bacteria 3281
444 Ga0501044_0004785 3300049823 Bacteria 15145
445 Ga0501044_0031906 3300049823 Bacteria 5540
446 Ga0501044_0102524 3300049823 Bacteria 2877
447 nmdc:mga03n38_49228_c1 3300050490 Bacteria 1873
448 nmdc:mga00v17_60340_c1 3300050491 Bacteria 2329
449 nmdc:mga0yw44_104001_c1 3300050492 Bacteria 1812
450 nmdc:mga0yw44_154324_c1 3300050492 Bacteria 1499
451 nmdc:mga07m45_65807_c2 3300050496 Bacteria 1540
452 nmdc:mga05p37_11378_c1 3300050507 Bacteria 10589
453 nmdc:mga05p37_211101_c1 3300050507 Bacteria 2347
454 nmdc:mga09592_15547_c1 3300050508 Bacteria 6221
455 nmdc:mga0qj67_8134_c1 3300050509 Bacteria 7767
456 nmdc:mga06r32_19108_c1 3300050510 Bacteria 6286
457 nmdc:mga06r32_365897_c1 3300050510 Bacteria 1426
458 nmdc:mga06r32_60599_c1 3300050510 Bacteria 3642
459 nmdc:mga08y16_102770_c1 3300050511 Bacteria 2975
460 nmdc:mga08y16_2287_c1 3300050511 Bacteria 19618
461 nmdc:mga08y16_362061_c1 3300050511 Bacteria 1489
462 nmdc:mga08y16_66007_c1 3300050511 Bacteria 3777
463 nmdc:mga0n895_126211_c1 3300050512 Bacteria 2583
464 nmdc:mga0rr50_125938_c1 3300050513 Bacteria 2046
465 nmdc:mga0rr50_305870_c1 3300050513 Bacteria 1331
466 nmdc:mga08x19_5782_c1 3300050514 Bacteria 7309
467 nmdc:mga0a205_19434_c1 3300050515 Bacteria 6404
468 Ga0495595_0058222 3300053084 Bacteria 1804
469 Ga0495619_0093829 3300053085 Bacteria 2035
470 Ga0500578_0046804 3300053086 Bacteria 2775
471 Ga0500650_0025329 3300053098 Bacteria 2652
472 Ga0500553_065809 3300053101 Bacteria 1682
473 Ga0500560_000404 3300053107 Bacteria 5862
474 Ga0500569_000761 3300053109 Bacteria 5643
475 Ga0500594_0000945 3300053118 Bacteria 6250
476 Ga0500652_002257 3300053131 Bacteria 5790
477 Ga0500652_014215 3300053131 Bacteria 2841
478 Ga0500658_0004248 3300053134 Bacteria 5373
479 Ga0500561_0000666 3300053137 Bacteria 5441
480 Ga0500588_0019960 3300053146 Bacteria 1790
481 Ga0500600_0036907 3300053149 Bacteria 2836
482 Ga0500616_0000755 3300053153 Bacteria 37233
483 Ga0500616_0067091 3300053153 Bacteria 1840
484 Ga0500633_0006280 3300053160 Bacteria 2901
485 Ga0466962_0000233 3300061719 Bacteria 23138

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0680413 Ga0496114_0680413_20_865 270
2 3300005616 Ga0068852_100056400 Ga0068852_1000564004 299
3 3300044842 Ga0466957_0337542 Ga0466957_0337542_63_1004 309
4 3300049589 Ga0501073_0350211 Ga0501073_0350211_19_1005 309
5 3300032005 Ga0307411_10056093 Ga0307411_100560932 310
6 3300005347 Ga0070668_100043684 Ga0070668_1000436842 311
7 3300005367 Ga0070667_100323165 Ga0070667_1003231652 311
8 3300005843 Ga0068860_100172475 Ga0068860_1001724752 311
9 3300025972 Ga0207668_10028898 Ga0207668_100288984 311
10 3300026035 Ga0207703_10050888 Ga0207703_100508882 311
11 3300036401 Ga0373937_0452341 Ga0373937_0452341_210_1205 313
12 3300028794 Ga0307515_10022984 Ga0307515_100229843 315
13 3300013102 Ga0157371_10067514 Ga0157371_100675143 318
14 3300013307 Ga0157372_10287763 Ga0157372_102877632 318
15 3300014968 Ga0157379_10392033 Ga0157379_103920331 318
16 3300006358 Ga0068871_100027176 Ga0068871_1000271762 321
17 3300049579 Ga0501043_0063003 Ga0501043_0063003_1842_2873 321
18 3300049823 Ga0501044_0031906 Ga0501044_0031906_2697_3728 321
19 3300005327 Ga0070658_10004588 Ga0070658_100045888 322
20 3300005328 Ga0070676_10014748 Ga0070676_100147485 322
21 3300005331 Ga0070670_100060122 Ga0070670_1000601222 322
22 3300005334 Ga0068869_100004228 Ga0068869_1000042286 322
23 3300005336 Ga0070680_100003234 Ga0070680_1000032345 322
24 3300005337 Ga0070682_100002451 Ga0070682_1000024517 322
25 3300005338 Ga0068868_100005180 Ga0068868_1000051805 322
26 3300005339 Ga0070660_100029230 Ga0070660_1000292304 322
27 3300005340 Ga0070689_100052309 Ga0070689_1000523092 322
28 3300005341 Ga0070691_10005633 Ga0070691_100056334 322
29 3300005343 Ga0070687_100179073 Ga0070687_1001790731 322
30 3300005344 Ga0070661_100050120 Ga0070661_1000501202 322
31 3300005354 Ga0070675_100005835 Ga0070675_1000058355 322
32 3300005355 Ga0070671_100002212 Ga0070671_1000022123 322
33 3300005364 Ga0070673_100125409 Ga0070673_1001254092 322
34 3300005366 Ga0070659_100039165 Ga0070659_1000391652 322
35 3300005455 Ga0070663_100006626 Ga0070663_1000066264 322
36 3300005456 Ga0070678_100008130 Ga0070678_1000081304 322
37 3300005458 Ga0070681_10172122 Ga0070681_101721221 322
38 3300005530 Ga0070679_100028110 Ga0070679_1000281104 322
39 3300005539 Ga0068853_100539299 Ga0068853_1005392991 322
40 3300005544 Ga0070686_100296778 Ga0070686_1002967781 322
41 3300005547 Ga0070693_100005315 Ga0070693_1000053156 322
42 3300005563 Ga0068855_100137621 Ga0068855_1001376212 322
43 3300005564 Ga0070664_100031524 Ga0070664_1000315242 322
44 3300005577 Ga0068857_100167480 Ga0068857_1001674802 322
45 3300005578 Ga0068854_100042922 Ga0068854_1000429222 322
46 3300005614 Ga0068856_100056231 Ga0068856_1000562312 322
47 3300005615 Ga0070702_100000382 Ga0070702_1000003823 322
48 3300005618 Ga0068864_100006746 Ga0068864_1000067466 322
49 3300005834 Ga0068851_10005204 Ga0068851_100052049 322
50 3300005840 Ga0068870_10002737 Ga0068870_100027372 322
51 3300005841 Ga0068863_100035875 Ga0068863_1000358753 322
52 3300005843 Ga0068860_100015607 Ga0068860_1000156074 322
53 3300006058 Ga0075432_10033856 Ga0075432_100338562 322
54 3300006237 Ga0097621_100025526 Ga0097621_1000255261 322
55 3300006844 Ga0075428_100134317 Ga0075428_1001343172 322
56 3300006847 Ga0075431_100081480 Ga0075431_1000814802 322
57 3300006852 Ga0075433_10002396 Ga0075433_1000239611 322
58 3300006914 Ga0075436_100015557 Ga0075436_1000155574 322
59 3300007076 Ga0075435_100001480 Ga0075435_1000014804 322
60 3300009098 Ga0105245_10010965 Ga0105245_100109657 322
61 3300009101 Ga0105247_10033037 Ga0105247_100330373 322
62 3300009174 Ga0105241_10015740 Ga0105241_100157407 322
63 3300010375 Ga0105239_10063676 Ga0105239_100636762 322
64 3300011119 Ga0105246_10009444 Ga0105246_100094442 322
65 3300013104 Ga0157370_10018705 Ga0157370_100187052 322
66 3300013105 Ga0157369_10207022 Ga0157369_102070222 322
67 3300013296 Ga0157374_10129419 Ga0157374_101294192 322
68 3300014325 Ga0163163_10062366 Ga0163163_100623664 322
69 3300014745 Ga0157377_10004325 Ga0157377_100043257 322
70 3300020082 Ga0206353_10439816 Ga0206353_104398163 322
71 3300025321 Ga0207656_10094493 Ga0207656_100944932 322
72 3300025901 Ga0207688_10013825 Ga0207688_100138254 322
73 3300025907 Ga0207645_10085247 Ga0207645_100852472 322
74 3300025908 Ga0207643_10000027 Ga0207643_1000002716 322
75 3300025909 Ga0207705_10056214 Ga0207705_100562144 322
76 3300025912 Ga0207707_10035341 Ga0207707_100353412 322
77 3300025917 Ga0207660_10218384 Ga0207660_102183842 322
78 3300025918 Ga0207662_10022691 Ga0207662_100226911 322
79 3300025919 Ga0207657_10115225 Ga0207657_101152252 322
80 3300025920 Ga0207649_10003298 Ga0207649_100032984 322
81 3300025921 Ga0207652_10004900 Ga0207652_100049002 322
82 3300025925 Ga0207650_10001414 Ga0207650_100014146 322
83 3300025926 Ga0207659_10028183 Ga0207659_100281833 322
84 3300025927 Ga0207687_10108804 Ga0207687_101088042 322
85 3300025932 Ga0207690_10107085 Ga0207690_101070852 322
86 3300025942 Ga0207689_10004346 Ga0207689_100043464 322
87 3300025944 Ga0207661_10012002 Ga0207661_100120025 322
88 3300025945 Ga0207679_10009014 Ga0207679_100090146 322
89 3300025949 Ga0207667_10048066 Ga0207667_100480664 322
90 3300025960 Ga0207651_10037039 Ga0207651_100370392 322
91 3300025981 Ga0207640_10156958 Ga0207640_101569582 322
92 3300026041 Ga0207639_10452868 Ga0207639_104528681 322
93 3300026067 Ga0207678_10000662 Ga0207678_1000066234 322
94 3300026075 Ga0207708_10067211 Ga0207708_100672111 322
95 3300026078 Ga0207702_10001188 Ga0207702_1000118810 322
96 3300026088 Ga0207641_10042523 Ga0207641_100425234 322
97 3300026095 Ga0207676_10011868 Ga0207676_100118686 322
98 3300026116 Ga0207674_10242599 Ga0207674_102425992 322
99 3300026121 Ga0207683_10002218 Ga0207683_1000221816 322
100 3300026142 Ga0207698_10025400 Ga0207698_100254003 322
101 3300027907 Ga0207428_10002503 Ga0207428_100025039 322
102 3300028381 Ga0268264_10035849 Ga0268264_100358493 322
103 3300048905 Ga0496102_0192978 Ga0496102_0192978_212_1240 322
104 3300048906 Ga0496103_0031484 Ga0496103_0031484_1662_2690 322
105 3300048907 Ga0496104_0001170 Ga0496104_0001170_11151_12179 322
106 3300048908 Ga0496105_0006599 Ga0496105_0006599_2699_3727 322
107 3300048909 Ga0496106_0008317 Ga0496106_0008317_1620_2648 322
108 3300048910 Ga0496107_0022541 Ga0496107_0022541_3041_4069 322
109 3300048911 Ga0496108_0002125 Ga0496108_0002125_3878_4906 322
110 3300048913 Ga0496110_0002646 Ga0496110_0002646_9639_10667 322
111 3300048915 Ga0496112_0043873 Ga0496112_0043873_372_1400 322
112 3300048916 Ga0496113_0044877 Ga0496113_0044877_1876_2904 322
113 3300048917 Ga0496114_0036187 Ga0496114_0036187_270_1289 322
114 3300048918 Ga0496115_0045886 Ga0496115_0045886_1531_2559 322
115 3300050511 nmdc:mga08y16_66007_c1 nmdc:mga08y16_66007_c1_1803_2831 322
116 3300050512 nmdc:mga0n895_126211_c1 nmdc:mga0n895_126211_c1_695_1723 322
117 3300050513 nmdc:mga0rr50_125938_c1 nmdc:mga0rr50_125938_c1_439_1467 322
118 3300050514 nmdc:mga08x19_5782_c1 nmdc:mga08x19_5782_c1_2669_3697 322
119 3300050515 nmdc:mga0a205_19434_c1 nmdc:mga0a205_19434_c1_1880_2908 322
120 3300005614 Ga0068856_100019295 Ga0068856_1000192952 323
121 3300026078 Ga0207702_10010960 Ga0207702_100109601 323
122 3300001991 JGI24743J22301_10020017 JGI24743J22301_100200171 324
123 3300014969 Ga0157376_10093168 Ga0157376_100931683 324
124 3300025938 Ga0207704_10207412 Ga0207704_102074121 324
125 3300026075 Ga0207708_10018814 Ga0207708_100188145 324
126 3300031730 Ga0307516_10035268 Ga0307516_100352682 324
127 3300042005 Ga0439448_0002961 Ga0439448_0002961_1634_2662 324
128 3300042438 Ga0439459_0000765 Ga0439459_0000765_577_1605 324
129 3300042439 Ga0439464_0002766 Ga0439464_0002766_2427_3455 324
130 3300047315 Ga0495581_0200255 Ga0495581_0200255_55_1086 324
131 3300048917 Ga0496114_0088731 Ga0496114_0088731_830_1861 324
132 3300049571 Ga0501034_0095213 Ga0501034_0095213_209_1240 324
133 3300046683 Ga0495658_0102803 Ga0495658_0102803_16_1059 325
134 3300050510 nmdc:mga06r32_60599_c1 nmdc:mga06r32_60599_c1_1801_2949 325
135 3300006844 Ga0075428_100041100 Ga0075428_1000411001 327
136 3300006847 Ga0075431_100015673 Ga0075431_1000156732 327
137 3300006880 Ga0075429_100037077 Ga0075429_1000370773 327
138 3300009147 Ga0114129_10001574 Ga0114129_1000157429 327
139 3300031995 Ga0307409_100254357 Ga0307409_1002543572 327
140 3300032004 Ga0307414_10037088 Ga0307414_100370882 327
141 3300049581 Ga0501047_0031348 Ga0501047_0031348_2051_3154 327
142 3300050507 nmdc:mga05p37_11378_c1 nmdc:mga05p37_11378_c1_9370_10398 327
143 3300050510 nmdc:mga06r32_365897_c1 nmdc:mga06r32_365897_c1_157_1185 327
144 3300005438 Ga0070701_10100200 Ga0070701_101002001 328
145 3300009094 Ga0111539_10188424 Ga0111539_101884242 328
146 3300031852 Ga0307410_10147355 Ga0307410_101473552 328
147 3300037466 Ga0395898_0025073 Ga0395898_0025073_3389_4429 328
148 3300038443 Ga0395901_0192661 Ga0395901_0192661_1015_2055 328
149 3300038443 Ga0395901_0066621 Ga0395901_0066621_2041_3087 329
150 3300053107 Ga0500560_000404 Ga0500560_000404_972_2057 329
151 3300003354 JGI25160J50197_1016954 JGI25160J50197_10169542 330
152 3300005356 Ga0070674_100214725 Ga0070674_1002147252 330
153 3300013308 Ga0157375_10057178 Ga0157375_100571783 330
154 3300025901 Ga0207688_10153747 Ga0207688_101537471 330
155 3300025944 Ga0207661_10278701 Ga0207661_102787011 330
156 3300037312 Ga0395899_0021027 Ga0395899_0021027_3831_4895 330
157 3300037466 Ga0395898_0123469 Ga0395898_0123469_1312_2376 330
158 3300038443 Ga0395901_0034769 Ga0395901_0034769_2953_4017 330
159 3300044694 Ga0466963_0000407 Ga0466963_0000407_10412_11452 330
160 3300045976 Ga0466967_0011811 Ga0466967_0011811_1920_2960 330
161 3300048917 Ga0496114_0130995 Ga0496114_0130995_278_1306 330
162 3300006051 Ga0075364_10025809 Ga0075364_100258092 331
163 3300031901 Ga0307406_10090429 Ga0307406_100904292 331
164 3300002739 JGI25158J39367_1000032 JGI25158J39367_100003211 332
165 3300002773 JGI25152J39213_1006252 JGI25152J39213_10062522 332
166 3300002987 JGI25159J45721_1001948 JGI25159J45721_10019483 332
167 3300002987 JGI25159J45721_1004540 JGI25159J45721_10045404 332
168 3300003215 JGI25153J46596_10003140 JGI25153J46596_100031409 332
169 3300003374 JGI25161J50226_1000129 JGI25161J50226_100012915 332
170 3300004625 Ga0055543_1000029 Ga0055543_100002984 332
171 3300005262 Ga0065165_1011090 Ga0065165_10110902 332
172 3300005435 Ga0070714_100178055 Ga0070714_1001780552 332
173 3300025208 Ga0209436_100026 Ga0209436_10002645 332
174 3300025258 Ga0209129_1000755 Ga0209129_10007551 332
175 3300025284 Ga0209130_1000030 Ga0209130_100003042 332
176 3300025297 Ga0209758_1000586 Ga0209758_100058610 332
177 3300025302 Ga0207426_1000047 Ga0207426_1000047358 332
178 3300025303 Ga0209051_1003256 Ga0209051_100325610 332
179 3300025304 Ga0209257_1013019 Ga0209257_10130192 332
180 3300005337 Ga0070682_100013826 Ga0070682_1000138262 334
181 3300005339 Ga0070660_100161196 Ga0070660_1001611962 334
182 3300005343 Ga0070687_100116342 Ga0070687_1001163422 334
183 3300005347 Ga0070668_100038719 Ga0070668_1000387193 334
184 3300005354 Ga0070675_100090936 Ga0070675_1000909361 334
185 3300005441 Ga0070700_100188770 Ga0070700_1001887702 334
186 3300005455 Ga0070663_100017480 Ga0070663_1000174804 334
187 3300005577 Ga0068857_100071257 Ga0068857_1000712572 334
188 3300005614 Ga0068856_100148950 Ga0068856_1001489502 334
189 3300005616 Ga0068852_100208037 Ga0068852_1002080371 334
190 3300005719 Ga0068861_100053596 Ga0068861_1000535964 334
191 3300005841 Ga0068863_100118855 Ga0068863_1001188552 334
192 3300005842 Ga0068858_100032402 Ga0068858_1000324022 334
193 3300006881 Ga0068865_100021006 Ga0068865_1000210064 334
194 3300009098 Ga0105245_10233685 Ga0105245_102336852 334
195 3300009148 Ga0105243_10065300 Ga0105243_100653002 334
196 3300009553 Ga0105249_10384603 Ga0105249_103846032 334
197 3300011119 Ga0105246_10057428 Ga0105246_100574282 334
198 3300011119 Ga0105246_10255150 Ga0105246_102551502 334
199 3300014325 Ga0163163_10147351 Ga0163163_101473513 334
200 3300014968 Ga0157379_10149139 Ga0157379_101491393 334
201 3300025901 Ga0207688_10009664 Ga0207688_100096642 334
202 3300025907 Ga0207645_10048199 Ga0207645_100481992 334
203 3300025908 Ga0207643_10048642 Ga0207643_100486423 334
204 3300025942 Ga0207689_10077742 Ga0207689_100777422 334
205 3300025981 Ga0207640_10057346 Ga0207640_100573462 334
206 3300025986 Ga0207658_10172866 Ga0207658_101728661 334
207 3300026075 Ga0207708_10066883 Ga0207708_100668833 334
208 3300026116 Ga0207674_10478507 Ga0207674_104785071 334
209 3300026118 Ga0207675_100061836 Ga0207675_1000618362 334
210 3300048913 Ga0496110_0125156 Ga0496110_0125156_1204_2250 334
211 3300050511 nmdc:mga08y16_362061_c1 nmdc:mga08y16_362061_c1_308_1354 334
212 3300031901 Ga0307406_10054115 Ga0307406_100541152 335
213 3300031903 Ga0307407_10006926 Ga0307407_100069265 335
214 iso_pu_bacteria 2547132111 2547412335 335
215 iso_pu_bacteria 2582581313 2585304195 335
216 iso_pu_bacteria 2582581314 2585319064 335
217 iso_pu_bacteria 2643221647 2644270414 335
218 iso_pu_bacteria 2643221678 2644440914 335
219 iso_pu_bacteria 2643221714 2644631525 335
220 iso_pu_bacteria 2784746768 2785373259 335
221 iso_pu_bacteria 2786546132 2786674724 335
222 iso_pu_bacteria 2808606359 2808845363 335
223 iso_pu_bacteria 2808606375 2808915116 335
224 iso_pu_bacteria 2808606448 2809235634 335
225 iso_pu_bacteria 2811994917 2812482860 335
226 iso_pu_bacteria 2862281513 2862282987 335
227 iso_pu_bacteria 2862507626 2862507683 335
228 iso_pu_bacteria 2877676314 2877677652 335
229 iso_pu_bacteria 2912715099 2912715861 335
230 iso_pu_bacteria 2919468124 2919475136 335
231 iso_pu_bacteria 2946072368 2946079223 335
232 iso_pu_bacteria 2954002825 2954009582 335
233 iso_pu_bacteria 2954380949 2954382412 335
234 iso_pu_bacteria 2954673503 2954680677 335
235 iso_pu_bacteria 2954682443 2954683476 335
236 iso_pu_bacteria 2954691527 2954693217 335
237 iso_pu_bacteria 2954701450 2954708314 335
238 iso_pu_bacteria 8008574985 8008575820 335
239 iso_pu_bacteria 8056829672 8056836153 335
240 3300006844 Ga0075428_100034036 Ga0075428_1000340363 336
241 3300006846 Ga0075430_100045193 Ga0075430_1000451933 336
242 3300006847 Ga0075431_100016777 Ga0075431_1000167775 336
243 iso_pu_bacteria 2565956761 2566992021 336
244 iso_pu_bacteria 2904535858 2904538580 336
245 3300005437 Ga0070710_10041143 Ga0070710_100411432 337
246 3300005440 Ga0070705_100146845 Ga0070705_1001468452 337
247 3300005471 Ga0070698_100049412 Ga0070698_1000494123 337
248 3300005614 Ga0068856_100021793 Ga0068856_1000217934 337
249 3300005615 Ga0070702_100157787 Ga0070702_1001577872 337
250 3300006028 Ga0070717_10202837 Ga0070717_102028372 337
251 3300006163 Ga0070715_10024740 Ga0070715_100247402 337
252 3300006173 Ga0070716_100063237 Ga0070716_1000632372 337
253 3300006175 Ga0070712_100047555 Ga0070712_1000475552 337
254 3300006237 Ga0097621_100403929 Ga0097621_1004039291 337
255 3300006871 Ga0075434_100122558 Ga0075434_1001225581 337
256 3300007076 Ga0075435_100022856 Ga0075435_1000228564 337
257 3300009098 Ga0105245_10130157 Ga0105245_101301572 337
258 3300025898 Ga0207692_10018764 Ga0207692_100187643 337
259 3300025905 Ga0207685_10056463 Ga0207685_100564632 337
260 3300025915 Ga0207693_10095241 Ga0207693_100952412 337
261 3300025915 Ga0207693_10196769 Ga0207693_101967692 337
262 3300025928 Ga0207700_10030399 Ga0207700_100303992 337
263 3300025929 Ga0207664_10056401 Ga0207664_100564012 337
264 3300026078 Ga0207702_10020919 Ga0207702_100209196 337
265 3300026121 Ga0207683_10279266 Ga0207683_102792661 337
266 3300034818 Ga0373950_0008549 Ga0373950_0008549_501_1517 337
267 3300034820 Ga0373959_0024467 Ga0373959_0024467_21_1037 337
268 3300034957 Ga0373938_0022720 Ga0373938_0022720_19_1035 337
269 3300035242 Ga0373962_0040318 Ga0373962_0040318_227_1243 337
270 3300035725 Ga0373947_0199820 Ga0373947_0199820_91_1107 337
271 3300046531 Ga0495665_0094501 Ga0495665_0094501_122_1135 337
272 3300048903 Ga0496100_0045427 Ga0496100_0045427_1424_2440 337
273 3300048904 Ga0496101_0152973 Ga0496101_0152973_718_1734 337
274 3300048905 Ga0496102_0159203 Ga0496102_0159203_313_1329 337
275 3300048906 Ga0496103_0094506 Ga0496103_0094506_263_1279 337
276 3300048909 Ga0496106_0045013 Ga0496106_0045013_2276_3292 337
277 3300048910 Ga0496107_0114771 Ga0496107_0114771_548_1564 337
278 3300048912 Ga0496109_0055058 Ga0496109_0055058_546_1562 337
279 3300048913 Ga0496110_0111410 Ga0496110_0111410_426_1442 337
280 3300048915 Ga0496112_0109233 Ga0496112_0109233_426_1442 337
281 3300048917 Ga0496114_0072364 Ga0496114_0072364_908_1924 337
282 3300049570 Ga0501033_0131872 Ga0501033_0131872_222_1319 337
283 3300049571 Ga0501034_0053350 Ga0501034_0053350_1271_2332 337
284 3300049581 Ga0501047_0187906 Ga0501047_0187906_390_1451 337
285 3300049582 Ga0501048_0078871 Ga0501048_0078871_903_1964 337
286 3300049823 Ga0501044_0102524 Ga0501044_0102524_1006_2067 337
287 3300050513 nmdc:mga0rr50_305870_c1 nmdc:mga0rr50_305870_c1_299_1315 337
288 iso_pu_bacteria 2537561592 2537900363 337
289 iso_pu_bacteria 2818991318 2819427576 337
290 iso_pu_bacteria 2945941187 2945943518 337
291 3300048929 Ga0496126_0000013 Ga0496126_0000013_652990_654006 338
292 iso_pu_bacteria 2523231044 2523384740 338
293 3300003323 rootH1_10028509 rootH1_100285096 339
294 3300006042 Ga0075368_10003495 Ga0075368_100034956 339
295 3300006048 Ga0075363_100005240 Ga0075363_1000052405 339
296 3300006048 Ga0075363_100040774 Ga0075363_1000407742 339
297 3300006178 Ga0075367_10001135 Ga0075367_100011354 339
298 3300009147 Ga0114129_10217028 Ga0114129_102170282 339
299 3300009148 Ga0105243_10372912 Ga0105243_103729121 339
300 3300011119 Ga0105246_10194529 Ga0105246_101945292 339
301 3300014497 Ga0182008_10001253 Ga0182008_1000125313 339
302 3300015262 Ga0182007_10006831 Ga0182007_100068313 339
303 3300015688 Ga0183367_1001 Ga0183367_1001985 339
304 3300025904 Ga0207647_10015251 Ga0207647_100152513 339
305 3300028794 Ga0307515_10067479 Ga0307515_100674793 339
306 3300030522 Ga0307512_10014920 Ga0307512_100149203 339
307 3300031456 Ga0307513_10183056 Ga0307513_101830562 339
308 3300031616 Ga0307508_10005047 Ga0307508_100050479 339
309 3300031616 Ga0307508_10009146 Ga0307508_100091466 339
310 3300031730 Ga0307516_10010982 Ga0307516_100109829 339
311 3300037418 Ga0395900_0066140 Ga0395900_0066140_2514_3545 339
312 3300037466 Ga0395898_0023284 Ga0395898_0023284_4272_5303 339
313 3300038443 Ga0395901_0148884 Ga0395901_0148884_389_1420 339
314 3300041452 Ga0451793_1621772 Ga0451793_1621772_1819_2853 339
315 3300041491 Ga0451833_1195762 Ga0451833_1195762_732_1766 339
316 3300041512 Ga0451853_2069982 Ga0451853_2069982_1136_2158 339
317 3300044656 Ga0466969_0049026 Ga0466969_0049026_978_2012 339
318 3300044658 Ga0466972_0014799 Ga0466972_0014799_377_1411 339
319 3300044683 Ga0466965_0000288 Ga0466965_0000288_12980_14014 339
320 3300044684 Ga0466966_0008623 Ga0466966_0008623_4672_5706 339
321 3300044684 Ga0466966_0059431 Ga0466966_0059431_647_1678 339
322 3300044693 Ga0466961_0016710 Ga0466961_0016710_2770_3804 339
323 3300044694 Ga0466963_0007390 Ga0466963_0007390_1043_2077 339
324 3300044706 Ga0466964_0003528 Ga0466964_0003528_1947_2981 339
325 3300044719 Ga0466971_0001045 Ga0466971_0001045_5880_6914 339
326 3300044765 Ga0466970_0001450 Ga0466970_0001450_8348_9382 339
327 3300044842 Ga0466957_0004375 Ga0466957_0004375_2212_3246 339
328 3300045049 Ga0466959_0007571 Ga0466959_0007571_1043_2077 339
329 3300045976 Ga0466967_0013565 Ga0466967_0013565_2014_3048 339
330 3300045976 Ga0466967_0028970 Ga0466967_0028970_1370_2392 339
331 3300045976 Ga0466967_0029886 Ga0466967_0029886_346_1377 339
332 3300045976 Ga0466967_0114834 Ga0466967_0114834_36_1064 339
333 3300048903 Ga0496100_0235502 Ga0496100_0235502_109_1131 339
334 3300049570 Ga0501033_0022434 Ga0501033_0022434_2410_3441 339
335 3300049822 Ga0501035_0063613 Ga0501035_0063613_479_1510 339
336 3300049823 Ga0501044_0004785 Ga0501044_0004785_1336_2358 339
337 3300050490 nmdc:mga03n38_49228_c1 nmdc:mga03n38_49228_c1_821_1846 339
338 3300050492 nmdc:mga0yw44_154324_c1 nmdc:mga0yw44_154324_c1_252_1274 339
339 3300050496 nmdc:mga07m45_65807_c2 nmdc:mga07m45_65807_c2_490_1509 339
340 3300050507 nmdc:mga05p37_211101_c1 nmdc:mga05p37_211101_c1_412_1578 339
341 3300050508 nmdc:mga09592_15547_c1 nmdc:mga09592_15547_c1_4832_5998 339
342 3300050509 nmdc:mga0qj67_8134_c1 nmdc:mga0qj67_8134_c1_5441_6607 339
343 3300050510 nmdc:mga06r32_19108_c1 nmdc:mga06r32_19108_c1_5060_6226 339
344 3300061719 Ga0466962_0000233 Ga0466962_0000233_915_1949 339
345 iso_pu_bacteria 2784132148 2784591998 339
346 iso_pu_bacteria 8023623736 8023624180 339
347 3300003316 rootH1_10000180 rootH1_1000018020 340
348 3300003320 rootH2_10014605 rootH2_100146052 340
349 3300003322 rootL2_10017864 rootL2_100178642 340
350 3300003323 rootH1_10022852 rootH1_100228527 340
351 3300003771 Ga0055526_1013602 Ga0055526_10136022 340
352 3300006048 Ga0075363_100089417 Ga0075363_1000894172 340
353 3300013102 Ga0157371_10039980 Ga0157371_100399802 340
354 3300013104 Ga0157370_10007445 Ga0157370_100074454 340
355 3300037853 Ga0436364_0625262 Ga0436364_0625262_611_1633 340
356 3300048911 Ga0496108_0072797 Ga0496108_0072797_216_1238 340
357 3300049568 Ga0501031_0006068 Ga0501031_0006068_6165_7244 340
358 3300049569 Ga0501032_0098136 Ga0501032_0098136_786_1865 340
359 3300049570 Ga0501033_0033137 Ga0501033_0033137_347_1426 340
360 3300049571 Ga0501034_0035780 Ga0501034_0035780_3678_4757 340
361 3300049572 Ga0501036_0117493 Ga0501036_0117493_864_1943 340
362 3300049573 Ga0501037_0042996 Ga0501037_0042996_1483_2562 340
363 3300049575 Ga0501039_0170821 Ga0501039_0170821_147_1226 340
364 3300049578 Ga0501042_0004136 Ga0501042_0004136_88_1167 340
365 3300049579 Ga0501043_0016086 Ga0501043_0016086_3660_4739 340
366 3300049581 Ga0501047_0079054 Ga0501047_0079054_1302_2381 340
367 3300031548 Ga0307408_100246880 Ga0307408_1002468802 341
368 3300031911 Ga0307412_10302409 Ga0307412_103024092 341
369 3300031995 Ga0307409_100192151 Ga0307409_1001921511 341
370 3300042005 Ga0439448_0025371 Ga0439448_0025371_513_1592 341
371 3300042138 Ga0450903_000618 Ga0450903_000618_4421_5500 341
372 3300042157 Ga0439458_0020604 Ga0439458_0020604_171_1256 341
373 3300046660 Ga0495625_0125867 Ga0495625_0125867_68_1147 341
374 3300047447 Ga0495685_015891 Ga0495685_015891_701_1780 341
375 iso_pu_bacteria 2954711539 2954712890 341
376 iso_pu_bacteria 2954721474 2954722848 341
377 iso_pu_bacteria 2954731030 2954738981 341
378 iso_pu_bacteria 2954740390 2954741759 341
379 iso_pu_bacteria 2954749733 2954757839 341
380 iso_pu_bacteria 2954759201 2954760738 341
381 3300005345 Ga0070692_10119983 Ga0070692_101199831 342
382 3300005347 Ga0070668_100260790 Ga0070668_1002607902 342
383 3300005353 Ga0070669_100180476 Ga0070669_1001804762 342
384 3300005354 Ga0070675_100045723 Ga0070675_1000457231 342
385 3300005434 Ga0070709_10135093 Ga0070709_101350932 342
386 3300005436 Ga0070713_100001480 Ga0070713_10000148010 342
387 3300005471 Ga0070698_100076215 Ga0070698_1000762152 342
388 3300005563 Ga0068855_100169094 Ga0068855_1001690942 342
389 3300005577 Ga0068857_100067487 Ga0068857_1000674872 342
390 3300006028 Ga0070717_10150150 Ga0070717_101501502 342
391 3300006051 Ga0075364_10067995 Ga0075364_100679952 342
392 3300006173 Ga0070716_100153417 Ga0070716_1001534172 342
393 3300006844 Ga0075428_100440234 Ga0075428_1004402341 342
394 3300009092 Ga0105250_10023373 Ga0105250_100233732 342
395 3300009551 Ga0105238_10195887 Ga0105238_101958871 342
396 3300017792 Ga0163161_10173543 Ga0163161_101735431 342
397 3300020082 Ga0206353_11470034 Ga0206353_114700342 342
398 3300025915 Ga0207693_10179859 Ga0207693_101798591 342
399 3300025928 Ga0207700_10206722 Ga0207700_102067222 342
400 3300025939 Ga0207665_10160472 Ga0207665_101604722 342
401 3300025972 Ga0207668_10212793 Ga0207668_102127932 342
402 3300026116 Ga0207674_10006429 Ga0207674_1000642912 342
403 3300031730 Ga0307516_10001110 Ga0307516_100011105 342
404 3300042016 Ga0439463_004853 Ga0439463_004853_1685_2713 342
405 3300044901 Ga0466960_0011604 Ga0466960_0011604_252_1280 342
406 3300049583 Ga0501067_0000945 Ga0501067_0000945_13629_14660 342
407 3300049585 Ga0501069_0106308 Ga0501069_0106308_502_1533 342
408 3300050491 nmdc:mga00v17_60340_c1 nmdc:mga00v17_60340_c1_718_1746 342
409 3300053098 Ga0500650_0025329 Ga0500650_0025329_161_1225 342
410 3300053118 Ga0500594_0000945 Ga0500594_0000945_1553_2617 342
411 3300053131 Ga0500652_014215 Ga0500652_014215_234_1298 342
412 3300005336 Ga0070680_100074541 Ga0070680_1000745412 343
413 3300006038 Ga0075365_10018647 Ga0075365_100186472 343
414 3300006844 Ga0075428_100098914 Ga0075428_1000989142 343
415 3300006914 Ga0075436_100085053 Ga0075436_1000850531 343
416 3300009094 Ga0111539_10004308 Ga0111539_1000430818 343
417 3300009098 Ga0105245_10265589 Ga0105245_102655892 343
418 3300009098 Ga0105245_10305973 Ga0105245_103059732 343
419 3300009176 Ga0105242_10141097 Ga0105242_101410972 343
420 3300014745 Ga0157377_10108768 Ga0157377_101087681 343
421 3300017792 Ga0163161_10073330 Ga0163161_100733302 343
422 3300021388 Ga0213875_10003363 Ga0213875_100033631 343
423 3300024225 Ga0224572_1000112 Ga0224572_10001124 343
424 3300025261 Ga0209233_1000068 Ga0209233_1000068230 343
425 3300025901 Ga0207688_10145131 Ga0207688_101451311 343
426 3300025912 Ga0207707_10221652 Ga0207707_102216522 343
427 3300025919 Ga0207657_10234530 Ga0207657_102345301 343
428 3300025927 Ga0207687_10113803 Ga0207687_101138032 343
429 3300025927 Ga0207687_10144169 Ga0207687_101441692 343
430 3300025927 Ga0207687_10291035 Ga0207687_102910351 343
431 3300025928 Ga0207700_10135387 Ga0207700_101353871 343
432 3300025934 Ga0207686_10165987 Ga0207686_101659872 343
433 3300025940 Ga0207691_10081164 Ga0207691_100811641 343
434 3300025941 Ga0207711_10372192 Ga0207711_103721921 343
435 3300025986 Ga0207658_10120660 Ga0207658_101206602 343
436 3300027907 Ga0207428_10056489 Ga0207428_100564892 343
437 3300028379 Ga0268266_10056653 Ga0268266_100566532 343
438 3300028786 Ga0307517_10022489 Ga0307517_100224895 343
439 3300031616 Ga0307508_10017515 Ga0307508_100175158 343
440 3300031730 Ga0307516_10077394 Ga0307516_100773942 343
441 3300031995 Ga0307409_100450271 Ga0307409_1004502711 343
442 3300032002 Ga0307416_100053639 Ga0307416_1000536393 343
443 3300032002 Ga0307416_100055376 Ga0307416_1000553764 343
444 3300032004 Ga0307414_10177682 Ga0307414_101776821 343
445 3300032126 Ga0307415_100106504 Ga0307415_1001065042 343
446 3300035113 Ga0373936_0070667 Ga0373936_0070667_68_1153 343
447 3300035170 Ga0373943_0096884 Ga0373943_0096884_53_1192 343
448 3300037418 Ga0395900_0010983 Ga0395900_0010983_2537_3583 343
449 3300037466 Ga0395898_0002705 Ga0395898_0002705_14533_15579 343
450 3300037471 Ga0395905_0004921 Ga0395905_0004921_504_1550 343
451 3300037853 Ga0436364_0286659 Ga0436364_0286659_3252_4283 343
452 3300038443 Ga0395901_0009925 Ga0395901_0009925_7159_8205 343
453 3300041443 Ga0451789_1275942 Ga0451789_1275942_455_1486 343
454 3300041452 Ga0451793_0901224 Ga0451793_0901224_6139_7170 343
455 3300041498 Ga0451841_0566005 Ga0451841_0566005_430_1461 343
456 3300041505 Ga0451849_0096531 Ga0451849_0096531_65_1096 343
457 3300041509 Ga0451843_1637094 Ga0451843_1637094_638_1669 343
458 3300041512 Ga0451853_0970575 Ga0451853_0970575_2600_3631 343
459 3300042993 Ga0439440_0040691 Ga0439440_0040691_41_1078 343
460 3300044683 Ga0466965_0080537 Ga0466965_0080537_61_1104 343
461 3300046462 Ga0495651_0056912 Ga0495651_0056912_387_1472 343
462 3300046463 Ga0495653_0047675 Ga0495653_0047675_1327_2412 343
463 3300046522 Ga0495643_0002710 Ga0495643_0002710_1456_2499 343
464 3300046529 Ga0495652_0136576 Ga0495652_0136576_262_1347 343
465 3300046616 Ga0495668_0000128 Ga0495668_0000128_59716_60798 343
466 3300046691 Ga0495670_0007291 Ga0495670_0007291_265_1308 343
467 3300046794 Ga0495589_0061645 Ga0495589_0061645_651_1694 343
468 3300047318 Ga0495636_0031973 Ga0495636_0031973_929_1972 343
469 3300047321 Ga0495676_0093852 Ga0495676_0093852_1068_2099 343
470 3300047321 Ga0495676_0210146 Ga0495676_0210146_28_1071 343
471 3300047322 Ga0495680_0106760 Ga0495680_0106760_458_1543 343
472 3300047443 Ga0495687_011432 Ga0495687_011432_2963_4006 343
473 3300047443 Ga0495687_013809 Ga0495687_013809_2128_3171 343
474 3300047446 Ga0495679_016103 Ga0495679_016103_1569_2612 343
475 3300047447 Ga0495685_002934 Ga0495685_002934_1624_2667 343
476 3300047470 Ga0495681_0014664 Ga0495681_0014664_2965_4008 343
477 3300048088 Ga0495602_0226640 Ga0495602_0226640_334_1365 343
478 3300048903 Ga0496100_0080594 Ga0496100_0080594_779_1810 343
479 3300048906 Ga0496103_0178663 Ga0496103_0178663_283_1314 343
480 3300048907 Ga0496104_0142839 Ga0496104_0142839_900_1931 343
481 3300048912 Ga0496109_0050350 Ga0496109_0050350_1929_2969 343
482 3300048912 Ga0496109_0189088 Ga0496109_0189088_864_1895 343
483 3300048913 Ga0496110_0322680 Ga0496110_0322680_324_1355 343
484 3300048914 Ga0496111_0356391 Ga0496111_0356391_22_1053 343
485 3300048917 Ga0496114_0187933 Ga0496114_0187933_114_1145 343
486 3300048917 Ga0496114_0357499 Ga0496114_0357499_109_1140 343
487 3300049656 Ga0501209_035382 Ga0501209_035382_169_1200 343
488 3300050492 nmdc:mga0yw44_104001_c1 nmdc:mga0yw44_104001_c1_501_1532 343
489 3300050511 nmdc:mga08y16_2287_c1 nmdc:mga08y16_2287_c1_1219_2250 343
490 3300053084 Ga0495595_0058222 Ga0495595_0058222_368_1453 343
491 3300053085 Ga0495619_0093829 Ga0495619_0093829_426_1511 343
492 3300053086 Ga0500578_0046804 Ga0500578_0046804_191_1234 343
493 3300053101 Ga0500553_065809 Ga0500553_065809_66_1109 343
494 3300053109 Ga0500569_000761 Ga0500569_000761_4331_5374 343
495 3300053131 Ga0500652_002257 Ga0500652_002257_4587_5630 343
496 3300053134 Ga0500658_0004248 Ga0500658_0004248_4143_5186 343
497 3300053137 Ga0500561_0000666 Ga0500561_0000666_3669_4712 343
498 3300053146 Ga0500588_0019960 Ga0500588_0019960_560_1603 343
499 3300053149 Ga0500600_0036907 Ga0500600_0036907_479_1522 343
500 3300053153 Ga0500616_0000755 Ga0500616_0000755_34325_35362 343
501 3300053153 Ga0500616_0067091 Ga0500616_0067091_128_1171 343
502 3300053160 Ga0500633_0006280 Ga0500633_0006280_189_1232 343
503 iso_pu_bacteria 2922554459 2922559310 343
504 3300044694 Ga0466963_0213299 Ga0466963_0213299_23_1138 344
505 3300048905 Ga0496102_0126871 Ga0496102_0126871_901_2037 344
506 3300005577 Ga0068857_100372821 Ga0068857_1003728211 345
507 3300035091 Ga0373951_0000019 Ga0373951_0000019_47078_48151 345
508 3300000549 LJQas_1005288 LJQas_10052881 346
509 3300005337 Ga0070682_100120104 Ga0070682_1001201041 346
510 3300005345 Ga0070692_10017388 Ga0070692_100173882 346
511 3300005459 Ga0068867_100070328 Ga0068867_1000703282 346
512 3300005616 Ga0068852_100091633 Ga0068852_1000916331 346
513 3300005617 Ga0068859_100508877 Ga0068859_1005088771 346
514 3300005719 Ga0068861_100036423 Ga0068861_1000364231 346
515 3300006931 Ga0097620_100508927 Ga0097620_1005089271 346
516 3300009098 Ga0105245_10019373 Ga0105245_100193735 346
517 3300009148 Ga0105243_10097192 Ga0105243_100971922 346
518 3300025901 Ga0207688_10023013 Ga0207688_100230134 346
519 3300025940 Ga0207691_10091483 Ga0207691_100914831 346
520 3300025944 Ga0207661_10044055 Ga0207661_100440551 346
521 3300026118 Ga0207675_100012606 Ga0207675_1000126066 346
522 3300026142 Ga0207698_10081872 Ga0207698_100818722 346
523 3300048909 Ga0496106_0051565 Ga0496106_0051565_803_1843 346
524 3300048911 Ga0496108_0080775 Ga0496108_0080775_24_1130 346
525 3300048912 Ga0496109_0115719 Ga0496109_0115719_469_1575 346
526 3300050511 nmdc:mga08y16_102770_c1 nmdc:mga08y16_102770_c1_1806_2912 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

105

343

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5br1-assembly1.cif.gz_A crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis s4 (avi_5305, target efi-511224) with bound alpha-d-galactosamine 0.8854 62 338
5hqj-assembly1.cif.gz_A crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose 0.8818 56 340
2ioy-assembly2.cif.gz_B crystal structure of thermoanaerobacter tengcongensis ribose binding protein 0.8787 59 337
8wlb-assembly1.cif.gz_A x-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose 0.8773 62 333
7x0p-assembly1.cif.gz_A crystal structure of sugar binding protein cbpd from clostridium thermocellum 0.877 60 335
ID Description Score Start End Superfamily
1jh9A01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8977 9 48 1.10.260.40
af_P39265_140_289_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8933 170 316 3.40.50.2300
1qpzA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8859 9 48 1.10.260.40
2puaA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8814 9 48 1.10.260.40
2pucA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8813 9 48 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A0J6YZH1-F1-model_v4 DNA-binding transcriptional repressor MalI 0.952 1 340 GO:0000976
GO:0003700
AF-A0A0J6YZH1-F1-model_v4 DNA-binding transcriptional repressor MalI 0.9358 1 340 GO:0000976
GO:0003700
AF-A0A485AU08-F1-model_v4 ABC-type sugar transport system, periplasmic component 0.9278 66 343 GO:0030246
GO:0030313
AF-K6WTP5-F1-model_v4 Putative LacI family transcriptional regulator 0.9212 4 339 GO:0003677
GO:0006355
GO:0030246
GO:0030288
AF-A0A0L0MIH0-F1-model_v4 Transcriptional regulator, LacI family 0.9208 145 335

Feature Viewer

pLDDT pTM Quality
90.44 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map