F459376

General Info

Members Datasets Scaffolds Average Seq Length
526 250 1052 149

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100607989|Ga0070699_1006079892
Length 168
Sequence MPAFRIRGPDAEVDLNIGSAMPVFICPNCGNRLSSQDRTAGFSAKPRGCAKCGFGFMFELLDDYYPAPDAAFFVCDAEARIIGCGRGSFELTGLKDEATLGRPVKDVLGLRFDQDEDPIGTSLEWGVRVLGRAVQVEAEGDLPAKATADVFPAYDDDGGLLLVLTPKR

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
123 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
124 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
125 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
151 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
152 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
153 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
156 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
159 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 4.56
Rhizosphere 90.87
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100607989 3300005518 Bacteria 997
2 LJNas_1024603 3300000546 Bacteria 644
3 LJQas_1016207 3300000549 Bacteria 870
4 JGI24740J21852_10001762 3300001979 Bacteria 9933
5 JGI24748J21848_1000694 3300002074 Bacteria 3618
6 JGI24034J26672_10000749 3300002239 Bacteria 4198
7 JGI24742J22300_10004291 3300002244 Bacteria 2331
8 JGI25406J46586_10099385 3300003203 Bacteria 869
9 JGI25407J50210_10120278 3300003373 Bacteria 647
10 JGI25404J52841_10065721 3300003659 Bacteria 758
11 Ga0070658_10422908 3300005327 Bacteria 1146
12 Ga0070683_100255296 3300005329 Bacteria 1667
13 Ga0070683_100287018 3300005329 Bacteria 1565
14 Ga0070683_100699711 3300005329 Bacteria 971
15 Ga0070670_100038633 3300005331 Bacteria 4105
16 Ga0070677_10000015 3300005333 Bacteria 52793
17 Ga0068869_100959494 3300005334 Bacteria 743
18 Ga0070682_100660090 3300005337 Bacteria 834
19 Ga0070682_100762981 3300005337 Bacteria 782
20 Ga0070682_101571622 3300005337 Bacteria 568
21 Ga0068868_100185756 3300005338 Bacteria 1727
22 Ga0068868_100566757 3300005338 Bacteria 1002
23 Ga0068868_100770555 3300005338 Bacteria 866
24 Ga0070660_100008820 3300005339 Bacteria 7068
25 Ga0070660_100039159 3300005339 Bacteria 3602
26 Ga0070691_10000524 3300005341 Bacteria 14453
27 Ga0070691_10568945 3300005341 Bacteria 665
28 Ga0070687_100278598 3300005343 Bacteria 1052
29 Ga0070692_10635090 3300005345 Bacteria 711
30 Ga0070668_100256907 3300005347 Bacteria 1452
31 Ga0070674_100053021 3300005356 Bacteria 2799
32 Ga0070674_100240715 3300005356 Bacteria 1416
33 Ga0070659_100000052 3300005366 Bacteria 96862
34 Ga0070659_100260493 3300005366 Bacteria 1439
35 Ga0070659_100711510 3300005366 Bacteria 869
36 Ga0070714_100000104 3300005435 Bacteria 70946
37 Ga0070714_100001703 3300005435 Bacteria 15996
38 Ga0070714_100531609 3300005435 Bacteria 1124
39 Ga0070711_100134559 3300005439 Bacteria 1845
40 Ga0070711_100439638 3300005439 Bacteria 1066
41 Ga0070700_100028933 3300005441 Bacteria 3301
42 Ga0070700_100149178 3300005441 Bacteria 1597
43 Ga0070678_101814800 3300005456 Unclassified 575
44 Ga0070662_100028548 3300005457 Bacteria 3883
45 Ga0070662_101164826 3300005457 Bacteria 662
46 Ga0068867_100064145 3300005459 Bacteria 2731
47 Ga0068867_100224648 3300005459 Bacteria 1515
48 Ga0068867_100510637 3300005459 Bacteria 1034
49 Ga0068867_101109363 3300005459 Bacteria 723
50 Ga0068867_101202971 3300005459 Bacteria 696
51 Ga0070684_100401390 3300005535 Bacteria 1264
52 Ga0070684_100732213 3300005535 Bacteria 923
53 Ga0070684_101012576 3300005535 Bacteria 780
54 Ga0070684_101350416 3300005535 Bacteria 671
55 Ga0068853_100339320 3300005539 Bacteria 1396
56 Ga0070672_100275834 3300005543 Bacteria 1421
57 Ga0070672_100309908 3300005543 Bacteria 1340
58 Ga0070704_100193431 3300005549 Bacteria 1637
59 Ga0070704_100784028 3300005549 Bacteria 851
60 Ga0070664_100234828 3300005564 Bacteria 1645
61 Ga0068854_100009180 3300005578 Bacteria 6379
62 Ga0068854_101610221 3300005578 Bacteria 592
63 Ga0070702_100003220 3300005615 Bacteria 7261
64 Ga0070702_100281763 3300005615 Bacteria 1142
65 Ga0068852_100051736 3300005616 Bacteria 3527
66 Ga0068852_100294891 3300005616 Bacteria 1568
67 Ga0068859_100186183 3300005617 Bacteria 2160
68 Ga0068859_101360369 3300005617 Bacteria 783
69 Ga0068864_100058727 3300005618 Bacteria 3326
70 Ga0068866_10063601 3300005718 Bacteria 1924
71 Ga0068870_10083845 3300005840 Bacteria 1768
72 Ga0068870_10337507 3300005840 Bacteria 963
73 Ga0068863_100000022 3300005841 Bacteria 188278
74 Ga0068858_100000508 3300005842 Bacteria 40801
75 Ga0068858_100211753 3300005842 Bacteria 1834
76 Ga0068860_100331943 3300005843 Bacteria 1494
77 Ga0068862_101873139 3300005844 Unclassified 609
78 Ga0081455_10031993 3300005937 Bacteria 4748
79 Ga0081455_10446067 3300005937 Bacteria 885
80 Ga0081538_10000959 3300005981 Bacteria 30827
81 Ga0081538_10002012 3300005981 Bacteria 20319
82 Ga0081538_10005011 3300005981 Bacteria 12062
83 Ga0081538_10007761 3300005981 Bacteria 9226
84 Ga0081538_10009976 3300005981 Bacteria 7839
85 Ga0081538_10013689 3300005981 Bacteria 6410
86 Ga0081538_10014732 3300005981 Bacteria 6101
87 Ga0081538_10014783 3300005981 Bacteria 6085
88 Ga0081538_10017157 3300005981 Bacteria 5508
89 Ga0081538_10024724 3300005981 Bacteria 4269
90 Ga0081538_10035091 3300005981 Bacteria 3302
91 Ga0081538_10040946 3300005981 Bacteria 2947
92 Ga0081538_10157729 3300005981 Bacteria 1014
93 Ga0081538_10315119 3300005981 Bacteria 571
94 Ga0081540_1000366 3300005983 Bacteria 45428
95 Ga0081539_10000740 3300005985 Bacteria 65387
96 Ga0081539_10003483 3300005985 Bacteria 19226
97 Ga0081539_10049937 3300005985 Bacteria 2370
98 Ga0070717_10004120 3300006028 Bacteria 10479
99 Ga0075365_10029192 3300006038 Bacteria 3523
100 Ga0070716_100745687 3300006173 Bacteria 753
101 Ga0070716_100768919 3300006173 Bacteria 743
102 Ga0075428_100054546 3300006844 Bacteria 4380
103 Ga0075428_100314276 3300006844 Bacteria 1684
104 Ga0075428_100659393 3300006844 Bacteria 1116
105 Ga0075430_100001083 3300006846 Bacteria 21605
106 Ga0075430_100006480 3300006846 Bacteria 9866
107 Ga0075430_101194360 3300006846 Bacteria 626
108 Ga0075431_100062557 3300006847 Bacteria 3840
109 Ga0075431_100342188 3300006847 Bacteria 1505
110 Ga0075433_11447666 3300006852 Bacteria 594
111 Ga0075429_100020083 3300006880 Bacteria 5793
112 Ga0075436_100695870 3300006914 Bacteria 753
113 Ga0097620_100186183 3300006931 Bacteria 2160
114 Ga0097620_101359868 3300006931 Bacteria 783
115 Ga0111539_10189289 3300009094 Bacteria 2402
116 Ga0111539_10275902 3300009094 Bacteria 1956
117 Ga0111539_10930991 3300009094 Bacteria 1011
118 Ga0111539_11110033 3300009094 Bacteria 919
119 Ga0111539_12901100 3300009094 Bacteria 555
120 Ga0105245_10000517 3300009098 Bacteria 35353
121 Ga0105245_10037305 3300009098 Bacteria 4321
122 Ga0105245_10122731 3300009098 Bacteria 2428
123 Ga0105245_10220453 3300009098 Bacteria 1830
124 Ga0105245_10367037 3300009098 Bacteria 1430
125 Ga0105245_10483406 3300009098 Bacteria 1252
126 Ga0105245_10651654 3300009098 Bacteria 1083
127 Ga0105245_10719596 3300009098 Bacteria 1032
128 Ga0105245_10796343 3300009098 Bacteria 983
129 Ga0114129_10017597 3300009147 Bacteria 10174
130 Ga0114129_10043867 3300009147 Bacteria 6292
131 Ga0114129_10334531 3300009147 Bacteria 2010
132 Ga0114129_10473393 3300009147 Bacteria 1640
133 Ga0114129_11207614 3300009147 Bacteria 942
134 Ga0105243_10043619 3300009148 Bacteria 3515
135 Ga0105243_10055826 3300009148 Bacteria 3138
136 Ga0105243_10213852 3300009148 Bacteria 1699
137 Ga0105243_10239962 3300009148 Bacteria 1612
138 Ga0105243_10969217 3300009148 Bacteria 851
139 Ga0105243_11691210 3300009148 Bacteria 661
140 Ga0105243_11912234 3300009148 Bacteria 626
141 Ga0105242_12431432 3300009176 Bacteria 571
142 Ga0105242_12439787 3300009176 Bacteria 571
143 Ga0105237_10431828 3300009545 Bacteria 1323
144 Ga0105237_10825131 3300009545 Bacteria 934
145 Ga0105238_10000009 3300009551 Bacteria 288729
146 Ga0105238_11315402 3300009551 Bacteria 749
147 Ga0105249_10000178 3300009553 Bacteria 74768
148 Ga0105249_11273899 3300009553 Bacteria 807
149 Ga0105246_10213212 3300011119 Bacteria 1509
150 Ga0105246_10714284 3300011119 Bacteria 880
151 Ga0105246_11112849 3300011119 Bacteria 722
152 Ga0105246_11439615 3300011119 Bacteria 644
153 Ga0157371_10959655 3300013102 Bacteria 651
154 Ga0157370_10022403 3300013104 Bacteria 6286
155 Ga0157374_11041094 3300013296 Bacteria 838
156 Ga0157374_11768352 3300013296 Bacteria 643
157 Ga0157378_10676562 3300013297 Bacteria 1050
158 Ga0157378_10945238 3300013297 Bacteria 894
159 Ga0163162_10334726 3300013306 Bacteria 1646
160 Ga0157372_10076429 3300013307 Bacteria 3781
161 Ga0157372_10266133 3300013307 Bacteria 1991
162 Ga0157375_10003797 3300013308 Bacteria 13096
163 Ga0157375_11215685 3300013308 Bacteria 884
164 Ga0157375_11376920 3300013308 Bacteria 831
165 Ga0157375_11524431 3300013308 Bacteria 789
166 Ga0163163_10694857 3300014325 Bacteria 1081
167 Ga0163163_11288963 3300014325 Bacteria 793
168 Ga0163163_11311478 3300014325 Bacteria 786
169 Ga0163163_11463095 3300014325 Bacteria 745
170 Ga0163163_11506385 3300014325 Bacteria 734
171 Ga0157380_10888481 3300014326 Bacteria 916
172 Ga0157380_10905077 3300014326 Bacteria 909
173 Ga0157380_11076502 3300014326 Bacteria 842
174 Ga0157377_10020429 3300014745 Bacteria 3470
175 Ga0157379_10016865 3300014968 Bacteria 6428
176 Ga0157379_10680054 3300014968 Bacteria 965
177 Ga0157379_10854884 3300014968 Bacteria 861
178 Ga0157379_10940333 3300014968 Bacteria 821
179 Ga0163161_10220804 3300017792 Bacteria 1467
180 Ga0163161_10626818 3300017792 Bacteria 889
181 Ga0213874_10000096 3300021377 Bacteria 14046
182 Ga0213876_10003839 3300021384 Bacteria 8513
183 Ga0213876_10092363 3300021384 Bacteria 1603
184 Ga0213875_10009779 3300021388 Bacteria 4841
185 Ga0213875_10010323 3300021388 Bacteria 4678
186 Ga0213875_10376792 3300021388 Bacteria 675
187 Ga0207682_10000155 3300025893 Bacteria 31180
188 Ga0207699_10686656 3300025906 Bacteria 749
189 Ga0207643_10106165 3300025908 Bacteria 1651
190 Ga0207643_10217926 3300025908 Bacteria 1167
191 Ga0207643_10384547 3300025908 Bacteria 885
192 Ga0207705_10382305 3300025909 Bacteria 1087
193 Ga0207705_10491843 3300025909 Bacteria 952
194 Ga0207663_10141106 3300025916 Bacteria 1678
195 Ga0207663_11019750 3300025916 Bacteria 664
196 Ga0207662_10128945 3300025918 Bacteria 1593
197 Ga0207657_10017147 3300025919 Bacteria 6957
198 Ga0207657_10183448 3300025919 Bacteria 1691
199 Ga0207681_10002638 3300025923 Bacteria 11374
200 Ga0207681_10380846 3300025923 Bacteria 1136
201 Ga0207694_10000004 3300025924 Bacteria 967075
202 Ga0207650_11153157 3300025925 Bacteria 660
203 Ga0207687_10000085 3300025927 Bacteria 68919
204 Ga0207687_10027361 3300025927 Bacteria 3826
205 Ga0207687_10385368 3300025927 Bacteria 1149
206 Ga0207687_10497334 3300025927 Bacteria 1017
207 Ga0207687_10544740 3300025927 Bacteria 973
208 Ga0207687_10820999 3300025927 Bacteria 793
209 Ga0207687_11136410 3300025927 Bacteria 671
210 Ga0207687_11432382 3300025927 Bacteria 594
211 Ga0207664_10000004 3300025929 Bacteria 493014
212 Ga0207664_10001474 3300025929 Bacteria 15435
213 Ga0207664_10012057 3300025929 Bacteria 6172
214 Ga0207690_10000061 3300025932 Bacteria 98910
215 Ga0207690_10051120 3300025932 Bacteria 2762
216 Ga0207690_10402018 3300025932 Bacteria 1092
217 Ga0207690_10584702 3300025932 Bacteria 910
218 Ga0207706_10034595 3300025933 Bacteria 4495
219 Ga0207706_11084921 3300025933 Bacteria 669
220 Ga0207686_10159727 3300025934 Bacteria 1578
221 Ga0207686_10405785 3300025934 Bacteria 1039
222 Ga0207686_10746906 3300025934 Bacteria 781
223 Ga0207709_10313824 3300025935 Bacteria 1171
224 Ga0207709_10658145 3300025935 Bacteria 835
225 Ga0207709_11263065 3300025935 Bacteria 610
226 Ga0207669_10092478 3300025937 Bacteria 1973
227 Ga0207669_10177309 3300025937 Bacteria 1524
228 Ga0207704_10186120 3300025938 Bacteria 1506
229 Ga0207665_10117591 3300025939 Bacteria 1875
230 Ga0207691_10231805 3300025940 Bacteria 1599
231 Ga0207689_10381276 3300025942 Bacteria 1174
232 Ga0207689_10832002 3300025942 Bacteria 779
233 Ga0207661_10804347 3300025944 Bacteria 865
234 Ga0207661_10982343 3300025944 Bacteria 778
235 Ga0207651_11521575 3300025960 Bacteria 603
236 Ga0207712_10000118 3300025961 Bacteria 85518
237 Ga0207712_10143984 3300025961 Bacteria 1833
238 Ga0207712_10194342 3300025961 Bacteria 1604
239 Ga0207668_10021220 3300025972 Bacteria 4140
240 Ga0207668_10039801 3300025972 Bacteria 3168
241 Ga0207640_10020738 3300025981 Bacteria 3906
242 Ga0207640_11808511 3300025981 Bacteria 552
243 Ga0207677_10320950 3300026023 Bacteria 1287
244 Ga0207677_10532372 3300026023 Bacteria 1021
245 Ga0207677_10801412 3300026023 Bacteria 843
246 Ga0207703_10000385 3300026035 Bacteria 47298
247 Ga0207678_10186883 3300026067 Bacteria 1770
248 Ga0207678_10261428 3300026067 Bacteria 1483
249 Ga0207708_10014080 3300026075 Bacteria 5977
250 Ga0207708_10096629 3300026075 Bacteria 2283
251 Ga0207708_10162393 3300026075 Bacteria 1765
252 Ga0207648_10066173 3300026089 Bacteria 3152
253 Ga0207648_10068447 3300026089 Bacteria 3093
254 Ga0207648_10123755 3300026089 Bacteria 2274
255 Ga0207676_10655224 3300026095 Bacteria 1014
256 Ga0207674_10245620 3300026116 Bacteria 1737
257 Ga0207675_100016103 3300026118 Bacteria 6984
258 Ga0207675_100095082 3300026118 Bacteria 2803
259 Ga0207675_100477347 3300026118 Bacteria 1239
260 Ga0207698_10128403 3300026142 Bacteria 2161
261 Ga0207698_10183891 3300026142 Bacteria 1854
262 Ga0207428_10029672 3300027907 Bacteria 4529
263 Ga0207428_10105420 3300027907 Bacteria 2174
264 Ga0207428_10208198 3300027907 Bacteria 1470
265 Ga0268266_10022301 3300028379 Bacteria 5396
266 Ga0265326_10000055 3300028558 Bacteria 66050
267 Ga0265319_1000069 3300028563 Bacteria 82640
268 Ga0265319_1000668 3300028563 Bacteria 22474
269 Ga0265319_1002434 3300028563 Bacteria 10177
270 Ga0265334_10000002 3300028573 Bacteria 325014
271 Ga0265322_10043695 3300028654 Bacteria 1276
272 Ga0265336_10001387 3300028666 Bacteria 11166
273 Ga0265338_10002429 3300028800 Bacteria 27994
274 Ga0265320_10014055 3300031240 Bacteria 4579
275 Ga0265320_10028555 3300031240 Bacteria 2896
276 Ga0265320_10037020 3300031240 Bacteria 2461
277 Ga0265340_10259798 3300031247 Bacteria 773
278 Ga0265316_10651111 3300031344 Bacteria 745
279 Ga0307408_100070752 3300031548 Bacteria 2577
280 Ga0307408_100251143 3300031548 Bacteria 1459
281 Ga0265313_10188244 3300031595 Unclassified 864
282 Ga0307405_10063005 3300031731 Bacteria 2350
283 Ga0307405_10197655 3300031731 Bacteria 1458
284 Ga0307405_10460975 3300031731 Bacteria 1010
285 Ga0307405_10970165 3300031731 Unclassified 723
286 Ga0307413_10063187 3300031824 Bacteria 2294
287 Ga0307413_10517771 3300031824 Bacteria 961
288 Ga0307410_10027760 3300031852 Bacteria 3580
289 Ga0307410_10211564 3300031852 Bacteria 1486
290 Ga0307410_10353418 3300031852 Bacteria 1175
291 Ga0307406_10024474 3300031901 Bacteria 3607
292 Ga0307406_10114637 3300031901 Bacteria 1862
293 Ga0307406_11582809 3300031901 Unclassified 578
294 Ga0307407_10017463 3300031903 Bacteria 3601
295 Ga0307407_10019506 3300031903 Bacteria 3454
296 Ga0307407_10074648 3300031903 Bacteria 2030
297 Ga0307407_10250457 3300031903 Bacteria 1213
298 Ga0307407_10482242 3300031903 Bacteria 906
299 Ga0307412_10114109 3300031911 Bacteria 1934
300 Ga0307412_10221048 3300031911 Bacteria 1452
301 Ga0307412_11624557 3300031911 Bacteria 591
302 Ga0307409_100026319 3300031995 Bacteria 4100
303 Ga0307409_100039061 3300031995 Bacteria 3518
304 Ga0307409_100055378 3300031995 Bacteria 3061
305 Ga0307409_100151933 3300031995 Bacteria 2011
306 Ga0307409_100225383 3300031995 Bacteria 1695
307 Ga0307409_100386050 3300031995 Bacteria 1333
308 Ga0307409_100712438 3300031995 Bacteria 1004
309 Ga0307409_100874926 3300031995 Bacteria 911
310 Ga0307409_101047899 3300031995 Bacteria 835
311 Ga0307409_101083313 3300031995 Bacteria 822
312 Ga0307409_101305297 3300031995 Bacteria 751
313 Ga0307416_100021890 3300032002 Bacteria 4601
314 Ga0307416_100049979 3300032002 Bacteria 3329
315 Ga0307416_100148454 3300032002 Bacteria 2146
316 Ga0307416_100159354 3300032002 Bacteria 2083
317 Ga0307416_100169951 3300032002 Bacteria 2028
318 Ga0307416_100340083 3300032002 Bacteria 1513
319 Ga0307416_100371700 3300032002 Bacteria 1456
320 Ga0307416_100388506 3300032002 Bacteria 1428
321 Ga0307416_100549193 3300032002 Bacteria 1228
322 Ga0307416_100595837 3300032002 Bacteria 1184
323 Ga0307416_100636057 3300032002 Bacteria 1150
324 Ga0307414_10170899 3300032004 Bacteria 1738
325 Ga0307414_10457297 3300032004 Bacteria 1121
326 Ga0307414_10812655 3300032004 Bacteria 853
327 Ga0307414_11769829 3300032004 Bacteria 576
328 Ga0307411_10225712 3300032005 Bacteria 1456
329 Ga0307411_11531669 3300032005 Bacteria 613
330 Ga0307415_100004019 3300032126 Bacteria 7581
331 Ga0307415_100033919 3300032126 Bacteria 3317
332 Ga0307415_100301697 3300032126 Bacteria 1327
333 Ga0307415_100528521 3300032126 Bacteria 1037
334 Ga0307415_100647199 3300032126 Bacteria 947
335 Ga0307415_100779016 3300032126 Bacteria 871
336 Ga0307415_101455471 3300032126 Bacteria 654
337 Ga0395898_0525962 3300037466 Bacteria 1124
338 Ga0395898_0665592 3300037466 Bacteria 983
339 Ga0395901_0321781 3300038443 Bacteria 1600
340 Ga0395901_0874713 3300038443 Bacteria 882
341 Ga0395901_1318740 3300038443 Bacteria 683
342 Ga0395901_1627776 3300038443 Bacteria 598
343 Ga0436365_0177823 3300039437 Bacteria 553
344 Ga0436365_0279367 3300039437 Bacteria 729
345 Ga0436365_0383859 3300039437 Bacteria 7053
346 Ga0436365_0745294 3300039437 Bacteria 2595
347 Ga0436365_1254347 3300039437 Bacteria 1753
348 Ga0436365_1844483 3300039437 Bacteria 8288
349 Ga0436363_0570032 3300039450 Bacteria 1657
350 Ga0436363_1718526 3300039450 Bacteria 44980
351 Ga0436362_0274537 3300039453 Bacteria 2314
352 Ga0436362_0676443 3300039453 Bacteria 504
353 Ga0439465_0172579 3300041413 Bacteria 780
354 Ga0451833_1110297 3300041491 Bacteria 1204
355 Ga0451835_0319053 3300041492 Bacteria 599
356 Ga0451847_0738836 3300041503 Bacteria 585
357 Ga0439450_012551 3300042008 Bacteria 1683
358 Ga0439455_0051382 3300042012 Bacteria 1077
359 Ga0439463_025033 3300042016 Bacteria 1496
360 Ga0450915_013784 3300042119 Bacteria 595
361 Ga0439458_0094167 3300042157 Bacteria 773
362 Ga0439464_0241740 3300042439 Bacteria 582
363 Ga0439464_0248142 3300042439 Bacteria 575
364 Ga0439440_0120323 3300042993 Bacteria 730
365 Ga0466965_0363820 3300044683 Bacteria 794
366 Ga0466963_0001147 3300044694 Bacteria 13865
367 Ga0466963_0427223 3300044694 Bacteria 934
368 Ga0466963_0612616 3300044694 Bacteria 769
369 Ga0466963_1329553 3300044694 Bacteria 504
370 Ga0466971_0034011 3300044719 Bacteria 2284
371 Ga0466968_0104089 3300044735 Bacteria 1270
372 Ga0466970_0371181 3300044765 Bacteria 814
373 Ga0466957_0480800 3300044842 Bacteria 859
374 Ga0466960_0480470 3300044901 Bacteria 726
375 Ga0466959_0490238 3300045049 Bacteria 831
376 Ga0466958_0019807 3300045836 Bacteria 3918
377 Ga0466958_0107465 3300045836 Bacteria 1740
378 Ga0466958_0264717 3300045836 Bacteria 1101
379 Ga0466958_1155861 3300045836 Bacteria 505
380 Ga0466967_0012066 3300045976 Bacteria 6587
381 Ga0466967_0013351 3300045976 Bacteria 6342
382 Ga0466967_0053498 3300045976 Bacteria 3548
383 Ga0466967_0205190 3300045976 Bacteria 1868
384 Ga0466967_0248631 3300045976 Bacteria 1698
385 Ga0466967_0266445 3300045976 Bacteria 1640
386 Ga0466967_0494741 3300045976 Bacteria 1199
387 Ga0466967_2017849 3300045976 Bacteria 573
388 Ga0466967_2086598 3300045976 Bacteria 563
389 Ga0495641_0496142 3300046461 Bacteria 557
390 Ga0495651_0141382 3300046462 Bacteria 1745
391 Ga0495651_0469043 3300046462 Bacteria 811
392 Ga0495582_0164201 3300046473 Bacteria 1264
393 Ga0495605_0310618 3300046474 Bacteria 666
394 Ga0495584_0152099 3300046491 Bacteria 1176
395 Ga0495584_0180754 3300046491 Bacteria 1072
396 Ga0495585_0118270 3300046492 Bacteria 1404
397 Ga0495620_0001374 3300046515 Bacteria 14672
398 Ga0495620_0157940 3300046515 Bacteria 882
399 Ga0495628_0074652 3300046516 Bacteria 2641
400 Ga0495631_0325269 3300046518 Bacteria 654
401 Ga0495637_0098673 3300046520 Bacteria 1144
402 Ga0495643_0204623 3300046522 Bacteria 946
403 Ga0495587_0286699 3300046536 Bacteria 922
404 Ga0495667_0056173 3300046559 Bacteria 2589
405 Ga0495667_0209827 3300046559 Bacteria 1245
406 Ga0495656_0058940 3300046615 Bacteria 1668
407 Ga0495656_0328639 3300046615 Bacteria 789
408 Ga0495656_0348696 3300046615 Bacteria 767
409 Ga0495656_0488952 3300046615 Bacteria 652
410 Ga0495668_0068771 3300046616 Bacteria 1948
411 Ga0495668_0214407 3300046616 Bacteria 1054
412 Ga0495661_0189566 3300046665 Bacteria 1084
413 Ga0495669_0000076 3300046684 Bacteria 65203
414 Ga0495624_0783075 3300046690 Bacteria 564
415 Ga0495671_0284631 3300046692 Bacteria 796
416 Ga0495589_0056932 3300046794 Bacteria 1924
417 Ga0495660_0314351 3300046810 Bacteria 706
418 Ga0495602_0121153 3300048088 Bacteria 2104
419 Ga0495614_0201657 3300048089 Bacteria 900
420 Ga0496100_0000059 3300048903 Bacteria 65518
421 Ga0496101_0000135 3300048904 Bacteria 65518
422 Ga0496102_0242273 3300048905 Bacteria 1700
423 Ga0496102_0450990 3300048905 Bacteria 1207
424 Ga0496102_0679015 3300048905 Bacteria 953
425 Ga0496104_0000025 3300048907 Bacteria 228519
426 Ga0496104_0265089 3300048907 Bacteria 1630
427 Ga0496105_0000023 3300048908 Bacteria 156126
428 Ga0496106_0000252 3300048909 Bacteria 37666
429 Ga0496107_0000054 3300048910 Bacteria 60902
430 Ga0496107_0665854 3300048910 Bacteria 767
431 Ga0496108_0000006 3300048911 Bacteria 469473
432 Ga0496108_0002020 3300048911 Bacteria 16252
433 Ga0496108_0420061 3300048911 Bacteria 1168
434 Ga0496109_0000009 3300048912 Bacteria 236561
435 Ga0496109_0003300 3300048912 Bacteria 13472
436 Ga0496109_0065927 3300048912 Bacteria 3315
437 Ga0496109_0323859 3300048912 Bacteria 1455
438 Ga0496109_1550859 3300048912 Bacteria 597
439 Ga0496110_0196490 3300048913 Bacteria 1832
440 Ga0496110_1556706 3300048913 Bacteria 571
441 Ga0496111_0217546 3300048914 Bacteria 1419
442 Ga0496112_0085530 3300048915 Bacteria 3120
443 Ga0496115_0677403 3300048918 Bacteria 813
444 Ga0496121_0001035 3300048924 Bacteria 49640
445 Ga0496124_0327574 3300048927 Bacteria 1094
446 Ga0496125_0037611 3300048928 Bacteria 4205
447 Ga0496126_1313536 3300048929 Bacteria 526
448 Ga0501031_0032028 3300049568 Bacteria 3429
449 Ga0501031_0126504 3300049568 Bacteria 1669
450 Ga0501031_0333254 3300049568 Bacteria 982
451 Ga0501032_0344429 3300049569 Bacteria 960
452 Ga0501036_0054297 3300049572 Bacteria 3393
453 Ga0501037_0143274 3300049573 Bacteria 1710
454 Ga0501038_0167660 3300049574 Bacteria 1780
455 Ga0501038_0346158 3300049574 Bacteria 1158
456 Ga0501039_0055728 3300049575 Bacteria 3062
457 Ga0501040_0066176 3300049576 Bacteria 2490
458 Ga0501040_0084155 3300049576 Bacteria 2206
459 Ga0501040_0328323 3300049576 Bacteria 1094
460 Ga0501041_0172280 3300049577 Bacteria 1354
461 Ga0501041_0309677 3300049577 Bacteria 995
462 Ga0501042_0052804 3300049578 Bacteria 2899
463 Ga0501042_0170096 3300049578 Bacteria 1572
464 Ga0501042_0234554 3300049578 Bacteria 1324
465 Ga0501042_0658304 3300049578 Bacteria 761
466 Ga0501043_0250987 3300049579 Bacteria 1363
467 Ga0501046_0240203 3300049580 Bacteria 1336
468 Ga0501047_0110096 3300049581 Bacteria 2637
469 Ga0501048_1213222 3300049582 Bacteria 542
470 Ga0501068_0176733 3300049584 Bacteria 1349
471 Ga0501070_0024035 3300049586 Bacteria 5110
472 Ga0501071_0011609 3300049587 Bacteria 5946
473 Ga0501071_0022089 3300049587 Bacteria 4434
474 Ga0501071_0475471 3300049587 Bacteria 957
475 Ga0501072_0078657 3300049588 Bacteria 2611
476 Ga0501072_0249591 3300049588 Bacteria 1413
477 Ga0501074_0230652 3300049590 Bacteria 1318
478 Ga0501075_0042115 3300049591 Bacteria 3423
479 Ga0501075_0075404 3300049591 Bacteria 2550
480 Ga0501076_0054154 3300049592 Bacteria 3179
481 Ga0501076_0659492 3300049592 Bacteria 863
482 Ga0501077_0132747 3300049593 Bacteria 1579
483 Ga0501077_0417817 3300049593 Bacteria 858
484 Ga0501079_0070655 3300049741 Bacteria 2696
485 Ga0501079_0111644 3300049741 Bacteria 2124
486 Ga0501079_0213425 3300049741 Bacteria 1508
487 Ga0501080_0067922 3300049742 Bacteria 3316
488 Ga0501081_0077696 3300049743 Bacteria 2320
489 Ga0501081_0437629 3300049743 Bacteria 970
490 Ga0501035_0407724 3300049822 Bacteria 1130
491 Ga0501035_0433866 3300049822 Bacteria 1089
492 Ga0501044_0106167 3300049823 Bacteria 2821
493 Ga0501045_0081807 3300049824 Bacteria 2381
494 Ga0501045_0446525 3300049824 Bacteria 961
495 nmdc:mga0yw44_542632_c1 3300050492 Bacteria 789
496 nmdc:mga0yw44_74648_c1 3300050492 Bacteria 2112
497 nmdc:mga05p37_2190575_c1 3300050507 Bacteria 514
498 nmdc:mga05p37_300051_c1 3300050507 Bacteria 1909
499 nmdc:mga09592_157065_c1 3300050508 Bacteria 1963
500 nmdc:mga0qj67_1096327_c1 3300050509 Bacteria 622
501 nmdc:mga0qj67_24455_c1 3300050509 Bacteria 4656
502 nmdc:mga06r32_1368850_c1 3300050510 Bacteria 650
503 nmdc:mga06r32_304407_c1 3300050510 Bacteria 1580
504 nmdc:mga06r32_504190_c1 3300050510 Bacteria 1187
505 nmdc:mga06r32_641572_c1 3300050510 Bacteria 1031
506 nmdc:mga08y16_163260_c1 3300050511 Bacteria 2314
507 nmdc:mga08y16_51532_c1 3300050511 Bacteria 4306
508 nmdc:mga08y16_581978_c1 3300050511 Bacteria 1130
509 nmdc:mga08y16_670128_c1 3300050511 Bacteria 1040
510 nmdc:mga08y16_772465_c1 3300050511 Bacteria 955
511 nmdc:mga08y16_930540_c1 3300050511 Bacteria 853
512 Ga0495655_0099135 3300053083 Bacteria 860
513 Ga0495655_0213443 3300053083 Bacteria 636
514 Ga0495655_0221398 3300053083 Bacteria 626
515 Ga0495619_0000008 3300053085 Bacteria 305999
516 Ga0495619_0349749 3300053085 Bacteria 1022
517 Ga0501084_0033079 3300054114 Bacteria 4325
518 Ga0501084_0072126 3300054114 Bacteria 2892
519 Ga0590071_141892 3300059421 Bacteria 620
520 Ga0590075_127831 3300059424 Bacteria 667
521 Ga0501082_0127181 3300060353 Bacteria 2210
522 Ga0501082_1072840 3300060353 Bacteria 704
523 Ga0466962_0035374 3300061719 Bacteria 2391
524 Ga0530510_0031356 3300061734 Bacteria 3822
525 Ga0530510_0034079 3300061734 Bacteria 3667
526 Ga0530510_0944621 3300061734 Bacteria 659
527 Ga0070699_100607989
528 LJNas_1024603
529 LJQas_1016207
530 JGI24740J21852_10001762
531 JGI24748J21848_1000694
532 JGI24034J26672_10000749
533 JGI24742J22300_10004291
534 JGI25406J46586_10099385
535 JGI25407J50210_10120278
536 JGI25404J52841_10065721
537 Ga0070658_10422908
538 Ga0070683_100255296
539 Ga0070683_100287018
540 Ga0070683_100699711
541 Ga0070670_100038633
542 Ga0070677_10000015
543 Ga0068869_100959494
544 Ga0070682_100660090
545 Ga0070682_100762981
546 Ga0070682_101571622
547 Ga0068868_100185756
548 Ga0068868_100566757
549 Ga0068868_100770555
550 Ga0070660_100008820
551 Ga0070660_100039159
552 Ga0070691_10000524
553 Ga0070691_10568945
554 Ga0070687_100278598
555 Ga0070692_10635090
556 Ga0070668_100256907
557 Ga0070674_100053021
558 Ga0070674_100240715
559 Ga0070659_100000052
560 Ga0070659_100260493
561 Ga0070659_100711510
562 Ga0070714_100000104
563 Ga0070714_100001703
564 Ga0070714_100531609
565 Ga0070711_100134559
566 Ga0070711_100439638
567 Ga0070700_100028933
568 Ga0070700_100149178
569 Ga0070678_101814800
570 Ga0070662_100028548
571 Ga0070662_101164826
572 Ga0068867_100064145
573 Ga0068867_100224648
574 Ga0068867_100510637
575 Ga0068867_101109363
576 Ga0068867_101202971
577 Ga0070684_100401390
578 Ga0070684_100732213
579 Ga0070684_101012576
580 Ga0070684_101350416
581 Ga0068853_100339320
582 Ga0070672_100275834
583 Ga0070672_100309908
584 Ga0070704_100193431
585 Ga0070704_100784028
586 Ga0070664_100234828
587 Ga0068854_100009180
588 Ga0068854_101610221
589 Ga0070702_100003220
590 Ga0070702_100281763
591 Ga0068852_100051736
592 Ga0068852_100294891
593 Ga0068859_100186183
594 Ga0068859_101360369
595 Ga0068864_100058727
596 Ga0068866_10063601
597 Ga0068870_10083845
598 Ga0068870_10337507
599 Ga0068863_100000022
600 Ga0068858_100000508
601 Ga0068858_100211753
602 Ga0068860_100331943
603 Ga0068862_101873139
604 Ga0081455_10031993
605 Ga0081455_10446067
606 Ga0081538_10000959
607 Ga0081538_10002012
608 Ga0081538_10005011
609 Ga0081538_10007761
610 Ga0081538_10009976
611 Ga0081538_10013689
612 Ga0081538_10014732
613 Ga0081538_10014783
614 Ga0081538_10017157
615 Ga0081538_10024724
616 Ga0081538_10035091
617 Ga0081538_10040946
618 Ga0081538_10157729
619 Ga0081538_10315119
620 Ga0081540_1000366
621 Ga0081539_10000740
622 Ga0081539_10003483
623 Ga0081539_10049937
624 Ga0070717_10004120
625 Ga0075365_10029192
626 Ga0070716_100745687
627 Ga0070716_100768919
628 Ga0075428_100054546
629 Ga0075428_100314276
630 Ga0075428_100659393
631 Ga0075430_100001083
632 Ga0075430_100006480
633 Ga0075430_101194360
634 Ga0075431_100062557
635 Ga0075431_100342188
636 Ga0075433_11447666
637 Ga0075429_100020083
638 Ga0075436_100695870
639 Ga0097620_100186183
640 Ga0097620_101359868
641 Ga0111539_10189289
642 Ga0111539_10275902
643 Ga0111539_10930991
644 Ga0111539_11110033
645 Ga0111539_12901100
646 Ga0105245_10000517
647 Ga0105245_10037305
648 Ga0105245_10122731
649 Ga0105245_10220453
650 Ga0105245_10367037
651 Ga0105245_10483406
652 Ga0105245_10651654
653 Ga0105245_10719596
654 Ga0105245_10796343
655 Ga0114129_10017597
656 Ga0114129_10043867
657 Ga0114129_10334531
658 Ga0114129_10473393
659 Ga0114129_11207614
660 Ga0105243_10043619
661 Ga0105243_10055826
662 Ga0105243_10213852
663 Ga0105243_10239962
664 Ga0105243_10969217
665 Ga0105243_11691210
666 Ga0105243_11912234
667 Ga0105242_12431432
668 Ga0105242_12439787
669 Ga0105237_10431828
670 Ga0105237_10825131
671 Ga0105238_10000009
672 Ga0105238_11315402
673 Ga0105249_10000178
674 Ga0105249_11273899
675 Ga0105246_10213212
676 Ga0105246_10714284
677 Ga0105246_11112849
678 Ga0105246_11439615
679 Ga0157371_10959655
680 Ga0157370_10022403
681 Ga0157374_11041094
682 Ga0157374_11768352
683 Ga0157378_10676562
684 Ga0157378_10945238
685 Ga0163162_10334726
686 Ga0157372_10076429
687 Ga0157372_10266133
688 Ga0157375_10003797
689 Ga0157375_11215685
690 Ga0157375_11376920
691 Ga0157375_11524431
692 Ga0163163_10694857
693 Ga0163163_11288963
694 Ga0163163_11311478
695 Ga0163163_11463095
696 Ga0163163_11506385
697 Ga0157380_10888481
698 Ga0157380_10905077
699 Ga0157380_11076502
700 Ga0157377_10020429
701 Ga0157379_10016865
702 Ga0157379_10680054
703 Ga0157379_10854884
704 Ga0157379_10940333
705 Ga0163161_10220804
706 Ga0163161_10626818
707 Ga0213874_10000096
708 Ga0213876_10003839
709 Ga0213876_10092363
710 Ga0213875_10009779
711 Ga0213875_10010323
712 Ga0213875_10376792
713 Ga0207682_10000155
714 Ga0207699_10686656
715 Ga0207643_10106165
716 Ga0207643_10217926
717 Ga0207643_10384547
718 Ga0207705_10382305
719 Ga0207705_10491843
720 Ga0207663_10141106
721 Ga0207663_11019750
722 Ga0207662_10128945
723 Ga0207657_10017147
724 Ga0207657_10183448
725 Ga0207681_10002638
726 Ga0207681_10380846
727 Ga0207694_10000004
728 Ga0207650_11153157
729 Ga0207687_10000085
730 Ga0207687_10027361
731 Ga0207687_10385368
732 Ga0207687_10497334
733 Ga0207687_10544740
734 Ga0207687_10820999
735 Ga0207687_11136410
736 Ga0207687_11432382
737 Ga0207664_10000004
738 Ga0207664_10001474
739 Ga0207664_10012057
740 Ga0207690_10000061
741 Ga0207690_10051120
742 Ga0207690_10402018
743 Ga0207690_10584702
744 Ga0207706_10034595
745 Ga0207706_11084921
746 Ga0207686_10159727
747 Ga0207686_10405785
748 Ga0207686_10746906
749 Ga0207709_10313824
750 Ga0207709_10658145
751 Ga0207709_11263065
752 Ga0207669_10092478
753 Ga0207669_10177309
754 Ga0207704_10186120
755 Ga0207665_10117591
756 Ga0207691_10231805
757 Ga0207689_10381276
758 Ga0207689_10832002
759 Ga0207661_10804347
760 Ga0207661_10982343
761 Ga0207651_11521575
762 Ga0207712_10000118
763 Ga0207712_10143984
764 Ga0207712_10194342
765 Ga0207668_10021220
766 Ga0207668_10039801
767 Ga0207640_10020738
768 Ga0207640_11808511
769 Ga0207677_10320950
770 Ga0207677_10532372
771 Ga0207677_10801412
772 Ga0207703_10000385
773 Ga0207678_10186883
774 Ga0207678_10261428
775 Ga0207708_10014080
776 Ga0207708_10096629
777 Ga0207708_10162393
778 Ga0207648_10066173
779 Ga0207648_10068447
780 Ga0207648_10123755
781 Ga0207676_10655224
782 Ga0207674_10245620
783 Ga0207675_100016103
784 Ga0207675_100095082
785 Ga0207675_100477347
786 Ga0207698_10128403
787 Ga0207698_10183891
788 Ga0207428_10029672
789 Ga0207428_10105420
790 Ga0207428_10208198
791 Ga0268266_10022301
792 Ga0265326_10000055
793 Ga0265319_1000069
794 Ga0265319_1000668
795 Ga0265319_1002434
796 Ga0265334_10000002
797 Ga0265322_10043695
798 Ga0265336_10001387
799 Ga0265338_10002429
800 Ga0265320_10014055
801 Ga0265320_10028555
802 Ga0265320_10037020
803 Ga0265340_10259798
804 Ga0265316_10651111
805 Ga0307408_100070752
806 Ga0307408_100251143
807 Ga0265313_10188244
808 Ga0307405_10063005
809 Ga0307405_10197655
810 Ga0307405_10460975
811 Ga0307405_10970165
812 Ga0307413_10063187
813 Ga0307413_10517771
814 Ga0307410_10027760
815 Ga0307410_10211564
816 Ga0307410_10353418
817 Ga0307406_10024474
818 Ga0307406_10114637
819 Ga0307406_11582809
820 Ga0307407_10017463
821 Ga0307407_10019506
822 Ga0307407_10074648
823 Ga0307407_10250457
824 Ga0307407_10482242
825 Ga0307412_10114109
826 Ga0307412_10221048
827 Ga0307412_11624557
828 Ga0307409_100026319
829 Ga0307409_100039061
830 Ga0307409_100055378
831 Ga0307409_100151933
832 Ga0307409_100225383
833 Ga0307409_100386050
834 Ga0307409_100712438
835 Ga0307409_100874926
836 Ga0307409_101047899
837 Ga0307409_101083313
838 Ga0307409_101305297
839 Ga0307416_100021890
840 Ga0307416_100049979
841 Ga0307416_100148454
842 Ga0307416_100159354
843 Ga0307416_100169951
844 Ga0307416_100340083
845 Ga0307416_100371700
846 Ga0307416_100388506
847 Ga0307416_100549193
848 Ga0307416_100595837
849 Ga0307416_100636057
850 Ga0307414_10170899
851 Ga0307414_10457297
852 Ga0307414_10812655
853 Ga0307414_11769829
854 Ga0307411_10225712
855 Ga0307411_11531669
856 Ga0307415_100004019
857 Ga0307415_100033919
858 Ga0307415_100301697
859 Ga0307415_100528521
860 Ga0307415_100647199
861 Ga0307415_100779016
862 Ga0307415_101455471
863 Ga0395898_0525962
864 Ga0395898_0665592
865 Ga0395901_0321781
866 Ga0395901_0874713
867 Ga0395901_1318740
868 Ga0395901_1627776
869 Ga0436365_0177823
870 Ga0436365_0279367
871 Ga0436365_0383859
872 Ga0436365_0745294
873 Ga0436365_1254347
874 Ga0436365_1844483
875 Ga0436363_0570032
876 Ga0436363_1718526
877 Ga0436362_0274537
878 Ga0436362_0676443
879 Ga0439465_0172579
880 Ga0451833_1110297
881 Ga0451835_0319053
882 Ga0451847_0738836
883 Ga0439450_012551
884 Ga0439455_0051382
885 Ga0439463_025033
886 Ga0450915_013784
887 Ga0439458_0094167
888 Ga0439464_0241740
889 Ga0439464_0248142
890 Ga0439440_0120323
891 Ga0466965_0363820
892 Ga0466963_0001147
893 Ga0466963_0427223
894 Ga0466963_0612616
895 Ga0466963_1329553
896 Ga0466971_0034011
897 Ga0466968_0104089
898 Ga0466970_0371181
899 Ga0466957_0480800
900 Ga0466960_0480470
901 Ga0466959_0490238
902 Ga0466958_0019807
903 Ga0466958_0107465
904 Ga0466958_0264717
905 Ga0466958_1155861
906 Ga0466967_0012066
907 Ga0466967_0013351
908 Ga0466967_0053498
909 Ga0466967_0205190
910 Ga0466967_0248631
911 Ga0466967_0266445
912 Ga0466967_0494741
913 Ga0466967_2017849
914 Ga0466967_2086598
915 Ga0495641_0496142
916 Ga0495651_0141382
917 Ga0495651_0469043
918 Ga0495582_0164201
919 Ga0495605_0310618
920 Ga0495584_0152099
921 Ga0495584_0180754
922 Ga0495585_0118270
923 Ga0495620_0001374
924 Ga0495620_0157940
925 Ga0495628_0074652
926 Ga0495631_0325269
927 Ga0495637_0098673
928 Ga0495643_0204623
929 Ga0495587_0286699
930 Ga0495667_0056173
931 Ga0495667_0209827
932 Ga0495656_0058940
933 Ga0495656_0328639
934 Ga0495656_0348696
935 Ga0495656_0488952
936 Ga0495668_0068771
937 Ga0495668_0214407
938 Ga0495661_0189566
939 Ga0495669_0000076
940 Ga0495624_0783075
941 Ga0495671_0284631
942 Ga0495589_0056932
943 Ga0495660_0314351
944 Ga0495602_0121153
945 Ga0495614_0201657
946 Ga0496100_0000059
947 Ga0496101_0000135
948 Ga0496102_0242273
949 Ga0496102_0450990
950 Ga0496102_0679015
951 Ga0496104_0000025
952 Ga0496104_0265089
953 Ga0496105_0000023
954 Ga0496106_0000252
955 Ga0496107_0000054
956 Ga0496107_0665854
957 Ga0496108_0000006
958 Ga0496108_0002020
959 Ga0496108_0420061
960 Ga0496109_0000009
961 Ga0496109_0003300
962 Ga0496109_0065927
963 Ga0496109_0323859
964 Ga0496109_1550859
965 Ga0496110_0196490
966 Ga0496110_1556706
967 Ga0496111_0217546
968 Ga0496112_0085530
969 Ga0496115_0677403
970 Ga0496121_0001035
971 Ga0496124_0327574
972 Ga0496125_0037611
973 Ga0496126_1313536
974 Ga0501031_0032028
975 Ga0501031_0126504
976 Ga0501031_0333254
977 Ga0501032_0344429
978 Ga0501036_0054297
979 Ga0501037_0143274
980 Ga0501038_0167660
981 Ga0501038_0346158
982 Ga0501039_0055728
983 Ga0501040_0066176
984 Ga0501040_0084155
985 Ga0501040_0328323
986 Ga0501041_0172280
987 Ga0501041_0309677
988 Ga0501042_0052804
989 Ga0501042_0170096
990 Ga0501042_0234554
991 Ga0501042_0658304
992 Ga0501043_0250987
993 Ga0501046_0240203
994 Ga0501047_0110096
995 Ga0501048_1213222
996 Ga0501068_0176733
997 Ga0501070_0024035
998 Ga0501071_0011609
999 Ga0501071_0022089
1000 Ga0501071_0475471
1001 Ga0501072_0078657
1002 Ga0501072_0249591
1003 Ga0501074_0230652
1004 Ga0501075_0042115
1005 Ga0501075_0075404
1006 Ga0501076_0054154
1007 Ga0501076_0659492
1008 Ga0501077_0132747
1009 Ga0501077_0417817
1010 Ga0501079_0070655
1011 Ga0501079_0111644
1012 Ga0501079_0213425
1013 Ga0501080_0067922
1014 Ga0501081_0077696
1015 Ga0501081_0437629
1016 Ga0501035_0407724
1017 Ga0501035_0433866
1018 Ga0501044_0106167
1019 Ga0501045_0081807
1020 Ga0501045_0446525
1021 nmdc:mga0yw44_542632_c1
1022 nmdc:mga0yw44_74648_c1
1023 nmdc:mga05p37_2190575_c1
1024 nmdc:mga05p37_300051_c1
1025 nmdc:mga09592_157065_c1
1026 nmdc:mga0qj67_1096327_c1
1027 nmdc:mga0qj67_24455_c1
1028 nmdc:mga06r32_1368850_c1
1029 nmdc:mga06r32_304407_c1
1030 nmdc:mga06r32_504190_c1
1031 nmdc:mga06r32_641572_c1
1032 nmdc:mga08y16_163260_c1
1033 nmdc:mga08y16_51532_c1
1034 nmdc:mga08y16_581978_c1
1035 nmdc:mga08y16_670128_c1
1036 nmdc:mga08y16_772465_c1
1037 nmdc:mga08y16_930540_c1
1038 Ga0495655_0099135
1039 Ga0495655_0213443
1040 Ga0495655_0221398
1041 Ga0495619_0000008
1042 Ga0495619_0349749
1043 Ga0501084_0033079
1044 Ga0501084_0072126
1045 Ga0590071_141892
1046 Ga0590075_127831
1047 Ga0501082_0127181
1048 Ga0501082_1072840
1049 Ga0466962_0035374
1050 Ga0530510_0031356
1051 Ga0530510_0034079
1052 Ga0530510_0944621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pky-assembly1.cif.gz_B structure of chloroflexus aggregans flavin based fluorescent protein (cagfbfp) q148v variant 0.8409 37 136
6ywi-assembly1.cif.gz_B structure of chloroflexus aggregans flavin based fluorescent protein (cagfbfp) q148e variant 0.8408 37 136
7ab6-assembly1.cif.gz_B structure of chloroflexus aggregans flavin based fluorescent protein (cagfbfp) i52t variant 0.8396 37 136
8pm1-assembly1.cif.gz_B structure of chloroflexus aggregans flavin based fluorescent protein (cagfbfp) variant i52v a85q 0.8393 37 136
6y7u-assembly1.cif.gz_B structure of chloroflexus aggregans cagg_3753 lov domain c85a a95p variant (cagfbfp) 0.8391 37 136
ID Description Score Start End Superfamily
6rhfA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8339 37 137 3.30.450.20
af_A0A0R0KYL2_36_218_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8204 39 137 3.30.450.20
af_I1J5K5_18_142_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8135 36 137 3.30.450.20
4r3aA01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8125 36 138 3.30.450.20
af_Q5VRX2_253_363_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.812 39 138 3.30.450.20
ID Description Score Start End GO Terms
AF-A0A3M1WZQ3-F1-model_v4 PAS domain-containing protein 0.8948 34 134 GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A2N6BUK8-F1-model_v4 PAS domain-containing protein 0.8887 36 137 GO:0005524
GO:0006355
GO:0016887
GO:0035438
GO:0043565
AF-A0A831QHX5-F1-model_v4 PAS domain S-box protein 0.8848 34 137
AF-A0A7Y8LWN0-F1-model_v4 Sigma 54-interacting transcriptional regulator 0.8837 34 134 GO:0005524
GO:0006355
AF-A0A0M3QGM7-F1-model_v4 PAS modulated sigma54 specific transcriptional regulator, Fis family 0.8815 36 134 GO:0005524
GO:0006355
GO:0016887
GO:0043565

Map