F459394
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 526 | 355 | 485 | 339 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10217028|Ga0114129_102170282 |
| Length | 381 |
| Sequence | LLVLRRVSDLVLAIPEDICHRKNRSPSIERRKPSKSHQGAAAGMGHPFRIRAIAQQAGLSEATVDRVLNNRGGVRTDTVREVHQAVADLERQRTQLRLGGRTFVIDVVMQAPDRFSSAVRRALEAELPALRPAVIRSRFHFRETGPLADLTATLDRIASRGSQGVIIKAPDVPEITEAVARVVAAGIPVLTLVTDLPASRRLAYVGIDNRAAGATAAYLIGQWLGDKPGNVLVTLSRGFFRGEEEREMGFRSAMRSRYPDRSLVEIDNSDGLDETMRGLVLSALDSDPAINAVYSIGGGNVAIGEAFVSMRRTCSVFIAHDLDQDNIRLLRDGHLSAVLMRRACHFIMQAHRALPGAASSWPSNIQVITPYNTPIPVTFEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 2 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 3 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 4 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 5 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 6 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 7 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 8 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 9 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 10 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 11 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 12 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 13 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 14 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 15 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 16 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 17 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 18 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 19 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 20 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 21 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 22 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 23 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 24 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 25 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 26 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 27 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 28 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 29 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 30 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 31 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 32 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 33 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 34 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 35 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 36 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 37 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 38 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 39 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 40 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 41 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 42 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 43 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 44 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 45 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 46 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 47 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 48 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 49 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 50 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 54 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 58 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 61 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 86 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 102 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 109 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 112 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 118 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 121 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 122 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 126 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 128 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 156 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 157 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 214 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 215 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 216 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 230 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 231 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 232 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 239 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 240 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 241 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 242 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 243 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 244 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 247 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 248 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 249 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 250 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 251 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 252 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 253 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 254 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 255 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 256 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 257 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 258 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 259 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 260 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 261 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 262 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 263 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 264 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 265 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 269 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 270 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 301 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 307 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 325 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 328 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 340 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 341 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 342 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 343 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 344 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 345 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 346 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 348 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 349 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 350 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 352 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 353 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 354 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 355 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.83 |
| Metatranscriptomes | 0.38 |
| Isolates | 7.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.75 |
| Nodule | 0 |
| Rhizoplane | 8.37 |
| Rhizosphere | 74.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1005288 | 3300000549 | Bacteria | 1645 |
| 2 | JGI24743J22301_10020017 | 3300001991 | Bacteria | 1273 |
| 3 | JGI25158J39367_1000032 | 3300002739 | Bacteria | 30976 |
| 4 | JGI25152J39213_1006252 | 3300002773 | Bacteria | 3292 |
| 5 | JGI25159J45721_1001948 | 3300002987 | Bacteria | 8221 |
| 6 | JGI25159J45721_1004540 | 3300002987 | Bacteria | 4584 |
| 7 | JGI25153J46596_10003140 | 3300003215 | Bacteria | 9317 |
| 8 | rootH1_10000180 | 3300003316 | Bacteria | 19593 |
| 9 | rootH2_10014605 | 3300003320 | Bacteria | 8359 |
| 10 | rootL2_10017864 | 3300003322 | Bacteria | 7993 |
| 11 | rootH1_10022852 | 3300003323 | Bacteria | 10309 |
| 12 | rootH1_10028509 | 3300003323 | Bacteria | 5441 |
| 13 | JGI25160J50197_1016954 | 3300003354 | Bacteria | 2327 |
| 14 | JGI25161J50226_1000129 | 3300003374 | Bacteria | 53598 |
| 15 | Ga0055526_1013602 | 3300003771 | Bacteria | 3427 |
| 16 | Ga0055543_1000029 | 3300004625 | Bacteria | 131452 |
| 17 | Ga0065165_1011090 | 3300005262 | Bacteria | 3808 |
| 18 | Ga0070658_10004588 | 3300005327 | Bacteria | 11224 |
| 19 | Ga0070676_10014748 | 3300005328 | Bacteria | 4299 |
| 20 | Ga0070670_100060122 | 3300005331 | Bacteria | 3262 |
| 21 | Ga0068869_100004228 | 3300005334 | Bacteria | 8909 |
| 22 | Ga0070680_100003234 | 3300005336 | Bacteria | 12124 |
| 23 | Ga0070680_100074541 | 3300005336 | Bacteria | 2792 |
| 24 | Ga0070682_100002451 | 3300005337 | Bacteria | 10247 |
| 25 | Ga0070682_100013826 | 3300005337 | Bacteria | 4653 |
| 26 | Ga0070682_100120104 | 3300005337 | Bacteria | 1763 |
| 27 | Ga0068868_100005180 | 3300005338 | Bacteria | 9150 |
| 28 | Ga0070660_100029230 | 3300005339 | Bacteria | 4128 |
| 29 | Ga0070660_100161196 | 3300005339 | Bacteria | 1807 |
| 30 | Ga0070689_100052309 | 3300005340 | Bacteria | 3159 |
| 31 | Ga0070691_10005633 | 3300005341 | Bacteria | 5706 |
| 32 | Ga0070687_100116342 | 3300005343 | Bacteria | 1522 |
| 33 | Ga0070687_100179073 | 3300005343 | Bacteria | 1268 |
| 34 | Ga0070661_100050120 | 3300005344 | Bacteria | 3055 |
| 35 | Ga0070692_10017388 | 3300005345 | Bacteria | 3438 |
| 36 | Ga0070692_10119983 | 3300005345 | Bacteria | 1465 |
| 37 | Ga0070668_100038719 | 3300005347 | Bacteria | 3645 |
| 38 | Ga0070668_100043684 | 3300005347 | Bacteria | 3437 |
| 39 | Ga0070668_100260790 | 3300005347 | Bacteria | 1441 |
| 40 | Ga0070669_100180476 | 3300005353 | Bacteria | 1651 |
| 41 | Ga0070675_100005835 | 3300005354 | Bacteria | 9430 |
| 42 | Ga0070675_100045723 | 3300005354 | Bacteria | 3583 |
| 43 | Ga0070675_100090936 | 3300005354 | Bacteria | 2556 |
| 44 | Ga0070671_100002212 | 3300005355 | Bacteria | 15019 |
| 45 | Ga0070674_100214725 | 3300005356 | Bacteria | 1493 |
| 46 | Ga0070673_100125409 | 3300005364 | Bacteria | 2148 |
| 47 | Ga0070659_100039165 | 3300005366 | Bacteria | 3699 |
| 48 | Ga0070667_100323165 | 3300005367 | Bacteria | 1393 |
| 49 | Ga0070709_10135093 | 3300005434 | Bacteria | 1688 |
| 50 | Ga0070714_100178055 | 3300005435 | Bacteria | 1933 |
| 51 | Ga0070713_100001480 | 3300005436 | Bacteria | 14974 |
| 52 | Ga0070710_10041143 | 3300005437 | Bacteria | 2550 |
| 53 | Ga0070701_10100200 | 3300005438 | Bacteria | 1603 |
| 54 | Ga0070705_100146845 | 3300005440 | Bacteria | 1559 |
| 55 | Ga0070700_100188770 | 3300005441 | Bacteria | 1439 |
| 56 | Ga0070663_100006626 | 3300005455 | Bacteria | 6982 |
| 57 | Ga0070663_100017480 | 3300005455 | Bacteria | 4681 |
| 58 | Ga0070678_100008130 | 3300005456 | Bacteria | 6267 |
| 59 | Ga0070681_10172122 | 3300005458 | Bacteria | 2087 |
| 60 | Ga0068867_100070328 | 3300005459 | Bacteria | 2616 |
| 61 | Ga0070698_100049412 | 3300005471 | Bacteria | 4293 |
| 62 | Ga0070698_100076215 | 3300005471 | Bacteria | 3356 |
| 63 | Ga0070679_100028110 | 3300005530 | Bacteria | 5542 |
| 64 | Ga0068853_100539299 | 3300005539 | Bacteria | 1104 |
| 65 | Ga0070686_100296778 | 3300005544 | Bacteria | 1197 |
| 66 | Ga0070693_100005315 | 3300005547 | Bacteria | 6172 |
| 67 | Ga0068855_100137621 | 3300005563 | Bacteria | 2785 |
| 68 | Ga0068855_100169094 | 3300005563 | Bacteria | 2476 |
| 69 | Ga0070664_100031524 | 3300005564 | Bacteria | 4429 |
| 70 | Ga0068857_100067487 | 3300005577 | Bacteria | 3184 |
| 71 | Ga0068857_100071257 | 3300005577 | Bacteria | 3096 |
| 72 | Ga0068857_100167480 | 3300005577 | Bacteria | 1996 |
| 73 | Ga0068857_100372821 | 3300005577 | Bacteria | 1324 |
| 74 | Ga0068854_100042922 | 3300005578 | Bacteria | 3203 |
| 75 | Ga0068856_100019295 | 3300005614 | Bacteria | 6618 |
| 76 | Ga0068856_100021793 | 3300005614 | Bacteria | 6227 |
| 77 | Ga0068856_100056231 | 3300005614 | Bacteria | 3882 |
| 78 | Ga0068856_100148950 | 3300005614 | Bacteria | 2348 |
| 79 | Ga0070702_100000382 | 3300005615 | Bacteria | 15658 |
| 80 | Ga0070702_100157787 | 3300005615 | Bacteria | 1463 |
| 81 | Ga0068852_100056400 | 3300005616 | Bacteria | 3395 |
| 82 | Ga0068852_100091633 | 3300005616 | Bacteria | 2720 |
| 83 | Ga0068852_100208037 | 3300005616 | Bacteria | 1855 |
| 84 | Ga0068859_100508877 | 3300005617 | Bacteria | 1299 |
| 85 | Ga0068864_100006746 | 3300005618 | Bacteria | 9403 |
| 86 | Ga0068861_100036423 | 3300005719 | Bacteria | 3651 |
| 87 | Ga0068861_100053596 | 3300005719 | Bacteria | 3069 |
| 88 | Ga0068851_10005204 | 3300005834 | Bacteria | 5902 |
| 89 | Ga0068870_10002737 | 3300005840 | Bacteria | 7400 |
| 90 | Ga0068863_100035875 | 3300005841 | Bacteria | 4722 |
| 91 | Ga0068863_100118855 | 3300005841 | Bacteria | 2519 |
| 92 | Ga0068858_100032402 | 3300005842 | Bacteria | 4853 |
| 93 | Ga0068860_100015607 | 3300005843 | Bacteria | 7418 |
| 94 | Ga0068860_100172475 | 3300005843 | Bacteria | 2090 |
| 95 | Ga0070717_10150150 | 3300006028 | Bacteria | 2015 |
| 96 | Ga0070717_10202837 | 3300006028 | Bacteria | 1738 |
| 97 | Ga0075365_10018647 | 3300006038 | Bacteria | 4271 |
| 98 | Ga0075368_10003495 | 3300006042 | Bacteria | 5255 |
| 99 | Ga0075363_100005240 | 3300006048 | Bacteria | 5748 |
| 100 | Ga0075363_100040774 | 3300006048 | Bacteria | 2448 |
| 101 | Ga0075363_100089417 | 3300006048 | Bacteria | 1693 |
| 102 | Ga0075364_10025809 | 3300006051 | Bacteria | 3743 |
| 103 | Ga0075364_10067995 | 3300006051 | Bacteria | 2342 |
| 104 | Ga0075432_10033856 | 3300006058 | Bacteria | 1773 |
| 105 | Ga0070715_10024740 | 3300006163 | Bacteria | 2370 |
| 106 | Ga0070716_100063237 | 3300006173 | Bacteria | 2148 |
| 107 | Ga0070716_100153417 | 3300006173 | Bacteria | 1484 |
| 108 | Ga0070712_100047555 | 3300006175 | Bacteria | 2970 |
| 109 | Ga0075367_10001135 | 3300006178 | Bacteria | 11089 |
| 110 | Ga0097621_100025526 | 3300006237 | Bacteria | 4623 |
| 111 | Ga0097621_100403929 | 3300006237 | Bacteria | 1223 |
| 112 | Ga0068871_100027176 | 3300006358 | Bacteria | 4472 |
| 113 | Ga0075428_100034036 | 3300006844 | Bacteria | 5620 |
| 114 | Ga0075428_100041100 | 3300006844 | Bacteria | 5086 |
| 115 | Ga0075428_100098914 | 3300006844 | Bacteria | 3181 |
| 116 | Ga0075428_100134317 | 3300006844 | Bacteria | 2690 |
| 117 | Ga0075428_100440234 | 3300006844 | Bacteria | 1396 |
| 118 | Ga0075430_100045193 | 3300006846 | Bacteria | 3721 |
| 119 | Ga0075431_100015673 | 3300006847 | Bacteria | 7684 |
| 120 | Ga0075431_100016777 | 3300006847 | Bacteria | 7438 |
| 121 | Ga0075431_100081480 | 3300006847 | Bacteria | 3342 |
| 122 | Ga0075433_10002396 | 3300006852 | Bacteria | 14261 |
| 123 | Ga0075434_100122558 | 3300006871 | Bacteria | 2616 |
| 124 | Ga0075429_100037077 | 3300006880 | Bacteria | 4243 |
| 125 | Ga0068865_100021006 | 3300006881 | Bacteria | 4243 |
| 126 | Ga0075436_100015557 | 3300006914 | Bacteria | 5208 |
| 127 | Ga0075436_100085053 | 3300006914 | Bacteria | 2195 |
| 128 | Ga0097620_100508927 | 3300006931 | Bacteria | 1299 |
| 129 | Ga0075435_100001480 | 3300007076 | Bacteria | 15092 |
| 130 | Ga0075435_100022856 | 3300007076 | Bacteria | 4827 |
| 131 | Ga0105250_10023373 | 3300009092 | Bacteria | 2489 |
| 132 | Ga0111539_10004308 | 3300009094 | Bacteria | 18616 |
| 133 | Ga0111539_10188424 | 3300009094 | Bacteria | 2408 |
| 134 | Ga0105245_10010965 | 3300009098 | Bacteria | 7886 |
| 135 | Ga0105245_10019373 | 3300009098 | Bacteria | 5959 |
| 136 | Ga0105245_10130157 | 3300009098 | Bacteria | 2359 |
| 137 | Ga0105245_10233685 | 3300009098 | Bacteria | 1779 |
| 138 | Ga0105245_10265589 | 3300009098 | Bacteria | 1672 |
| 139 | Ga0105245_10305973 | 3300009098 | Bacteria | 1561 |
| 140 | Ga0105247_10033037 | 3300009101 | Bacteria | 3146 |
| 141 | Ga0114129_10001574 | 3300009147 | Bacteria | 30996 |
| 142 | Ga0114129_10217028 | 3300009147 | Bacteria | 2583 |
| 143 | Ga0105243_10065300 | 3300009148 | Bacteria | 2923 |
| 144 | Ga0105243_10097192 | 3300009148 | Bacteria | 2437 |
| 145 | Ga0105243_10372912 | 3300009148 | Bacteria | 1317 |
| 146 | Ga0105241_10015740 | 3300009174 | Bacteria | 5541 |
| 147 | Ga0105242_10141097 | 3300009176 | Bacteria | 2091 |
| 148 | Ga0105238_10195887 | 3300009551 | Bacteria | 1996 |
| 149 | Ga0105249_10384603 | 3300009553 | Bacteria | 1430 |
| 150 | Ga0105239_10063676 | 3300010375 | Bacteria | 4049 |
| 151 | Ga0105246_10009444 | 3300011119 | Bacteria | 6010 |
| 152 | Ga0105246_10057428 | 3300011119 | Bacteria | 2693 |
| 153 | Ga0105246_10194529 | 3300011119 | Bacteria | 1572 |
| 154 | Ga0105246_10255150 | 3300011119 | Bacteria | 1394 |
| 155 | Ga0157371_10039980 | 3300013102 | Bacteria | 3352 |
| 156 | Ga0157371_10067514 | 3300013102 | Bacteria | 2531 |
| 157 | Ga0157370_10007445 | 3300013104 | Bacteria | 11901 |
| 158 | Ga0157370_10018705 | 3300013104 | Bacteria | 6966 |
| 159 | Ga0157369_10207022 | 3300013105 | Bacteria | 2057 |
| 160 | Ga0157374_10129419 | 3300013296 | Bacteria | 2442 |
| 161 | Ga0157372_10287763 | 3300013307 | Bacteria | 1911 |
| 162 | Ga0157375_10057178 | 3300013308 | Bacteria | 3855 |
| 163 | Ga0163163_10062366 | 3300014325 | Bacteria | 3694 |
| 164 | Ga0163163_10147351 | 3300014325 | Bacteria | 2398 |
| 165 | Ga0182008_10001253 | 3300014497 | Bacteria | 17425 |
| 166 | Ga0157377_10004325 | 3300014745 | Bacteria | 6522 |
| 167 | Ga0157377_10108768 | 3300014745 | Bacteria | 1663 |
| 168 | Ga0157379_10149139 | 3300014968 | Bacteria | 2109 |
| 169 | Ga0157379_10392033 | 3300014968 | Bacteria | 1275 |
| 170 | Ga0157376_10093168 | 3300014969 | Bacteria | 2614 |
| 171 | Ga0182007_10006831 | 3300015262 | Bacteria | 4855 |
| 172 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 173 | Ga0163161_10073330 | 3300017792 | Bacteria | 2508 |
| 174 | Ga0163161_10173543 | 3300017792 | Bacteria | 1649 |
| 175 | Ga0206353_10439816 | 3300020082 | Bacteria | 3360 |
| 176 | Ga0206353_11470034 | 3300020082 | Bacteria | 1511 |
| 177 | Ga0213875_10003363 | 3300021388 | Bacteria | 9116 |
| 178 | Ga0224572_1000112 | 3300024225 | Bacteria | 6382 |
| 179 | Ga0209436_100026 | 3300025208 | Bacteria | 90859 |
| 180 | Ga0209129_1000755 | 3300025258 | Bacteria | 20560 |
| 181 | Ga0209233_1000068 | 3300025261 | Bacteria | 377969 |
| 182 | Ga0209130_1000030 | 3300025284 | Bacteria | 323323 |
| 183 | Ga0209758_1000586 | 3300025297 | Bacteria | 56819 |
| 184 | Ga0207426_1000047 | 3300025302 | Bacteria | 417011 |
| 185 | Ga0209051_1003256 | 3300025303 | Bacteria | 10787 |
| 186 | Ga0209257_1013019 | 3300025304 | Bacteria | 3754 |
| 187 | Ga0207656_10094493 | 3300025321 | Bacteria | 1362 |
| 188 | Ga0207692_10018764 | 3300025898 | Bacteria | 3111 |
| 189 | Ga0207688_10009664 | 3300025901 | Bacteria | 5251 |
| 190 | Ga0207688_10013825 | 3300025901 | Bacteria | 4386 |
| 191 | Ga0207688_10023013 | 3300025901 | Bacteria | 3410 |
| 192 | Ga0207688_10145131 | 3300025901 | Bacteria | 1399 |
| 193 | Ga0207688_10153747 | 3300025901 | Bacteria | 1360 |
| 194 | Ga0207647_10015251 | 3300025904 | Bacteria | 5275 |
| 195 | Ga0207685_10056463 | 3300025905 | Bacteria | 1537 |
| 196 | Ga0207645_10048199 | 3300025907 | Bacteria | 2720 |
| 197 | Ga0207645_10085247 | 3300025907 | Bacteria | 2028 |
| 198 | Ga0207643_10000027 | 3300025908 | Bacteria | 99423 |
| 199 | Ga0207643_10048642 | 3300025908 | Bacteria | 2402 |
| 200 | Ga0207705_10056214 | 3300025909 | Bacteria | 2837 |
| 201 | Ga0207707_10035341 | 3300025912 | Bacteria | 4370 |
| 202 | Ga0207707_10221652 | 3300025912 | Bacteria | 1646 |
| 203 | Ga0207693_10095241 | 3300025915 | Bacteria | 2334 |
| 204 | Ga0207693_10179859 | 3300025915 | Bacteria | 1664 |
| 205 | Ga0207693_10196769 | 3300025915 | Bacteria | 1585 |
| 206 | Ga0207660_10218384 | 3300025917 | Bacteria | 1495 |
| 207 | Ga0207662_10022691 | 3300025918 | Bacteria | 3601 |
| 208 | Ga0207657_10115225 | 3300025919 | Bacteria | 2215 |
| 209 | Ga0207657_10234530 | 3300025919 | Bacteria | 1467 |
| 210 | Ga0207649_10003298 | 3300025920 | Bacteria | 8835 |
| 211 | Ga0207652_10004900 | 3300025921 | Bacteria | 10831 |
| 212 | Ga0207650_10001414 | 3300025925 | Bacteria | 17301 |
| 213 | Ga0207659_10028183 | 3300025926 | Bacteria | 3814 |
| 214 | Ga0207687_10108804 | 3300025927 | Bacteria | 2053 |
| 215 | Ga0207687_10113803 | 3300025927 | Bacteria | 2013 |
| 216 | Ga0207687_10144169 | 3300025927 | Bacteria | 1810 |
| 217 | Ga0207687_10291035 | 3300025927 | Bacteria | 1313 |
| 218 | Ga0207700_10030399 | 3300025928 | Bacteria | 3825 |
| 219 | Ga0207700_10135387 | 3300025928 | Bacteria | 2017 |
| 220 | Ga0207700_10206722 | 3300025928 | Bacteria | 1657 |
| 221 | Ga0207664_10056401 | 3300025929 | Bacteria | 3120 |
| 222 | Ga0207690_10107085 | 3300025932 | Bacteria | 2007 |
| 223 | Ga0207686_10165987 | 3300025934 | Bacteria | 1552 |
| 224 | Ga0207704_10207412 | 3300025938 | Bacteria | 1439 |
| 225 | Ga0207665_10160472 | 3300025939 | Bacteria | 1617 |
| 226 | Ga0207691_10081164 | 3300025940 | Bacteria | 2915 |
| 227 | Ga0207691_10091483 | 3300025940 | Bacteria | 2726 |
| 228 | Ga0207711_10372192 | 3300025941 | Bacteria | 1325 |
| 229 | Ga0207689_10004346 | 3300025942 | Bacteria | 12911 |
| 230 | Ga0207689_10077742 | 3300025942 | Bacteria | 2727 |
| 231 | Ga0207661_10012002 | 3300025944 | Bacteria | 6294 |
| 232 | Ga0207661_10044055 | 3300025944 | Bacteria | 3524 |
| 233 | Ga0207661_10278701 | 3300025944 | Bacteria | 1494 |
| 234 | Ga0207679_10009014 | 3300025945 | Bacteria | 6377 |
| 235 | Ga0207667_10048066 | 3300025949 | Bacteria | 4513 |
| 236 | Ga0207651_10037039 | 3300025960 | Bacteria | 3192 |
| 237 | Ga0207668_10028898 | 3300025972 | Bacteria | 3630 |
| 238 | Ga0207668_10212793 | 3300025972 | Bacteria | 1547 |
| 239 | Ga0207640_10057346 | 3300025981 | Bacteria | 2561 |
| 240 | Ga0207640_10156958 | 3300025981 | Bacteria | 1678 |
| 241 | Ga0207658_10120660 | 3300025986 | Bacteria | 2090 |
| 242 | Ga0207658_10172866 | 3300025986 | Bacteria | 1782 |
| 243 | Ga0207703_10050888 | 3300026035 | Bacteria | 3354 |
| 244 | Ga0207639_10452868 | 3300026041 | Bacteria | 1165 |
| 245 | Ga0207678_10000662 | 3300026067 | Bacteria | 31648 |
| 246 | Ga0207708_10018814 | 3300026075 | Bacteria | 5203 |
| 247 | Ga0207708_10066883 | 3300026075 | Bacteria | 2748 |
| 248 | Ga0207708_10067211 | 3300026075 | Bacteria | 2742 |
| 249 | Ga0207702_10001188 | 3300026078 | Bacteria | 26420 |
| 250 | Ga0207702_10010960 | 3300026078 | Bacteria | 7562 |
| 251 | Ga0207702_10020919 | 3300026078 | Bacteria | 5414 |
| 252 | Ga0207641_10042523 | 3300026088 | Bacteria | 3812 |
| 253 | Ga0207676_10011868 | 3300026095 | Bacteria | 6234 |
| 254 | Ga0207674_10006429 | 3300026116 | Bacteria | 13816 |
| 255 | Ga0207674_10242599 | 3300026116 | Bacteria | 1749 |
| 256 | Ga0207674_10478507 | 3300026116 | Bacteria | 1204 |
| 257 | Ga0207675_100012606 | 3300026118 | Bacteria | 7897 |
| 258 | Ga0207675_100061836 | 3300026118 | Bacteria | 3496 |
| 259 | Ga0207683_10002218 | 3300026121 | Bacteria | 17085 |
| 260 | Ga0207683_10279266 | 3300026121 | Bacteria | 1526 |
| 261 | Ga0207698_10025400 | 3300026142 | Bacteria | 4173 |
| 262 | Ga0207698_10081872 | 3300026142 | Bacteria | 2607 |
| 263 | Ga0207428_10002503 | 3300027907 | Bacteria | 18349 |
| 264 | Ga0207428_10056489 | 3300027907 | Bacteria | 3119 |
| 265 | Ga0268266_10056653 | 3300028379 | Bacteria | 3372 |
| 266 | Ga0268264_10035849 | 3300028381 | Bacteria | 4085 |
| 267 | Ga0307517_10022489 | 3300028786 | Bacteria | 7895 |
| 268 | Ga0307515_10022984 | 3300028794 | Bacteria | 10961 |
| 269 | Ga0307515_10067479 | 3300028794 | Bacteria | 4932 |
| 270 | Ga0307512_10014920 | 3300030522 | Bacteria | 7222 |
| 271 | Ga0307513_10183056 | 3300031456 | Bacteria | 1956 |
| 272 | Ga0307408_100246880 | 3300031548 | Bacteria | 1470 |
| 273 | Ga0307508_10005047 | 3300031616 | Bacteria | 12676 |
| 274 | Ga0307508_10009146 | 3300031616 | Bacteria | 9123 |
| 275 | Ga0307508_10017515 | 3300031616 | Bacteria | 6512 |
| 276 | Ga0307516_10001110 | 3300031730 | Bacteria | 37506 |
| 277 | Ga0307516_10010982 | 3300031730 | Bacteria | 9898 |
| 278 | Ga0307516_10035268 | 3300031730 | Bacteria | 5021 |
| 279 | Ga0307516_10077394 | 3300031730 | Bacteria | 3175 |
| 280 | Ga0307410_10147355 | 3300031852 | Bacteria | 1748 |
| 281 | Ga0307406_10054115 | 3300031901 | Bacteria | 2560 |
| 282 | Ga0307406_10090429 | 3300031901 | Bacteria | 2060 |
| 283 | Ga0307407_10006926 | 3300031903 | Bacteria | 5093 |
| 284 | Ga0307412_10302409 | 3300031911 | Bacteria | 1265 |
| 285 | Ga0307409_100192151 | 3300031995 | Bacteria | 1818 |
| 286 | Ga0307409_100254357 | 3300031995 | Bacteria | 1608 |
| 287 | Ga0307409_100450271 | 3300031995 | Bacteria | 1242 |
| 288 | Ga0307416_100053639 | 3300032002 | Bacteria | 3236 |
| 289 | Ga0307416_100055376 | 3300032002 | Bacteria | 3194 |
| 290 | Ga0307414_10037088 | 3300032004 | Bacteria | 3261 |
| 291 | Ga0307414_10177682 | 3300032004 | Bacteria | 1709 |
| 292 | Ga0307411_10056093 | 3300032005 | Bacteria | 2595 |
| 293 | Ga0307415_100106504 | 3300032126 | Bacteria | 2070 |
| 294 | Ga0373950_0008549 | 3300034818 | Bacteria | 1614 |
| 295 | Ga0373959_0024467 | 3300034820 | Bacteria | 1180 |
| 296 | Ga0373938_0022720 | 3300034957 | Bacteria | 1284 |
| 297 | Ga0373951_0000019 | 3300035091 | Bacteria | 63710 |
| 298 | Ga0373936_0070667 | 3300035113 | Bacteria | 1438 |
| 299 | Ga0373943_0096884 | 3300035170 | Bacteria | 1536 |
| 300 | Ga0373962_0040318 | 3300035242 | Bacteria | 1313 |
| 301 | Ga0373947_0199820 | 3300035725 | Bacteria | 1308 |
| 302 | Ga0373937_0452341 | 3300036401 | Bacteria | 1219 |
| 303 | Ga0395899_0021027 | 3300037312 | Bacteria | 4949 |
| 304 | Ga0395900_0010983 | 3300037418 | Bacteria | 9262 |
| 305 | Ga0395900_0066140 | 3300037418 | Bacteria | 3715 |
| 306 | Ga0395898_0002705 | 3300037466 | Bacteria | 20474 |
| 307 | Ga0395898_0023284 | 3300037466 | Bacteria | 6258 |
| 308 | Ga0395898_0025073 | 3300037466 | Bacteria | 6012 |
| 309 | Ga0395898_0123469 | 3300037466 | Bacteria | 2481 |
| 310 | Ga0395905_0004921 | 3300037471 | Bacteria | 13759 |
| 311 | Ga0436364_0286659 | 3300037853 | Bacteria | 12967 |
| 312 | Ga0436364_0625262 | 3300037853 | Bacteria | 1711 |
| 313 | Ga0395901_0009925 | 3300038443 | Bacteria | 9651 |
| 314 | Ga0395901_0034769 | 3300038443 | Bacteria | 5206 |
| 315 | Ga0395901_0066621 | 3300038443 | Bacteria | 3751 |
| 316 | Ga0395901_0148884 | 3300038443 | Bacteria | 2460 |
| 317 | Ga0395901_0192661 | 3300038443 | Bacteria | 2138 |
| 318 | Ga0451789_1275942 | 3300041443 | Bacteria | 1608 |
| 319 | Ga0451793_0901224 | 3300041452 | Bacteria | 8183 |
| 320 | Ga0451793_1621772 | 3300041452 | Bacteria | 3881 |
| 321 | Ga0451833_1195762 | 3300041491 | Bacteria | 1991 |
| 322 | Ga0451841_0566005 | 3300041498 | Bacteria | 1743 |
| 323 | Ga0451849_0096531 | 3300041505 | Bacteria | 1710 |
| 324 | Ga0451843_1637094 | 3300041509 | Bacteria | 3976 |
| 325 | Ga0451853_0970575 | 3300041512 | Bacteria | 10503 |
| 326 | Ga0451853_2069982 | 3300041512 | Bacteria | 5911 |
| 327 | Ga0439448_0002961 | 3300042005 | Bacteria | 4659 |
| 328 | Ga0439448_0025371 | 3300042005 | Bacteria | 1859 |
| 329 | Ga0439463_004853 | 3300042016 | Bacteria | 3361 |
| 330 | Ga0450903_000618 | 3300042138 | Bacteria | 7184 |
| 331 | Ga0439458_0020604 | 3300042157 | Bacteria | 1523 |
| 332 | Ga0439459_0000765 | 3300042438 | Bacteria | 4420 |
| 333 | Ga0439464_0002766 | 3300042439 | Bacteria | 4353 |
| 334 | Ga0439440_0040691 | 3300042993 | Bacteria | 1132 |
| 335 | Ga0466969_0049026 | 3300044656 | Bacteria | 2086 |
| 336 | Ga0466972_0014799 | 3300044658 | Bacteria | 3903 |
| 337 | Ga0466965_0000288 | 3300044683 | Bacteria | 16687 |
| 338 | Ga0466965_0080537 | 3300044683 | Bacteria | 1646 |
| 339 | Ga0466966_0008623 | 3300044684 | Bacteria | 6748 |
| 340 | Ga0466966_0059431 | 3300044684 | Bacteria | 2414 |
| 341 | Ga0466961_0016710 | 3300044693 | Bacteria | 4718 |
| 342 | Ga0466963_0000407 | 3300044694 | Bacteria | 19711 |
| 343 | Ga0466963_0007390 | 3300044694 | Bacteria | 6545 |
| 344 | Ga0466963_0213299 | 3300044694 | Bacteria | 1351 |
| 345 | Ga0466964_0003528 | 3300044706 | Bacteria | 5715 |
| 346 | Ga0466971_0001045 | 3300044719 | Bacteria | 11476 |
| 347 | Ga0466970_0001450 | 3300044765 | Bacteria | 11479 |
| 348 | Ga0466957_0004375 | 3300044842 | Bacteria | 7857 |
| 349 | Ga0466957_0337542 | 3300044842 | Bacteria | 1020 |
| 350 | Ga0466960_0011604 | 3300044901 | Bacteria | 3693 |
| 351 | Ga0466959_0007571 | 3300045049 | Bacteria | 7631 |
| 352 | Ga0466967_0011811 | 3300045976 | Bacteria | 6642 |
| 353 | Ga0466967_0013565 | 3300045976 | Bacteria | 6303 |
| 354 | Ga0466967_0028970 | 3300045976 | Bacteria | 4629 |
| 355 | Ga0466967_0029886 | 3300045976 | Bacteria | 4566 |
| 356 | Ga0466967_0114834 | 3300045976 | Bacteria | 2479 |
| 357 | Ga0495651_0056912 | 3300046462 | Bacteria | 3002 |
| 358 | Ga0495653_0047675 | 3300046463 | Bacteria | 3313 |
| 359 | Ga0495643_0002710 | 3300046522 | Bacteria | 13641 |
| 360 | Ga0495652_0136576 | 3300046529 | Bacteria | 1934 |
| 361 | Ga0495665_0094501 | 3300046531 | Bacteria | 1570 |
| 362 | Ga0495668_0000128 | 3300046616 | Bacteria | 113090 |
| 363 | Ga0495625_0125867 | 3300046660 | Bacteria | 1740 |
| 364 | Ga0495658_0102803 | 3300046683 | Bacteria | 1708 |
| 365 | Ga0495670_0007291 | 3300046691 | Bacteria | 5435 |
| 366 | Ga0495589_0061645 | 3300046794 | Bacteria | 1840 |
| 367 | Ga0495581_0200255 | 3300047315 | Bacteria | 1168 |
| 368 | Ga0495636_0031973 | 3300047318 | Bacteria | 2158 |
| 369 | Ga0495676_0093852 | 3300047321 | Bacteria | 2237 |
| 370 | Ga0495676_0210146 | 3300047321 | Bacteria | 1347 |
| 371 | Ga0495680_0106760 | 3300047322 | Bacteria | 2080 |
| 372 | Ga0495687_011432 | 3300047443 | Bacteria | 4775 |
| 373 | Ga0495687_013809 | 3300047443 | Bacteria | 4191 |
| 374 | Ga0495679_016103 | 3300047446 | Bacteria | 2713 |
| 375 | Ga0495685_002934 | 3300047447 | Bacteria | 5394 |
| 376 | Ga0495685_015891 | 3300047447 | Bacteria | 2571 |
| 377 | Ga0495681_0014664 | 3300047470 | Bacteria | 4479 |
| 378 | Ga0495602_0226640 | 3300048088 | Bacteria | 1407 |
| 379 | Ga0496100_0045427 | 3300048903 | Bacteria | 2819 |
| 380 | Ga0496100_0080594 | 3300048903 | Bacteria | 2197 |
| 381 | Ga0496100_0235502 | 3300048903 | Bacteria | 1349 |
| 382 | Ga0496101_0152973 | 3300048904 | Bacteria | 1765 |
| 383 | Ga0496102_0126871 | 3300048905 | Bacteria | 2386 |
| 384 | Ga0496102_0159203 | 3300048905 | Bacteria | 2123 |
| 385 | Ga0496102_0192978 | 3300048905 | Bacteria | 1919 |
| 386 | Ga0496103_0031484 | 3300048906 | Bacteria | 3232 |
| 387 | Ga0496103_0094506 | 3300048906 | Bacteria | 1889 |
| 388 | Ga0496103_0178663 | 3300048906 | Bacteria | 1364 |
| 389 | Ga0496104_0001170 | 3300048907 | Bacteria | 22501 |
| 390 | Ga0496104_0142839 | 3300048907 | Bacteria | 2300 |
| 391 | Ga0496105_0006599 | 3300048908 | Bacteria | 8934 |
| 392 | Ga0496106_0008317 | 3300048909 | Bacteria | 7678 |
| 393 | Ga0496106_0045013 | 3300048909 | Bacteria | 3314 |
| 394 | Ga0496106_0051565 | 3300048909 | Bacteria | 3103 |
| 395 | Ga0496107_0022541 | 3300048910 | Bacteria | 4450 |
| 396 | Ga0496107_0114771 | 3300048910 | Bacteria | 1982 |
| 397 | Ga0496108_0002125 | 3300048911 | Bacteria | 15875 |
| 398 | Ga0496108_0072797 | 3300048911 | Bacteria | 2901 |
| 399 | Ga0496108_0080775 | 3300048911 | Bacteria | 2755 |
| 400 | Ga0496109_0050350 | 3300048912 | Bacteria | 3794 |
| 401 | Ga0496109_0055058 | 3300048912 | Bacteria | 3629 |
| 402 | Ga0496109_0115719 | 3300048912 | Bacteria | 2495 |
| 403 | Ga0496109_0189088 | 3300048912 | Bacteria | 1935 |
| 404 | Ga0496110_0002646 | 3300048913 | Bacteria | 13499 |
| 405 | Ga0496110_0111410 | 3300048913 | Bacteria | 2460 |
| 406 | Ga0496110_0125156 | 3300048913 | Bacteria | 2319 |
| 407 | Ga0496110_0322680 | 3300048913 | Bacteria | 1407 |
| 408 | Ga0496111_0356391 | 3300048914 | Bacteria | 1083 |
| 409 | Ga0496112_0043873 | 3300048915 | Bacteria | 4378 |
| 410 | Ga0496112_0109233 | 3300048915 | Bacteria | 2736 |
| 411 | Ga0496113_0044877 | 3300048916 | Bacteria | 3275 |
| 412 | Ga0496114_0036187 | 3300048917 | Bacteria | 4080 |
| 413 | Ga0496114_0072364 | 3300048917 | Bacteria | 2899 |
| 414 | Ga0496114_0088731 | 3300048917 | Bacteria | 2623 |
| 415 | Ga0496114_0130995 | 3300048917 | Bacteria | 2165 |
| 416 | Ga0496114_0187933 | 3300048917 | Bacteria | 1806 |
| 417 | Ga0496114_0357499 | 3300048917 | Bacteria | 1292 |
| 418 | Ga0496114_0680413 | 3300048917 | Bacteria | 903 |
| 419 | Ga0496115_0045886 | 3300048918 | Bacteria | 3490 |
| 420 | Ga0496126_0000013 | 3300048929 | Bacteria | 690046 |
| 421 | Ga0501031_0006068 | 3300049568 | Bacteria | 7889 |
| 422 | Ga0501032_0098136 | 3300049569 | Bacteria | 1941 |
| 423 | Ga0501033_0022434 | 3300049570 | Bacteria | 4762 |
| 424 | Ga0501033_0033137 | 3300049570 | Bacteria | 3879 |
| 425 | Ga0501033_0131872 | 3300049570 | Bacteria | 1810 |
| 426 | Ga0501034_0035780 | 3300049571 | Bacteria | 5033 |
| 427 | Ga0501034_0053350 | 3300049571 | Bacteria | 4071 |
| 428 | Ga0501034_0095213 | 3300049571 | Bacteria | 2974 |
| 429 | Ga0501036_0117493 | 3300049572 | Bacteria | 2246 |
| 430 | Ga0501037_0042996 | 3300049573 | Bacteria | 3320 |
| 431 | Ga0501039_0170821 | 3300049575 | Bacteria | 1709 |
| 432 | Ga0501042_0004136 | 3300049578 | Bacteria | 9225 |
| 433 | Ga0501043_0016086 | 3300049579 | Bacteria | 5867 |
| 434 | Ga0501043_0063003 | 3300049579 | Bacteria | 2912 |
| 435 | Ga0501047_0031348 | 3300049581 | Bacteria | 5126 |
| 436 | Ga0501047_0079054 | 3300049581 | Bacteria | 3162 |
| 437 | Ga0501047_0187906 | 3300049581 | Bacteria | 1930 |
| 438 | Ga0501048_0078871 | 3300049582 | Bacteria | 2324 |
| 439 | Ga0501067_0000945 | 3300049583 | Bacteria | 15577 |
| 440 | Ga0501069_0106308 | 3300049585 | Bacteria | 1595 |
| 441 | Ga0501073_0350211 | 3300049589 | Bacteria | 1020 |
| 442 | Ga0501209_035382 | 3300049656 | Bacteria | 1293 |
| 443 | Ga0501035_0063613 | 3300049822 | Bacteria | 3281 |
| 444 | Ga0501044_0004785 | 3300049823 | Bacteria | 15145 |
| 445 | Ga0501044_0031906 | 3300049823 | Bacteria | 5540 |
| 446 | Ga0501044_0102524 | 3300049823 | Bacteria | 2877 |
| 447 | nmdc:mga03n38_49228_c1 | 3300050490 | Bacteria | 1873 |
| 448 | nmdc:mga00v17_60340_c1 | 3300050491 | Bacteria | 2329 |
| 449 | nmdc:mga0yw44_104001_c1 | 3300050492 | Bacteria | 1812 |
| 450 | nmdc:mga0yw44_154324_c1 | 3300050492 | Bacteria | 1499 |
| 451 | nmdc:mga07m45_65807_c2 | 3300050496 | Bacteria | 1540 |
| 452 | nmdc:mga05p37_11378_c1 | 3300050507 | Bacteria | 10589 |
| 453 | nmdc:mga05p37_211101_c1 | 3300050507 | Bacteria | 2347 |
| 454 | nmdc:mga09592_15547_c1 | 3300050508 | Bacteria | 6221 |
| 455 | nmdc:mga0qj67_8134_c1 | 3300050509 | Bacteria | 7767 |
| 456 | nmdc:mga06r32_19108_c1 | 3300050510 | Bacteria | 6286 |
| 457 | nmdc:mga06r32_365897_c1 | 3300050510 | Bacteria | 1426 |
| 458 | nmdc:mga06r32_60599_c1 | 3300050510 | Bacteria | 3642 |
| 459 | nmdc:mga08y16_102770_c1 | 3300050511 | Bacteria | 2975 |
| 460 | nmdc:mga08y16_2287_c1 | 3300050511 | Bacteria | 19618 |
| 461 | nmdc:mga08y16_362061_c1 | 3300050511 | Bacteria | 1489 |
| 462 | nmdc:mga08y16_66007_c1 | 3300050511 | Bacteria | 3777 |
| 463 | nmdc:mga0n895_126211_c1 | 3300050512 | Bacteria | 2583 |
| 464 | nmdc:mga0rr50_125938_c1 | 3300050513 | Bacteria | 2046 |
| 465 | nmdc:mga0rr50_305870_c1 | 3300050513 | Bacteria | 1331 |
| 466 | nmdc:mga08x19_5782_c1 | 3300050514 | Bacteria | 7309 |
| 467 | nmdc:mga0a205_19434_c1 | 3300050515 | Bacteria | 6404 |
| 468 | Ga0495595_0058222 | 3300053084 | Bacteria | 1804 |
| 469 | Ga0495619_0093829 | 3300053085 | Bacteria | 2035 |
| 470 | Ga0500578_0046804 | 3300053086 | Bacteria | 2775 |
| 471 | Ga0500650_0025329 | 3300053098 | Bacteria | 2652 |
| 472 | Ga0500553_065809 | 3300053101 | Bacteria | 1682 |
| 473 | Ga0500560_000404 | 3300053107 | Bacteria | 5862 |
| 474 | Ga0500569_000761 | 3300053109 | Bacteria | 5643 |
| 475 | Ga0500594_0000945 | 3300053118 | Bacteria | 6250 |
| 476 | Ga0500652_002257 | 3300053131 | Bacteria | 5790 |
| 477 | Ga0500652_014215 | 3300053131 | Bacteria | 2841 |
| 478 | Ga0500658_0004248 | 3300053134 | Bacteria | 5373 |
| 479 | Ga0500561_0000666 | 3300053137 | Bacteria | 5441 |
| 480 | Ga0500588_0019960 | 3300053146 | Bacteria | 1790 |
| 481 | Ga0500600_0036907 | 3300053149 | Bacteria | 2836 |
| 482 | Ga0500616_0000755 | 3300053153 | Bacteria | 37233 |
| 483 | Ga0500616_0067091 | 3300053153 | Bacteria | 1840 |
| 484 | Ga0500633_0006280 | 3300053160 | Bacteria | 2901 |
| 485 | Ga0466962_0000233 | 3300061719 | Bacteria | 23138 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048917 | Ga0496114_0680413 | Ga0496114_0680413_20_865 | 270 |
| 2 | 3300005616 | Ga0068852_100056400 | Ga0068852_1000564004 | 299 |
| 3 | 3300044842 | Ga0466957_0337542 | Ga0466957_0337542_63_1004 | 309 |
| 4 | 3300049589 | Ga0501073_0350211 | Ga0501073_0350211_19_1005 | 309 |
| 5 | 3300032005 | Ga0307411_10056093 | Ga0307411_100560932 | 310 |
| 6 | 3300005347 | Ga0070668_100043684 | Ga0070668_1000436842 | 311 |
| 7 | 3300005367 | Ga0070667_100323165 | Ga0070667_1003231652 | 311 |
| 8 | 3300005843 | Ga0068860_100172475 | Ga0068860_1001724752 | 311 |
| 9 | 3300025972 | Ga0207668_10028898 | Ga0207668_100288984 | 311 |
| 10 | 3300026035 | Ga0207703_10050888 | Ga0207703_100508882 | 311 |
| 11 | 3300036401 | Ga0373937_0452341 | Ga0373937_0452341_210_1205 | 313 |
| 12 | 3300028794 | Ga0307515_10022984 | Ga0307515_100229843 | 315 |
| 13 | 3300013102 | Ga0157371_10067514 | Ga0157371_100675143 | 318 |
| 14 | 3300013307 | Ga0157372_10287763 | Ga0157372_102877632 | 318 |
| 15 | 3300014968 | Ga0157379_10392033 | Ga0157379_103920331 | 318 |
| 16 | 3300006358 | Ga0068871_100027176 | Ga0068871_1000271762 | 321 |
| 17 | 3300049579 | Ga0501043_0063003 | Ga0501043_0063003_1842_2873 | 321 |
| 18 | 3300049823 | Ga0501044_0031906 | Ga0501044_0031906_2697_3728 | 321 |
| 19 | 3300005327 | Ga0070658_10004588 | Ga0070658_100045888 | 322 |
| 20 | 3300005328 | Ga0070676_10014748 | Ga0070676_100147485 | 322 |
| 21 | 3300005331 | Ga0070670_100060122 | Ga0070670_1000601222 | 322 |
| 22 | 3300005334 | Ga0068869_100004228 | Ga0068869_1000042286 | 322 |
| 23 | 3300005336 | Ga0070680_100003234 | Ga0070680_1000032345 | 322 |
| 24 | 3300005337 | Ga0070682_100002451 | Ga0070682_1000024517 | 322 |
| 25 | 3300005338 | Ga0068868_100005180 | Ga0068868_1000051805 | 322 |
| 26 | 3300005339 | Ga0070660_100029230 | Ga0070660_1000292304 | 322 |
| 27 | 3300005340 | Ga0070689_100052309 | Ga0070689_1000523092 | 322 |
| 28 | 3300005341 | Ga0070691_10005633 | Ga0070691_100056334 | 322 |
| 29 | 3300005343 | Ga0070687_100179073 | Ga0070687_1001790731 | 322 |
| 30 | 3300005344 | Ga0070661_100050120 | Ga0070661_1000501202 | 322 |
| 31 | 3300005354 | Ga0070675_100005835 | Ga0070675_1000058355 | 322 |
| 32 | 3300005355 | Ga0070671_100002212 | Ga0070671_1000022123 | 322 |
| 33 | 3300005364 | Ga0070673_100125409 | Ga0070673_1001254092 | 322 |
| 34 | 3300005366 | Ga0070659_100039165 | Ga0070659_1000391652 | 322 |
| 35 | 3300005455 | Ga0070663_100006626 | Ga0070663_1000066264 | 322 |
| 36 | 3300005456 | Ga0070678_100008130 | Ga0070678_1000081304 | 322 |
| 37 | 3300005458 | Ga0070681_10172122 | Ga0070681_101721221 | 322 |
| 38 | 3300005530 | Ga0070679_100028110 | Ga0070679_1000281104 | 322 |
| 39 | 3300005539 | Ga0068853_100539299 | Ga0068853_1005392991 | 322 |
| 40 | 3300005544 | Ga0070686_100296778 | Ga0070686_1002967781 | 322 |
| 41 | 3300005547 | Ga0070693_100005315 | Ga0070693_1000053156 | 322 |
| 42 | 3300005563 | Ga0068855_100137621 | Ga0068855_1001376212 | 322 |
| 43 | 3300005564 | Ga0070664_100031524 | Ga0070664_1000315242 | 322 |
| 44 | 3300005577 | Ga0068857_100167480 | Ga0068857_1001674802 | 322 |
| 45 | 3300005578 | Ga0068854_100042922 | Ga0068854_1000429222 | 322 |
| 46 | 3300005614 | Ga0068856_100056231 | Ga0068856_1000562312 | 322 |
| 47 | 3300005615 | Ga0070702_100000382 | Ga0070702_1000003823 | 322 |
| 48 | 3300005618 | Ga0068864_100006746 | Ga0068864_1000067466 | 322 |
| 49 | 3300005834 | Ga0068851_10005204 | Ga0068851_100052049 | 322 |
| 50 | 3300005840 | Ga0068870_10002737 | Ga0068870_100027372 | 322 |
| 51 | 3300005841 | Ga0068863_100035875 | Ga0068863_1000358753 | 322 |
| 52 | 3300005843 | Ga0068860_100015607 | Ga0068860_1000156074 | 322 |
| 53 | 3300006058 | Ga0075432_10033856 | Ga0075432_100338562 | 322 |
| 54 | 3300006237 | Ga0097621_100025526 | Ga0097621_1000255261 | 322 |
| 55 | 3300006844 | Ga0075428_100134317 | Ga0075428_1001343172 | 322 |
| 56 | 3300006847 | Ga0075431_100081480 | Ga0075431_1000814802 | 322 |
| 57 | 3300006852 | Ga0075433_10002396 | Ga0075433_1000239611 | 322 |
| 58 | 3300006914 | Ga0075436_100015557 | Ga0075436_1000155574 | 322 |
| 59 | 3300007076 | Ga0075435_100001480 | Ga0075435_1000014804 | 322 |
| 60 | 3300009098 | Ga0105245_10010965 | Ga0105245_100109657 | 322 |
| 61 | 3300009101 | Ga0105247_10033037 | Ga0105247_100330373 | 322 |
| 62 | 3300009174 | Ga0105241_10015740 | Ga0105241_100157407 | 322 |
| 63 | 3300010375 | Ga0105239_10063676 | Ga0105239_100636762 | 322 |
| 64 | 3300011119 | Ga0105246_10009444 | Ga0105246_100094442 | 322 |
| 65 | 3300013104 | Ga0157370_10018705 | Ga0157370_100187052 | 322 |
| 66 | 3300013105 | Ga0157369_10207022 | Ga0157369_102070222 | 322 |
| 67 | 3300013296 | Ga0157374_10129419 | Ga0157374_101294192 | 322 |
| 68 | 3300014325 | Ga0163163_10062366 | Ga0163163_100623664 | 322 |
| 69 | 3300014745 | Ga0157377_10004325 | Ga0157377_100043257 | 322 |
| 70 | 3300020082 | Ga0206353_10439816 | Ga0206353_104398163 | 322 |
| 71 | 3300025321 | Ga0207656_10094493 | Ga0207656_100944932 | 322 |
| 72 | 3300025901 | Ga0207688_10013825 | Ga0207688_100138254 | 322 |
| 73 | 3300025907 | Ga0207645_10085247 | Ga0207645_100852472 | 322 |
| 74 | 3300025908 | Ga0207643_10000027 | Ga0207643_1000002716 | 322 |
| 75 | 3300025909 | Ga0207705_10056214 | Ga0207705_100562144 | 322 |
| 76 | 3300025912 | Ga0207707_10035341 | Ga0207707_100353412 | 322 |
| 77 | 3300025917 | Ga0207660_10218384 | Ga0207660_102183842 | 322 |
| 78 | 3300025918 | Ga0207662_10022691 | Ga0207662_100226911 | 322 |
| 79 | 3300025919 | Ga0207657_10115225 | Ga0207657_101152252 | 322 |
| 80 | 3300025920 | Ga0207649_10003298 | Ga0207649_100032984 | 322 |
| 81 | 3300025921 | Ga0207652_10004900 | Ga0207652_100049002 | 322 |
| 82 | 3300025925 | Ga0207650_10001414 | Ga0207650_100014146 | 322 |
| 83 | 3300025926 | Ga0207659_10028183 | Ga0207659_100281833 | 322 |
| 84 | 3300025927 | Ga0207687_10108804 | Ga0207687_101088042 | 322 |
| 85 | 3300025932 | Ga0207690_10107085 | Ga0207690_101070852 | 322 |
| 86 | 3300025942 | Ga0207689_10004346 | Ga0207689_100043464 | 322 |
| 87 | 3300025944 | Ga0207661_10012002 | Ga0207661_100120025 | 322 |
| 88 | 3300025945 | Ga0207679_10009014 | Ga0207679_100090146 | 322 |
| 89 | 3300025949 | Ga0207667_10048066 | Ga0207667_100480664 | 322 |
| 90 | 3300025960 | Ga0207651_10037039 | Ga0207651_100370392 | 322 |
| 91 | 3300025981 | Ga0207640_10156958 | Ga0207640_101569582 | 322 |
| 92 | 3300026041 | Ga0207639_10452868 | Ga0207639_104528681 | 322 |
| 93 | 3300026067 | Ga0207678_10000662 | Ga0207678_1000066234 | 322 |
| 94 | 3300026075 | Ga0207708_10067211 | Ga0207708_100672111 | 322 |
| 95 | 3300026078 | Ga0207702_10001188 | Ga0207702_1000118810 | 322 |
| 96 | 3300026088 | Ga0207641_10042523 | Ga0207641_100425234 | 322 |
| 97 | 3300026095 | Ga0207676_10011868 | Ga0207676_100118686 | 322 |
| 98 | 3300026116 | Ga0207674_10242599 | Ga0207674_102425992 | 322 |
| 99 | 3300026121 | Ga0207683_10002218 | Ga0207683_1000221816 | 322 |
| 100 | 3300026142 | Ga0207698_10025400 | Ga0207698_100254003 | 322 |
| 101 | 3300027907 | Ga0207428_10002503 | Ga0207428_100025039 | 322 |
| 102 | 3300028381 | Ga0268264_10035849 | Ga0268264_100358493 | 322 |
| 103 | 3300048905 | Ga0496102_0192978 | Ga0496102_0192978_212_1240 | 322 |
| 104 | 3300048906 | Ga0496103_0031484 | Ga0496103_0031484_1662_2690 | 322 |
| 105 | 3300048907 | Ga0496104_0001170 | Ga0496104_0001170_11151_12179 | 322 |
| 106 | 3300048908 | Ga0496105_0006599 | Ga0496105_0006599_2699_3727 | 322 |
| 107 | 3300048909 | Ga0496106_0008317 | Ga0496106_0008317_1620_2648 | 322 |
| 108 | 3300048910 | Ga0496107_0022541 | Ga0496107_0022541_3041_4069 | 322 |
| 109 | 3300048911 | Ga0496108_0002125 | Ga0496108_0002125_3878_4906 | 322 |
| 110 | 3300048913 | Ga0496110_0002646 | Ga0496110_0002646_9639_10667 | 322 |
| 111 | 3300048915 | Ga0496112_0043873 | Ga0496112_0043873_372_1400 | 322 |
| 112 | 3300048916 | Ga0496113_0044877 | Ga0496113_0044877_1876_2904 | 322 |
| 113 | 3300048917 | Ga0496114_0036187 | Ga0496114_0036187_270_1289 | 322 |
| 114 | 3300048918 | Ga0496115_0045886 | Ga0496115_0045886_1531_2559 | 322 |
| 115 | 3300050511 | nmdc:mga08y16_66007_c1 | nmdc:mga08y16_66007_c1_1803_2831 | 322 |
| 116 | 3300050512 | nmdc:mga0n895_126211_c1 | nmdc:mga0n895_126211_c1_695_1723 | 322 |
| 117 | 3300050513 | nmdc:mga0rr50_125938_c1 | nmdc:mga0rr50_125938_c1_439_1467 | 322 |
| 118 | 3300050514 | nmdc:mga08x19_5782_c1 | nmdc:mga08x19_5782_c1_2669_3697 | 322 |
| 119 | 3300050515 | nmdc:mga0a205_19434_c1 | nmdc:mga0a205_19434_c1_1880_2908 | 322 |
| 120 | 3300005614 | Ga0068856_100019295 | Ga0068856_1000192952 | 323 |
| 121 | 3300026078 | Ga0207702_10010960 | Ga0207702_100109601 | 323 |
| 122 | 3300001991 | JGI24743J22301_10020017 | JGI24743J22301_100200171 | 324 |
| 123 | 3300014969 | Ga0157376_10093168 | Ga0157376_100931683 | 324 |
| 124 | 3300025938 | Ga0207704_10207412 | Ga0207704_102074121 | 324 |
| 125 | 3300026075 | Ga0207708_10018814 | Ga0207708_100188145 | 324 |
| 126 | 3300031730 | Ga0307516_10035268 | Ga0307516_100352682 | 324 |
| 127 | 3300042005 | Ga0439448_0002961 | Ga0439448_0002961_1634_2662 | 324 |
| 128 | 3300042438 | Ga0439459_0000765 | Ga0439459_0000765_577_1605 | 324 |
| 129 | 3300042439 | Ga0439464_0002766 | Ga0439464_0002766_2427_3455 | 324 |
| 130 | 3300047315 | Ga0495581_0200255 | Ga0495581_0200255_55_1086 | 324 |
| 131 | 3300048917 | Ga0496114_0088731 | Ga0496114_0088731_830_1861 | 324 |
| 132 | 3300049571 | Ga0501034_0095213 | Ga0501034_0095213_209_1240 | 324 |
| 133 | 3300046683 | Ga0495658_0102803 | Ga0495658_0102803_16_1059 | 325 |
| 134 | 3300050510 | nmdc:mga06r32_60599_c1 | nmdc:mga06r32_60599_c1_1801_2949 | 325 |
| 135 | 3300006844 | Ga0075428_100041100 | Ga0075428_1000411001 | 327 |
| 136 | 3300006847 | Ga0075431_100015673 | Ga0075431_1000156732 | 327 |
| 137 | 3300006880 | Ga0075429_100037077 | Ga0075429_1000370773 | 327 |
| 138 | 3300009147 | Ga0114129_10001574 | Ga0114129_1000157429 | 327 |
| 139 | 3300031995 | Ga0307409_100254357 | Ga0307409_1002543572 | 327 |
| 140 | 3300032004 | Ga0307414_10037088 | Ga0307414_100370882 | 327 |
| 141 | 3300049581 | Ga0501047_0031348 | Ga0501047_0031348_2051_3154 | 327 |
| 142 | 3300050507 | nmdc:mga05p37_11378_c1 | nmdc:mga05p37_11378_c1_9370_10398 | 327 |
| 143 | 3300050510 | nmdc:mga06r32_365897_c1 | nmdc:mga06r32_365897_c1_157_1185 | 327 |
| 144 | 3300005438 | Ga0070701_10100200 | Ga0070701_101002001 | 328 |
| 145 | 3300009094 | Ga0111539_10188424 | Ga0111539_101884242 | 328 |
| 146 | 3300031852 | Ga0307410_10147355 | Ga0307410_101473552 | 328 |
| 147 | 3300037466 | Ga0395898_0025073 | Ga0395898_0025073_3389_4429 | 328 |
| 148 | 3300038443 | Ga0395901_0192661 | Ga0395901_0192661_1015_2055 | 328 |
| 149 | 3300038443 | Ga0395901_0066621 | Ga0395901_0066621_2041_3087 | 329 |
| 150 | 3300053107 | Ga0500560_000404 | Ga0500560_000404_972_2057 | 329 |
| 151 | 3300003354 | JGI25160J50197_1016954 | JGI25160J50197_10169542 | 330 |
| 152 | 3300005356 | Ga0070674_100214725 | Ga0070674_1002147252 | 330 |
| 153 | 3300013308 | Ga0157375_10057178 | Ga0157375_100571783 | 330 |
| 154 | 3300025901 | Ga0207688_10153747 | Ga0207688_101537471 | 330 |
| 155 | 3300025944 | Ga0207661_10278701 | Ga0207661_102787011 | 330 |
| 156 | 3300037312 | Ga0395899_0021027 | Ga0395899_0021027_3831_4895 | 330 |
| 157 | 3300037466 | Ga0395898_0123469 | Ga0395898_0123469_1312_2376 | 330 |
| 158 | 3300038443 | Ga0395901_0034769 | Ga0395901_0034769_2953_4017 | 330 |
| 159 | 3300044694 | Ga0466963_0000407 | Ga0466963_0000407_10412_11452 | 330 |
| 160 | 3300045976 | Ga0466967_0011811 | Ga0466967_0011811_1920_2960 | 330 |
| 161 | 3300048917 | Ga0496114_0130995 | Ga0496114_0130995_278_1306 | 330 |
| 162 | 3300006051 | Ga0075364_10025809 | Ga0075364_100258092 | 331 |
| 163 | 3300031901 | Ga0307406_10090429 | Ga0307406_100904292 | 331 |
| 164 | 3300002739 | JGI25158J39367_1000032 | JGI25158J39367_100003211 | 332 |
| 165 | 3300002773 | JGI25152J39213_1006252 | JGI25152J39213_10062522 | 332 |
| 166 | 3300002987 | JGI25159J45721_1001948 | JGI25159J45721_10019483 | 332 |
| 167 | 3300002987 | JGI25159J45721_1004540 | JGI25159J45721_10045404 | 332 |
| 168 | 3300003215 | JGI25153J46596_10003140 | JGI25153J46596_100031409 | 332 |
| 169 | 3300003374 | JGI25161J50226_1000129 | JGI25161J50226_100012915 | 332 |
| 170 | 3300004625 | Ga0055543_1000029 | Ga0055543_100002984 | 332 |
| 171 | 3300005262 | Ga0065165_1011090 | Ga0065165_10110902 | 332 |
| 172 | 3300005435 | Ga0070714_100178055 | Ga0070714_1001780552 | 332 |
| 173 | 3300025208 | Ga0209436_100026 | Ga0209436_10002645 | 332 |
| 174 | 3300025258 | Ga0209129_1000755 | Ga0209129_10007551 | 332 |
| 175 | 3300025284 | Ga0209130_1000030 | Ga0209130_100003042 | 332 |
| 176 | 3300025297 | Ga0209758_1000586 | Ga0209758_100058610 | 332 |
| 177 | 3300025302 | Ga0207426_1000047 | Ga0207426_1000047358 | 332 |
| 178 | 3300025303 | Ga0209051_1003256 | Ga0209051_100325610 | 332 |
| 179 | 3300025304 | Ga0209257_1013019 | Ga0209257_10130192 | 332 |
| 180 | 3300005337 | Ga0070682_100013826 | Ga0070682_1000138262 | 334 |
| 181 | 3300005339 | Ga0070660_100161196 | Ga0070660_1001611962 | 334 |
| 182 | 3300005343 | Ga0070687_100116342 | Ga0070687_1001163422 | 334 |
| 183 | 3300005347 | Ga0070668_100038719 | Ga0070668_1000387193 | 334 |
| 184 | 3300005354 | Ga0070675_100090936 | Ga0070675_1000909361 | 334 |
| 185 | 3300005441 | Ga0070700_100188770 | Ga0070700_1001887702 | 334 |
| 186 | 3300005455 | Ga0070663_100017480 | Ga0070663_1000174804 | 334 |
| 187 | 3300005577 | Ga0068857_100071257 | Ga0068857_1000712572 | 334 |
| 188 | 3300005614 | Ga0068856_100148950 | Ga0068856_1001489502 | 334 |
| 189 | 3300005616 | Ga0068852_100208037 | Ga0068852_1002080371 | 334 |
| 190 | 3300005719 | Ga0068861_100053596 | Ga0068861_1000535964 | 334 |
| 191 | 3300005841 | Ga0068863_100118855 | Ga0068863_1001188552 | 334 |
| 192 | 3300005842 | Ga0068858_100032402 | Ga0068858_1000324022 | 334 |
| 193 | 3300006881 | Ga0068865_100021006 | Ga0068865_1000210064 | 334 |
| 194 | 3300009098 | Ga0105245_10233685 | Ga0105245_102336852 | 334 |
| 195 | 3300009148 | Ga0105243_10065300 | Ga0105243_100653002 | 334 |
| 196 | 3300009553 | Ga0105249_10384603 | Ga0105249_103846032 | 334 |
| 197 | 3300011119 | Ga0105246_10057428 | Ga0105246_100574282 | 334 |
| 198 | 3300011119 | Ga0105246_10255150 | Ga0105246_102551502 | 334 |
| 199 | 3300014325 | Ga0163163_10147351 | Ga0163163_101473513 | 334 |
| 200 | 3300014968 | Ga0157379_10149139 | Ga0157379_101491393 | 334 |
| 201 | 3300025901 | Ga0207688_10009664 | Ga0207688_100096642 | 334 |
| 202 | 3300025907 | Ga0207645_10048199 | Ga0207645_100481992 | 334 |
| 203 | 3300025908 | Ga0207643_10048642 | Ga0207643_100486423 | 334 |
| 204 | 3300025942 | Ga0207689_10077742 | Ga0207689_100777422 | 334 |
| 205 | 3300025981 | Ga0207640_10057346 | Ga0207640_100573462 | 334 |
| 206 | 3300025986 | Ga0207658_10172866 | Ga0207658_101728661 | 334 |
| 207 | 3300026075 | Ga0207708_10066883 | Ga0207708_100668833 | 334 |
| 208 | 3300026116 | Ga0207674_10478507 | Ga0207674_104785071 | 334 |
| 209 | 3300026118 | Ga0207675_100061836 | Ga0207675_1000618362 | 334 |
| 210 | 3300048913 | Ga0496110_0125156 | Ga0496110_0125156_1204_2250 | 334 |
| 211 | 3300050511 | nmdc:mga08y16_362061_c1 | nmdc:mga08y16_362061_c1_308_1354 | 334 |
| 212 | 3300031901 | Ga0307406_10054115 | Ga0307406_100541152 | 335 |
| 213 | 3300031903 | Ga0307407_10006926 | Ga0307407_100069265 | 335 |
| 214 | iso_pu_bacteria | 2547132111 | 2547412335 | 335 |
| 215 | iso_pu_bacteria | 2582581313 | 2585304195 | 335 |
| 216 | iso_pu_bacteria | 2582581314 | 2585319064 | 335 |
| 217 | iso_pu_bacteria | 2643221647 | 2644270414 | 335 |
| 218 | iso_pu_bacteria | 2643221678 | 2644440914 | 335 |
| 219 | iso_pu_bacteria | 2643221714 | 2644631525 | 335 |
| 220 | iso_pu_bacteria | 2784746768 | 2785373259 | 335 |
| 221 | iso_pu_bacteria | 2786546132 | 2786674724 | 335 |
| 222 | iso_pu_bacteria | 2808606359 | 2808845363 | 335 |
| 223 | iso_pu_bacteria | 2808606375 | 2808915116 | 335 |
| 224 | iso_pu_bacteria | 2808606448 | 2809235634 | 335 |
| 225 | iso_pu_bacteria | 2811994917 | 2812482860 | 335 |
| 226 | iso_pu_bacteria | 2862281513 | 2862282987 | 335 |
| 227 | iso_pu_bacteria | 2862507626 | 2862507683 | 335 |
| 228 | iso_pu_bacteria | 2877676314 | 2877677652 | 335 |
| 229 | iso_pu_bacteria | 2912715099 | 2912715861 | 335 |
| 230 | iso_pu_bacteria | 2919468124 | 2919475136 | 335 |
| 231 | iso_pu_bacteria | 2946072368 | 2946079223 | 335 |
| 232 | iso_pu_bacteria | 2954002825 | 2954009582 | 335 |
| 233 | iso_pu_bacteria | 2954380949 | 2954382412 | 335 |
| 234 | iso_pu_bacteria | 2954673503 | 2954680677 | 335 |
| 235 | iso_pu_bacteria | 2954682443 | 2954683476 | 335 |
| 236 | iso_pu_bacteria | 2954691527 | 2954693217 | 335 |
| 237 | iso_pu_bacteria | 2954701450 | 2954708314 | 335 |
| 238 | iso_pu_bacteria | 8008574985 | 8008575820 | 335 |
| 239 | iso_pu_bacteria | 8056829672 | 8056836153 | 335 |
| 240 | 3300006844 | Ga0075428_100034036 | Ga0075428_1000340363 | 336 |
| 241 | 3300006846 | Ga0075430_100045193 | Ga0075430_1000451933 | 336 |
| 242 | 3300006847 | Ga0075431_100016777 | Ga0075431_1000167775 | 336 |
| 243 | iso_pu_bacteria | 2565956761 | 2566992021 | 336 |
| 244 | iso_pu_bacteria | 2904535858 | 2904538580 | 336 |
| 245 | 3300005437 | Ga0070710_10041143 | Ga0070710_100411432 | 337 |
| 246 | 3300005440 | Ga0070705_100146845 | Ga0070705_1001468452 | 337 |
| 247 | 3300005471 | Ga0070698_100049412 | Ga0070698_1000494123 | 337 |
| 248 | 3300005614 | Ga0068856_100021793 | Ga0068856_1000217934 | 337 |
| 249 | 3300005615 | Ga0070702_100157787 | Ga0070702_1001577872 | 337 |
| 250 | 3300006028 | Ga0070717_10202837 | Ga0070717_102028372 | 337 |
| 251 | 3300006163 | Ga0070715_10024740 | Ga0070715_100247402 | 337 |
| 252 | 3300006173 | Ga0070716_100063237 | Ga0070716_1000632372 | 337 |
| 253 | 3300006175 | Ga0070712_100047555 | Ga0070712_1000475552 | 337 |
| 254 | 3300006237 | Ga0097621_100403929 | Ga0097621_1004039291 | 337 |
| 255 | 3300006871 | Ga0075434_100122558 | Ga0075434_1001225581 | 337 |
| 256 | 3300007076 | Ga0075435_100022856 | Ga0075435_1000228564 | 337 |
| 257 | 3300009098 | Ga0105245_10130157 | Ga0105245_101301572 | 337 |
| 258 | 3300025898 | Ga0207692_10018764 | Ga0207692_100187643 | 337 |
| 259 | 3300025905 | Ga0207685_10056463 | Ga0207685_100564632 | 337 |
| 260 | 3300025915 | Ga0207693_10095241 | Ga0207693_100952412 | 337 |
| 261 | 3300025915 | Ga0207693_10196769 | Ga0207693_101967692 | 337 |
| 262 | 3300025928 | Ga0207700_10030399 | Ga0207700_100303992 | 337 |
| 263 | 3300025929 | Ga0207664_10056401 | Ga0207664_100564012 | 337 |
| 264 | 3300026078 | Ga0207702_10020919 | Ga0207702_100209196 | 337 |
| 265 | 3300026121 | Ga0207683_10279266 | Ga0207683_102792661 | 337 |
| 266 | 3300034818 | Ga0373950_0008549 | Ga0373950_0008549_501_1517 | 337 |
| 267 | 3300034820 | Ga0373959_0024467 | Ga0373959_0024467_21_1037 | 337 |
| 268 | 3300034957 | Ga0373938_0022720 | Ga0373938_0022720_19_1035 | 337 |
| 269 | 3300035242 | Ga0373962_0040318 | Ga0373962_0040318_227_1243 | 337 |
| 270 | 3300035725 | Ga0373947_0199820 | Ga0373947_0199820_91_1107 | 337 |
| 271 | 3300046531 | Ga0495665_0094501 | Ga0495665_0094501_122_1135 | 337 |
| 272 | 3300048903 | Ga0496100_0045427 | Ga0496100_0045427_1424_2440 | 337 |
| 273 | 3300048904 | Ga0496101_0152973 | Ga0496101_0152973_718_1734 | 337 |
| 274 | 3300048905 | Ga0496102_0159203 | Ga0496102_0159203_313_1329 | 337 |
| 275 | 3300048906 | Ga0496103_0094506 | Ga0496103_0094506_263_1279 | 337 |
| 276 | 3300048909 | Ga0496106_0045013 | Ga0496106_0045013_2276_3292 | 337 |
| 277 | 3300048910 | Ga0496107_0114771 | Ga0496107_0114771_548_1564 | 337 |
| 278 | 3300048912 | Ga0496109_0055058 | Ga0496109_0055058_546_1562 | 337 |
| 279 | 3300048913 | Ga0496110_0111410 | Ga0496110_0111410_426_1442 | 337 |
| 280 | 3300048915 | Ga0496112_0109233 | Ga0496112_0109233_426_1442 | 337 |
| 281 | 3300048917 | Ga0496114_0072364 | Ga0496114_0072364_908_1924 | 337 |
| 282 | 3300049570 | Ga0501033_0131872 | Ga0501033_0131872_222_1319 | 337 |
| 283 | 3300049571 | Ga0501034_0053350 | Ga0501034_0053350_1271_2332 | 337 |
| 284 | 3300049581 | Ga0501047_0187906 | Ga0501047_0187906_390_1451 | 337 |
| 285 | 3300049582 | Ga0501048_0078871 | Ga0501048_0078871_903_1964 | 337 |
| 286 | 3300049823 | Ga0501044_0102524 | Ga0501044_0102524_1006_2067 | 337 |
| 287 | 3300050513 | nmdc:mga0rr50_305870_c1 | nmdc:mga0rr50_305870_c1_299_1315 | 337 |
| 288 | iso_pu_bacteria | 2537561592 | 2537900363 | 337 |
| 289 | iso_pu_bacteria | 2818991318 | 2819427576 | 337 |
| 290 | iso_pu_bacteria | 2945941187 | 2945943518 | 337 |
| 291 | 3300048929 | Ga0496126_0000013 | Ga0496126_0000013_652990_654006 | 338 |
| 292 | iso_pu_bacteria | 2523231044 | 2523384740 | 338 |
| 293 | 3300003323 | rootH1_10028509 | rootH1_100285096 | 339 |
| 294 | 3300006042 | Ga0075368_10003495 | Ga0075368_100034956 | 339 |
| 295 | 3300006048 | Ga0075363_100005240 | Ga0075363_1000052405 | 339 |
| 296 | 3300006048 | Ga0075363_100040774 | Ga0075363_1000407742 | 339 |
| 297 | 3300006178 | Ga0075367_10001135 | Ga0075367_100011354 | 339 |
| 298 | 3300009147 | Ga0114129_10217028 | Ga0114129_102170282 | 339 |
| 299 | 3300009148 | Ga0105243_10372912 | Ga0105243_103729121 | 339 |
| 300 | 3300011119 | Ga0105246_10194529 | Ga0105246_101945292 | 339 |
| 301 | 3300014497 | Ga0182008_10001253 | Ga0182008_1000125313 | 339 |
| 302 | 3300015262 | Ga0182007_10006831 | Ga0182007_100068313 | 339 |
| 303 | 3300015688 | Ga0183367_1001 | Ga0183367_1001985 | 339 |
| 304 | 3300025904 | Ga0207647_10015251 | Ga0207647_100152513 | 339 |
| 305 | 3300028794 | Ga0307515_10067479 | Ga0307515_100674793 | 339 |
| 306 | 3300030522 | Ga0307512_10014920 | Ga0307512_100149203 | 339 |
| 307 | 3300031456 | Ga0307513_10183056 | Ga0307513_101830562 | 339 |
| 308 | 3300031616 | Ga0307508_10005047 | Ga0307508_100050479 | 339 |
| 309 | 3300031616 | Ga0307508_10009146 | Ga0307508_100091466 | 339 |
| 310 | 3300031730 | Ga0307516_10010982 | Ga0307516_100109829 | 339 |
| 311 | 3300037418 | Ga0395900_0066140 | Ga0395900_0066140_2514_3545 | 339 |
| 312 | 3300037466 | Ga0395898_0023284 | Ga0395898_0023284_4272_5303 | 339 |
| 313 | 3300038443 | Ga0395901_0148884 | Ga0395901_0148884_389_1420 | 339 |
| 314 | 3300041452 | Ga0451793_1621772 | Ga0451793_1621772_1819_2853 | 339 |
| 315 | 3300041491 | Ga0451833_1195762 | Ga0451833_1195762_732_1766 | 339 |
| 316 | 3300041512 | Ga0451853_2069982 | Ga0451853_2069982_1136_2158 | 339 |
| 317 | 3300044656 | Ga0466969_0049026 | Ga0466969_0049026_978_2012 | 339 |
| 318 | 3300044658 | Ga0466972_0014799 | Ga0466972_0014799_377_1411 | 339 |
| 319 | 3300044683 | Ga0466965_0000288 | Ga0466965_0000288_12980_14014 | 339 |
| 320 | 3300044684 | Ga0466966_0008623 | Ga0466966_0008623_4672_5706 | 339 |
| 321 | 3300044684 | Ga0466966_0059431 | Ga0466966_0059431_647_1678 | 339 |
| 322 | 3300044693 | Ga0466961_0016710 | Ga0466961_0016710_2770_3804 | 339 |
| 323 | 3300044694 | Ga0466963_0007390 | Ga0466963_0007390_1043_2077 | 339 |
| 324 | 3300044706 | Ga0466964_0003528 | Ga0466964_0003528_1947_2981 | 339 |
| 325 | 3300044719 | Ga0466971_0001045 | Ga0466971_0001045_5880_6914 | 339 |
| 326 | 3300044765 | Ga0466970_0001450 | Ga0466970_0001450_8348_9382 | 339 |
| 327 | 3300044842 | Ga0466957_0004375 | Ga0466957_0004375_2212_3246 | 339 |
| 328 | 3300045049 | Ga0466959_0007571 | Ga0466959_0007571_1043_2077 | 339 |
| 329 | 3300045976 | Ga0466967_0013565 | Ga0466967_0013565_2014_3048 | 339 |
| 330 | 3300045976 | Ga0466967_0028970 | Ga0466967_0028970_1370_2392 | 339 |
| 331 | 3300045976 | Ga0466967_0029886 | Ga0466967_0029886_346_1377 | 339 |
| 332 | 3300045976 | Ga0466967_0114834 | Ga0466967_0114834_36_1064 | 339 |
| 333 | 3300048903 | Ga0496100_0235502 | Ga0496100_0235502_109_1131 | 339 |
| 334 | 3300049570 | Ga0501033_0022434 | Ga0501033_0022434_2410_3441 | 339 |
| 335 | 3300049822 | Ga0501035_0063613 | Ga0501035_0063613_479_1510 | 339 |
| 336 | 3300049823 | Ga0501044_0004785 | Ga0501044_0004785_1336_2358 | 339 |
| 337 | 3300050490 | nmdc:mga03n38_49228_c1 | nmdc:mga03n38_49228_c1_821_1846 | 339 |
| 338 | 3300050492 | nmdc:mga0yw44_154324_c1 | nmdc:mga0yw44_154324_c1_252_1274 | 339 |
| 339 | 3300050496 | nmdc:mga07m45_65807_c2 | nmdc:mga07m45_65807_c2_490_1509 | 339 |
| 340 | 3300050507 | nmdc:mga05p37_211101_c1 | nmdc:mga05p37_211101_c1_412_1578 | 339 |
| 341 | 3300050508 | nmdc:mga09592_15547_c1 | nmdc:mga09592_15547_c1_4832_5998 | 339 |
| 342 | 3300050509 | nmdc:mga0qj67_8134_c1 | nmdc:mga0qj67_8134_c1_5441_6607 | 339 |
| 343 | 3300050510 | nmdc:mga06r32_19108_c1 | nmdc:mga06r32_19108_c1_5060_6226 | 339 |
| 344 | 3300061719 | Ga0466962_0000233 | Ga0466962_0000233_915_1949 | 339 |
| 345 | iso_pu_bacteria | 2784132148 | 2784591998 | 339 |
| 346 | iso_pu_bacteria | 8023623736 | 8023624180 | 339 |
| 347 | 3300003316 | rootH1_10000180 | rootH1_1000018020 | 340 |
| 348 | 3300003320 | rootH2_10014605 | rootH2_100146052 | 340 |
| 349 | 3300003322 | rootL2_10017864 | rootL2_100178642 | 340 |
| 350 | 3300003323 | rootH1_10022852 | rootH1_100228527 | 340 |
| 351 | 3300003771 | Ga0055526_1013602 | Ga0055526_10136022 | 340 |
| 352 | 3300006048 | Ga0075363_100089417 | Ga0075363_1000894172 | 340 |
| 353 | 3300013102 | Ga0157371_10039980 | Ga0157371_100399802 | 340 |
| 354 | 3300013104 | Ga0157370_10007445 | Ga0157370_100074454 | 340 |
| 355 | 3300037853 | Ga0436364_0625262 | Ga0436364_0625262_611_1633 | 340 |
| 356 | 3300048911 | Ga0496108_0072797 | Ga0496108_0072797_216_1238 | 340 |
| 357 | 3300049568 | Ga0501031_0006068 | Ga0501031_0006068_6165_7244 | 340 |
| 358 | 3300049569 | Ga0501032_0098136 | Ga0501032_0098136_786_1865 | 340 |
| 359 | 3300049570 | Ga0501033_0033137 | Ga0501033_0033137_347_1426 | 340 |
| 360 | 3300049571 | Ga0501034_0035780 | Ga0501034_0035780_3678_4757 | 340 |
| 361 | 3300049572 | Ga0501036_0117493 | Ga0501036_0117493_864_1943 | 340 |
| 362 | 3300049573 | Ga0501037_0042996 | Ga0501037_0042996_1483_2562 | 340 |
| 363 | 3300049575 | Ga0501039_0170821 | Ga0501039_0170821_147_1226 | 340 |
| 364 | 3300049578 | Ga0501042_0004136 | Ga0501042_0004136_88_1167 | 340 |
| 365 | 3300049579 | Ga0501043_0016086 | Ga0501043_0016086_3660_4739 | 340 |
| 366 | 3300049581 | Ga0501047_0079054 | Ga0501047_0079054_1302_2381 | 340 |
| 367 | 3300031548 | Ga0307408_100246880 | Ga0307408_1002468802 | 341 |
| 368 | 3300031911 | Ga0307412_10302409 | Ga0307412_103024092 | 341 |
| 369 | 3300031995 | Ga0307409_100192151 | Ga0307409_1001921511 | 341 |
| 370 | 3300042005 | Ga0439448_0025371 | Ga0439448_0025371_513_1592 | 341 |
| 371 | 3300042138 | Ga0450903_000618 | Ga0450903_000618_4421_5500 | 341 |
| 372 | 3300042157 | Ga0439458_0020604 | Ga0439458_0020604_171_1256 | 341 |
| 373 | 3300046660 | Ga0495625_0125867 | Ga0495625_0125867_68_1147 | 341 |
| 374 | 3300047447 | Ga0495685_015891 | Ga0495685_015891_701_1780 | 341 |
| 375 | iso_pu_bacteria | 2954711539 | 2954712890 | 341 |
| 376 | iso_pu_bacteria | 2954721474 | 2954722848 | 341 |
| 377 | iso_pu_bacteria | 2954731030 | 2954738981 | 341 |
| 378 | iso_pu_bacteria | 2954740390 | 2954741759 | 341 |
| 379 | iso_pu_bacteria | 2954749733 | 2954757839 | 341 |
| 380 | iso_pu_bacteria | 2954759201 | 2954760738 | 341 |
| 381 | 3300005345 | Ga0070692_10119983 | Ga0070692_101199831 | 342 |
| 382 | 3300005347 | Ga0070668_100260790 | Ga0070668_1002607902 | 342 |
| 383 | 3300005353 | Ga0070669_100180476 | Ga0070669_1001804762 | 342 |
| 384 | 3300005354 | Ga0070675_100045723 | Ga0070675_1000457231 | 342 |
| 385 | 3300005434 | Ga0070709_10135093 | Ga0070709_101350932 | 342 |
| 386 | 3300005436 | Ga0070713_100001480 | Ga0070713_10000148010 | 342 |
| 387 | 3300005471 | Ga0070698_100076215 | Ga0070698_1000762152 | 342 |
| 388 | 3300005563 | Ga0068855_100169094 | Ga0068855_1001690942 | 342 |
| 389 | 3300005577 | Ga0068857_100067487 | Ga0068857_1000674872 | 342 |
| 390 | 3300006028 | Ga0070717_10150150 | Ga0070717_101501502 | 342 |
| 391 | 3300006051 | Ga0075364_10067995 | Ga0075364_100679952 | 342 |
| 392 | 3300006173 | Ga0070716_100153417 | Ga0070716_1001534172 | 342 |
| 393 | 3300006844 | Ga0075428_100440234 | Ga0075428_1004402341 | 342 |
| 394 | 3300009092 | Ga0105250_10023373 | Ga0105250_100233732 | 342 |
| 395 | 3300009551 | Ga0105238_10195887 | Ga0105238_101958871 | 342 |
| 396 | 3300017792 | Ga0163161_10173543 | Ga0163161_101735431 | 342 |
| 397 | 3300020082 | Ga0206353_11470034 | Ga0206353_114700342 | 342 |
| 398 | 3300025915 | Ga0207693_10179859 | Ga0207693_101798591 | 342 |
| 399 | 3300025928 | Ga0207700_10206722 | Ga0207700_102067222 | 342 |
| 400 | 3300025939 | Ga0207665_10160472 | Ga0207665_101604722 | 342 |
| 401 | 3300025972 | Ga0207668_10212793 | Ga0207668_102127932 | 342 |
| 402 | 3300026116 | Ga0207674_10006429 | Ga0207674_1000642912 | 342 |
| 403 | 3300031730 | Ga0307516_10001110 | Ga0307516_100011105 | 342 |
| 404 | 3300042016 | Ga0439463_004853 | Ga0439463_004853_1685_2713 | 342 |
| 405 | 3300044901 | Ga0466960_0011604 | Ga0466960_0011604_252_1280 | 342 |
| 406 | 3300049583 | Ga0501067_0000945 | Ga0501067_0000945_13629_14660 | 342 |
| 407 | 3300049585 | Ga0501069_0106308 | Ga0501069_0106308_502_1533 | 342 |
| 408 | 3300050491 | nmdc:mga00v17_60340_c1 | nmdc:mga00v17_60340_c1_718_1746 | 342 |
| 409 | 3300053098 | Ga0500650_0025329 | Ga0500650_0025329_161_1225 | 342 |
| 410 | 3300053118 | Ga0500594_0000945 | Ga0500594_0000945_1553_2617 | 342 |
| 411 | 3300053131 | Ga0500652_014215 | Ga0500652_014215_234_1298 | 342 |
| 412 | 3300005336 | Ga0070680_100074541 | Ga0070680_1000745412 | 343 |
| 413 | 3300006038 | Ga0075365_10018647 | Ga0075365_100186472 | 343 |
| 414 | 3300006844 | Ga0075428_100098914 | Ga0075428_1000989142 | 343 |
| 415 | 3300006914 | Ga0075436_100085053 | Ga0075436_1000850531 | 343 |
| 416 | 3300009094 | Ga0111539_10004308 | Ga0111539_1000430818 | 343 |
| 417 | 3300009098 | Ga0105245_10265589 | Ga0105245_102655892 | 343 |
| 418 | 3300009098 | Ga0105245_10305973 | Ga0105245_103059732 | 343 |
| 419 | 3300009176 | Ga0105242_10141097 | Ga0105242_101410972 | 343 |
| 420 | 3300014745 | Ga0157377_10108768 | Ga0157377_101087681 | 343 |
| 421 | 3300017792 | Ga0163161_10073330 | Ga0163161_100733302 | 343 |
| 422 | 3300021388 | Ga0213875_10003363 | Ga0213875_100033631 | 343 |
| 423 | 3300024225 | Ga0224572_1000112 | Ga0224572_10001124 | 343 |
| 424 | 3300025261 | Ga0209233_1000068 | Ga0209233_1000068230 | 343 |
| 425 | 3300025901 | Ga0207688_10145131 | Ga0207688_101451311 | 343 |
| 426 | 3300025912 | Ga0207707_10221652 | Ga0207707_102216522 | 343 |
| 427 | 3300025919 | Ga0207657_10234530 | Ga0207657_102345301 | 343 |
| 428 | 3300025927 | Ga0207687_10113803 | Ga0207687_101138032 | 343 |
| 429 | 3300025927 | Ga0207687_10144169 | Ga0207687_101441692 | 343 |
| 430 | 3300025927 | Ga0207687_10291035 | Ga0207687_102910351 | 343 |
| 431 | 3300025928 | Ga0207700_10135387 | Ga0207700_101353871 | 343 |
| 432 | 3300025934 | Ga0207686_10165987 | Ga0207686_101659872 | 343 |
| 433 | 3300025940 | Ga0207691_10081164 | Ga0207691_100811641 | 343 |
| 434 | 3300025941 | Ga0207711_10372192 | Ga0207711_103721921 | 343 |
| 435 | 3300025986 | Ga0207658_10120660 | Ga0207658_101206602 | 343 |
| 436 | 3300027907 | Ga0207428_10056489 | Ga0207428_100564892 | 343 |
| 437 | 3300028379 | Ga0268266_10056653 | Ga0268266_100566532 | 343 |
| 438 | 3300028786 | Ga0307517_10022489 | Ga0307517_100224895 | 343 |
| 439 | 3300031616 | Ga0307508_10017515 | Ga0307508_100175158 | 343 |
| 440 | 3300031730 | Ga0307516_10077394 | Ga0307516_100773942 | 343 |
| 441 | 3300031995 | Ga0307409_100450271 | Ga0307409_1004502711 | 343 |
| 442 | 3300032002 | Ga0307416_100053639 | Ga0307416_1000536393 | 343 |
| 443 | 3300032002 | Ga0307416_100055376 | Ga0307416_1000553764 | 343 |
| 444 | 3300032004 | Ga0307414_10177682 | Ga0307414_101776821 | 343 |
| 445 | 3300032126 | Ga0307415_100106504 | Ga0307415_1001065042 | 343 |
| 446 | 3300035113 | Ga0373936_0070667 | Ga0373936_0070667_68_1153 | 343 |
| 447 | 3300035170 | Ga0373943_0096884 | Ga0373943_0096884_53_1192 | 343 |
| 448 | 3300037418 | Ga0395900_0010983 | Ga0395900_0010983_2537_3583 | 343 |
| 449 | 3300037466 | Ga0395898_0002705 | Ga0395898_0002705_14533_15579 | 343 |
| 450 | 3300037471 | Ga0395905_0004921 | Ga0395905_0004921_504_1550 | 343 |
| 451 | 3300037853 | Ga0436364_0286659 | Ga0436364_0286659_3252_4283 | 343 |
| 452 | 3300038443 | Ga0395901_0009925 | Ga0395901_0009925_7159_8205 | 343 |
| 453 | 3300041443 | Ga0451789_1275942 | Ga0451789_1275942_455_1486 | 343 |
| 454 | 3300041452 | Ga0451793_0901224 | Ga0451793_0901224_6139_7170 | 343 |
| 455 | 3300041498 | Ga0451841_0566005 | Ga0451841_0566005_430_1461 | 343 |
| 456 | 3300041505 | Ga0451849_0096531 | Ga0451849_0096531_65_1096 | 343 |
| 457 | 3300041509 | Ga0451843_1637094 | Ga0451843_1637094_638_1669 | 343 |
| 458 | 3300041512 | Ga0451853_0970575 | Ga0451853_0970575_2600_3631 | 343 |
| 459 | 3300042993 | Ga0439440_0040691 | Ga0439440_0040691_41_1078 | 343 |
| 460 | 3300044683 | Ga0466965_0080537 | Ga0466965_0080537_61_1104 | 343 |
| 461 | 3300046462 | Ga0495651_0056912 | Ga0495651_0056912_387_1472 | 343 |
| 462 | 3300046463 | Ga0495653_0047675 | Ga0495653_0047675_1327_2412 | 343 |
| 463 | 3300046522 | Ga0495643_0002710 | Ga0495643_0002710_1456_2499 | 343 |
| 464 | 3300046529 | Ga0495652_0136576 | Ga0495652_0136576_262_1347 | 343 |
| 465 | 3300046616 | Ga0495668_0000128 | Ga0495668_0000128_59716_60798 | 343 |
| 466 | 3300046691 | Ga0495670_0007291 | Ga0495670_0007291_265_1308 | 343 |
| 467 | 3300046794 | Ga0495589_0061645 | Ga0495589_0061645_651_1694 | 343 |
| 468 | 3300047318 | Ga0495636_0031973 | Ga0495636_0031973_929_1972 | 343 |
| 469 | 3300047321 | Ga0495676_0093852 | Ga0495676_0093852_1068_2099 | 343 |
| 470 | 3300047321 | Ga0495676_0210146 | Ga0495676_0210146_28_1071 | 343 |
| 471 | 3300047322 | Ga0495680_0106760 | Ga0495680_0106760_458_1543 | 343 |
| 472 | 3300047443 | Ga0495687_011432 | Ga0495687_011432_2963_4006 | 343 |
| 473 | 3300047443 | Ga0495687_013809 | Ga0495687_013809_2128_3171 | 343 |
| 474 | 3300047446 | Ga0495679_016103 | Ga0495679_016103_1569_2612 | 343 |
| 475 | 3300047447 | Ga0495685_002934 | Ga0495685_002934_1624_2667 | 343 |
| 476 | 3300047470 | Ga0495681_0014664 | Ga0495681_0014664_2965_4008 | 343 |
| 477 | 3300048088 | Ga0495602_0226640 | Ga0495602_0226640_334_1365 | 343 |
| 478 | 3300048903 | Ga0496100_0080594 | Ga0496100_0080594_779_1810 | 343 |
| 479 | 3300048906 | Ga0496103_0178663 | Ga0496103_0178663_283_1314 | 343 |
| 480 | 3300048907 | Ga0496104_0142839 | Ga0496104_0142839_900_1931 | 343 |
| 481 | 3300048912 | Ga0496109_0050350 | Ga0496109_0050350_1929_2969 | 343 |
| 482 | 3300048912 | Ga0496109_0189088 | Ga0496109_0189088_864_1895 | 343 |
| 483 | 3300048913 | Ga0496110_0322680 | Ga0496110_0322680_324_1355 | 343 |
| 484 | 3300048914 | Ga0496111_0356391 | Ga0496111_0356391_22_1053 | 343 |
| 485 | 3300048917 | Ga0496114_0187933 | Ga0496114_0187933_114_1145 | 343 |
| 486 | 3300048917 | Ga0496114_0357499 | Ga0496114_0357499_109_1140 | 343 |
| 487 | 3300049656 | Ga0501209_035382 | Ga0501209_035382_169_1200 | 343 |
| 488 | 3300050492 | nmdc:mga0yw44_104001_c1 | nmdc:mga0yw44_104001_c1_501_1532 | 343 |
| 489 | 3300050511 | nmdc:mga08y16_2287_c1 | nmdc:mga08y16_2287_c1_1219_2250 | 343 |
| 490 | 3300053084 | Ga0495595_0058222 | Ga0495595_0058222_368_1453 | 343 |
| 491 | 3300053085 | Ga0495619_0093829 | Ga0495619_0093829_426_1511 | 343 |
| 492 | 3300053086 | Ga0500578_0046804 | Ga0500578_0046804_191_1234 | 343 |
| 493 | 3300053101 | Ga0500553_065809 | Ga0500553_065809_66_1109 | 343 |
| 494 | 3300053109 | Ga0500569_000761 | Ga0500569_000761_4331_5374 | 343 |
| 495 | 3300053131 | Ga0500652_002257 | Ga0500652_002257_4587_5630 | 343 |
| 496 | 3300053134 | Ga0500658_0004248 | Ga0500658_0004248_4143_5186 | 343 |
| 497 | 3300053137 | Ga0500561_0000666 | Ga0500561_0000666_3669_4712 | 343 |
| 498 | 3300053146 | Ga0500588_0019960 | Ga0500588_0019960_560_1603 | 343 |
| 499 | 3300053149 | Ga0500600_0036907 | Ga0500600_0036907_479_1522 | 343 |
| 500 | 3300053153 | Ga0500616_0000755 | Ga0500616_0000755_34325_35362 | 343 |
| 501 | 3300053153 | Ga0500616_0067091 | Ga0500616_0067091_128_1171 | 343 |
| 502 | 3300053160 | Ga0500633_0006280 | Ga0500633_0006280_189_1232 | 343 |
| 503 | iso_pu_bacteria | 2922554459 | 2922559310 | 343 |
| 504 | 3300044694 | Ga0466963_0213299 | Ga0466963_0213299_23_1138 | 344 |
| 505 | 3300048905 | Ga0496102_0126871 | Ga0496102_0126871_901_2037 | 344 |
| 506 | 3300005577 | Ga0068857_100372821 | Ga0068857_1003728211 | 345 |
| 507 | 3300035091 | Ga0373951_0000019 | Ga0373951_0000019_47078_48151 | 345 |
| 508 | 3300000549 | LJQas_1005288 | LJQas_10052881 | 346 |
| 509 | 3300005337 | Ga0070682_100120104 | Ga0070682_1001201041 | 346 |
| 510 | 3300005345 | Ga0070692_10017388 | Ga0070692_100173882 | 346 |
| 511 | 3300005459 | Ga0068867_100070328 | Ga0068867_1000703282 | 346 |
| 512 | 3300005616 | Ga0068852_100091633 | Ga0068852_1000916331 | 346 |
| 513 | 3300005617 | Ga0068859_100508877 | Ga0068859_1005088771 | 346 |
| 514 | 3300005719 | Ga0068861_100036423 | Ga0068861_1000364231 | 346 |
| 515 | 3300006931 | Ga0097620_100508927 | Ga0097620_1005089271 | 346 |
| 516 | 3300009098 | Ga0105245_10019373 | Ga0105245_100193735 | 346 |
| 517 | 3300009148 | Ga0105243_10097192 | Ga0105243_100971922 | 346 |
| 518 | 3300025901 | Ga0207688_10023013 | Ga0207688_100230134 | 346 |
| 519 | 3300025940 | Ga0207691_10091483 | Ga0207691_100914831 | 346 |
| 520 | 3300025944 | Ga0207661_10044055 | Ga0207661_100440551 | 346 |
| 521 | 3300026118 | Ga0207675_100012606 | Ga0207675_1000126066 | 346 |
| 522 | 3300026142 | Ga0207698_10081872 | Ga0207698_100818722 | 346 |
| 523 | 3300048909 | Ga0496106_0051565 | Ga0496106_0051565_803_1843 | 346 |
| 524 | 3300048911 | Ga0496108_0080775 | Ga0496108_0080775_24_1130 | 346 |
| 525 | 3300048912 | Ga0496109_0115719 | Ga0496109_0115719_469_1575 | 346 |
| 526 | 3300050511 | nmdc:mga08y16_102770_c1 | nmdc:mga08y16_102770_c1_1806_2912 | 346 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5br1-assembly1.cif.gz_A | crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis s4 (avi_5305, target efi-511224) with bound alpha-d-galactosamine | 0.8854 | 62 | 338 |
| 5hqj-assembly1.cif.gz_A | crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose | 0.8818 | 56 | 340 |
| 2ioy-assembly2.cif.gz_B | crystal structure of thermoanaerobacter tengcongensis ribose binding protein | 0.8787 | 59 | 337 |
| 8wlb-assembly1.cif.gz_A | x-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose | 0.8773 | 62 | 333 |
| 7x0p-assembly1.cif.gz_A | crystal structure of sugar binding protein cbpd from clostridium thermocellum | 0.877 | 60 | 335 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jh9A01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8977 | 9 | 48 | 1.10.260.40 |
| af_P39265_140_289_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8933 | 170 | 316 | 3.40.50.2300 |
| 1qpzA01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8859 | 9 | 48 | 1.10.260.40 |
| 2puaA01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8814 | 9 | 48 | 1.10.260.40 |
| 2pucA01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8813 | 9 | 48 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0J6YZH1-F1-model_v4 | DNA-binding transcriptional repressor MalI | 0.952 | 1 | 340 |
GO:0000976
GO:0003700 |
| AF-A0A0J6YZH1-F1-model_v4 | DNA-binding transcriptional repressor MalI | 0.9358 | 1 | 340 |
GO:0000976
GO:0003700 |
| AF-A0A485AU08-F1-model_v4 | ABC-type sugar transport system, periplasmic component | 0.9278 | 66 | 343 |
GO:0030246
GO:0030313 |
| AF-K6WTP5-F1-model_v4 | Putative LacI family transcriptional regulator | 0.9212 | 4 | 339 |
GO:0003677
GO:0006355 GO:0030246 GO:0030288 |
| AF-A0A0L0MIH0-F1-model_v4 | Transcriptional regulator, LacI family | 0.9208 | 145 | 335 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar