F459348

General Info

Members Datasets Scaffolds Average Seq Length
525 366 387 405

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2545555800|2545557550
Length 466
Sequence YFVSGKRKKILRLAEVCTQTAGKFCGKRKNAGETSRFFGLARNLLYKKGKQDLMLNDYKTRGNQIMSAFTKSQEIISQTSHYGANNYHPLPIVISEAQGVWVKDPEGNQYMDMLSAYSAVNQGHRHPKIIQALKDQADKITLTSRAFHNDQLGPFYEKTAKLTGKDMILPMNTGAEAVESAVKAARRWAYEVKGVADNQAEIIACIGNFHGRTMLAVSLSSEDEYKRGFGPMLPGIKLIPYGDAEALRRAITPNTAAFLFEPIQGEAGIVIPPEGFLQEAAAICKEENVLLIADEIQTGLGRTGKTFAVDWENIVPDMFILGKALGGGVFPISCIAANRDILGVFNPGSHGSTFGGNPLACAVSLASLEVLEEEGLAERSLQLGRYFKEELEKIDNPIIKDVRGRGLFIGVELTEAARPYCEKLKGEGLLCKETHDTVIRFAPPLMISKEDLDWAIQKITNVLQNA

Samples

Sample ID Description Type Environment
1 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
2 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
3 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
4 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
5 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
6 2554235283 Bacillus safensis VK Isolate Rhizosphere
7 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
8 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
9 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
10 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
11 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
12 2643221549 Agromyces sp. Root1464 Isolate Unclassified
13 2643221561 Nocardioides sp. Root151 Isolate Unclassified
14 2643221566 Microbacterium sp. Root166 Isolate Unclassified
15 2643221696 Nocardioides sp. Root140 Isolate Unclassified
16 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
17 2643221729 Bacillus sp. Root11 Isolate Unclassified
18 2643221730 Bacillus sp. Root131 Isolate Unclassified
19 2643221735 Bacillus sp. Root920 Isolate Unclassified
20 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
21 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
22 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
23 2684622632 Bacillus cereus 905 Isolate Unclassified
24 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
25 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
26 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
27 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
28 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
29 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
30 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
31 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
32 2738541358 Bacillus sp. OV752 Isolate Unclassified
33 2738543006 Bacillus sp. OK077 Isolate Unclassified
34 2738543010 Bacillus sp. YR335 Isolate Unclassified
35 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
36 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
37 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
38 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
39 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
40 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
41 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
42 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
43 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
44 2808606372 Agromyces sp. 23-23 Isolate Unclassified
45 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
46 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
47 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
48 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
49 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
50 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
51 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
52 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
53 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
54 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
55 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
56 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
57 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
58 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
59 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
60 2842682962 Bacillus sp. R-72492 Isolate Unclassified
61 2849139964 Bacillus sp. R-71875 Isolate Unclassified
62 2857472729 Cohnella sp. R-74144 Isolate Unclassified
63 2857581216 Bacillus sp. R-71922 Isolate Unclassified
64 2857586860 Bacillus sp. R-71935 Isolate Unclassified
65 2860837431 Bacillus sp. WR11 Isolate Unclassified
66 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
67 2867428634 Streptomyces sp. RP5T Isolate Unclassified
68 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
69 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
70 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
71 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
72 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
73 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
74 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
75 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
76 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
77 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
78 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
79 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
80 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
81 2919069694 Microbacterium sp. 1154 Isolate Unclassified
82 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
83 2919395869 Microbacterium resistens 2980 Isolate Unclassified
84 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
85 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
86 2919726948 Bacillus pumilus 4489 Isolate Unclassified
87 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
88 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
89 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
90 2938917290 Bacillus sp. CR71 Isolate Unclassified
91 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
92 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
93 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
94 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
95 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
96 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
97 2965761152 Bacillus sp. COPE52 Isolate Unclassified
98 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
99 2969141011 Bacillus velezensis MH25 Isolate Unclassified
100 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
101 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
102 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
103 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
104 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
105 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
106 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
107 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
108 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
109 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
110 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
111 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
112 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
113 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
114 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
115 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
116 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
117 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
118 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
119 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
120 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
121 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
122 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
123 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
124 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
125 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
126 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
127 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
128 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
129 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
130 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
131 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
132 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
133 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
134 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
135 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
136 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
137 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
138 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
139 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
140 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
141 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
142 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
143 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
144 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
145 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
146 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
147 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
148 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
149 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
150 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
151 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
152 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
153 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
154 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
155 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
156 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
157 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
158 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
159 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
160 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
161 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
162 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
163 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
164 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
165 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
166 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
167 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
168 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
169 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
170 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
171 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
172 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
173 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
174 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
175 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
176 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
177 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
178 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
179 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
180 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
181 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
182 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
185 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
218 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
219 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
220 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
231 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
234 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
241 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
244 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
245 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
248 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
249 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
250 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
254 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
255 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
258 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
259 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
269 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
297 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
298 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
299 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
300 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
323 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
324 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
325 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
326 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
330 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
331 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
334 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
337 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
338 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
339 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
340 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
341 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
342 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
343 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
344 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
345 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
346 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
347 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
348 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
349 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
350 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
351 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
352 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
353 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
354 8022653035 Bacillus sp. Rc4 Isolate Unclassified
355 8022792930 Bacillus sp. Xin Isolate Rhizosphere
356 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
357 8023438354 Bacillus sp. BH2 Isolate Unclassified
358 8023444577 Bacillus sp. BH32 Isolate Unclassified
359 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
360 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
361 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
362 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
363 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
364 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
365 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
366 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.33
Metatranscriptomes 0.38
Isolates 26.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 12.57
Nodule 0.38
Rhizoplane 7.24
Rhizosphere 54.29
Stem 0
Stem Tuber 0
Unclassified 24.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1007547 3300002987 Bacteria 3104
2 JGI25151J46595_10000011 3300003187 Bacteria 264206
3 JGI25151J46595_10004537 3300003187 Bacteria 7326
4 JGI25151J46595_10006351 3300003187 Bacteria 5952
5 JGI25151J46595_10014009 3300003187 Bacteria 3590
6 JGI25151J46595_10016140 3300003187 Bacteria 3272
7 JGI25151J46595_10017178 3300003187 Bacteria 3146
8 Ga0006562J51391_1000095 3300003578 Bacteria 15431
9 Ga0006562J51391_1071400 3300003578 Bacteria 17010
10 Ga0055532_1000024 3300003758 Bacteria 244166
11 Ga0065704_10089489 3300005289 Bacteria 2854
12 Ga0065707_10128256 3300005295 Bacteria 1968
13 Ga0070658_10011701 3300005327 Bacteria 7038
14 Ga0070683_100000938 3300005329 Bacteria 21679
15 Ga0070683_100366606 3300005329 Bacteria 1372
16 Ga0070670_100190230 3300005331 Bacteria 1783
17 Ga0070682_100004788 3300005337 Bacteria 7520
18 Ga0070669_100000944 3300005353 Bacteria 21209
19 Ga0070671_100002004 3300005355 Bacteria 15647
20 Ga0070667_100000182 3300005367 Bacteria 75588
21 Ga0070667_100002503 3300005367 Bacteria 16033
22 Ga0070710_10000261 3300005437 Bacteria 25090
23 Ga0070663_100069351 3300005455 Bacteria 2561
24 Ga0070678_100147305 3300005456 Bacteria 1892
25 Ga0070662_100005256 3300005457 Bacteria 8261
26 Ga0070681_10130384 3300005458 Bacteria 2446
27 Ga0068867_100046951 3300005459 Bacteria 3173
28 Ga0070679_100044651 3300005530 Bacteria 4415
29 Ga0070684_100050198 3300005535 Bacteria 3623
30 Ga0070665_100008095 3300005548 Bacteria 10641
31 Ga0070665_100179842 3300005548 Bacteria 2116
32 Ga0068855_100060699 3300005563 Bacteria 4421
33 Ga0068857_100243089 3300005577 Bacteria 1648
34 Ga0068859_100008871 3300005617 Bacteria 10152
35 Ga0068864_100017142 3300005618 Bacteria 6040
36 Ga0068864_100055669 3300005618 Bacteria 3416
37 Ga0068863_100012289 3300005841 Bacteria 8265
38 Ga0068863_100014842 3300005841 Bacteria 7486
39 Ga0068863_100120243 3300005841 Bacteria 2504
40 Ga0068863_100359281 3300005841 Bacteria 1420
41 Ga0068858_100039330 3300005842 Bacteria 4386
42 Ga0068860_100000374 3300005843 Bacteria 58635
43 Ga0068862_100000276 3300005844 Bacteria 57404
44 Ga0068862_100090833 3300005844 Bacteria 2659
45 Ga0081455_10017303 3300005937 Bacteria 6918
46 Ga0075365_10033973 3300006038 Bacteria 3291
47 Ga0075363_100001303 3300006048 Bacteria 9309
48 Ga0075363_100028896 3300006048 Bacteria 2857
49 Ga0075363_100046547 3300006048 Bacteria 2302
50 Ga0075364_10011450 3300006051 Bacteria 5389
51 Ga0075364_10023675 3300006051 Bacteria 3890
52 Ga0075364_10027707 3300006051 Bacteria 3621
53 Ga0075364_10031848 3300006051 Bacteria 3387
54 Ga0075367_10003453 3300006178 Bacteria 7539
55 Ga0075369_10020487 3300006186 Bacteria 2708
56 Ga0075369_10021759 3300006186 Bacteria 2639
57 Ga0075370_10002037 3300006353 Bacteria 9171
58 Ga0075370_10003960 3300006353 Bacteria 7116
59 Ga0075370_10004873 3300006353 Bacteria 6584
60 Ga0075428_100001829 3300006844 Bacteria 22768
61 Ga0075428_100025039 3300006844 Bacteria 6602
62 Ga0075430_100001544 3300006846 Bacteria 18810
63 Ga0075430_100055026 3300006846 Bacteria 3347
64 Ga0075431_100033580 3300006847 Bacteria 5288
65 Ga0097620_100008871 3300006931 Bacteria 10152
66 Ga0105244_10000719 3300009036 Bacteria 28584
67 Ga0105244_10020287 3300009036 Bacteria 3695
68 Ga0105250_10005754 3300009092 Bacteria 5518
69 Ga0105250_10027675 3300009092 Bacteria 2285
70 Ga0111539_10137635 3300009094 Bacteria 2859
71 Ga0105245_10036363 3300009098 Bacteria 4374
72 Ga0105247_10000181 3300009101 Bacteria 61066
73 Ga0105243_10165400 3300009148 Bacteria 1911
74 Ga0105243_10235964 3300009148 Bacteria 1625
75 Ga0105248_10000652 3300009177 Bacteria 39387
76 Ga0105248_10004546 3300009177 Bacteria 15355
77 Ga0105237_10003090 3300009545 Bacteria 20059
78 Ga0105237_10057184 3300009545 Bacteria 3904
79 Ga0105249_10000022 3300009553 Bacteria 258377
80 Ga0105239_10001222 3300010375 Bacteria 35019
81 Ga0105239_10030709 3300010375 Bacteria 5909
82 Ga0105246_10012025 3300011119 Bacteria 5392
83 Ga0157369_10271441 3300013105 Bacteria 1767
84 Ga0163162_10035949 3300013306 Bacteria 4935
85 Ga0163162_10060900 3300013306 Bacteria 3811
86 Ga0157372_10012226 3300013307 Bacteria 9140
87 Ga0157372_10104317 3300013307 Bacteria 3240
88 Ga0157375_10077481 3300013308 Bacteria 3354
89 Ga0157375_10103532 3300013308 Bacteria 2934
90 Ga0157375_10259032 3300013308 Bacteria 1901
91 Ga0157375_10354984 3300013308 Bacteria 1632
92 Ga0163163_10072568 3300014325 Bacteria 3432
93 Ga0163163_10098763 3300014325 Bacteria 2941
94 Ga0163163_10176172 3300014325 Bacteria 2185
95 Ga0157380_10006402 3300014326 Bacteria 8289
96 Ga0213876_10021932 3300021384 Bacteria 3378
97 Ga0209784_100061 3300025224 Bacteria 164590
98 Ga0209147_100020 3300025229 Bacteria 474055
99 Ga0209130_1000311 3300025284 Bacteria 57319
100 Ga0209130_1006242 3300025284 Bacteria 3915
101 Ga0209130_1006505 3300025284 Bacteria 3781
102 Ga0209675_1012279 3300025291 Bacteria 2772
103 Ga0209676_1000274 3300025292 Bacteria 107505
104 Ga0209676_1000808 3300025292 Bacteria 40975
105 Ga0209025_1000011 3300025294 Bacteria 976387
106 Ga0209025_1000043 3300025294 Bacteria 350458
107 Ga0209025_1000209 3300025294 Bacteria 140401
108 Ga0209025_1000851 3300025294 Bacteria 48307
109 Ga0209025_1001029 3300025294 Bacteria 40908
110 Ga0209025_1002458 3300025294 Bacteria 19577
111 Ga0209025_1003417 3300025294 Bacteria 15063
112 Ga0209025_1006279 3300025294 Bacteria 9295
113 Ga0209025_1006597 3300025294 Bacteria 8945
114 Ga0209025_1016765 3300025294 Bacteria 4288
115 Ga0209025_1024252 3300025294 Bacteria 3137
116 Ga0209025_1028312 3300025294 Bacteria 2750
117 Ga0207696_1005618 3300025711 Bacteria 5175
118 Ga0207696_1021684 3300025711 Bacteria 2054
119 Ga0207655_1000184 3300025728 Bacteria 111832
120 Ga0207655_1002232 3300025728 Bacteria 16043
121 Ga0207710_10000091 3300025900 Bacteria 121330
122 Ga0207705_10022680 3300025909 Bacteria 4478
123 Ga0207707_10067445 3300025912 Bacteria 3117
124 Ga0207671_10055321 3300025914 Bacteria 2940
125 Ga0207657_10209240 3300025919 Bacteria 1566
126 Ga0207652_10013343 3300025921 Bacteria 6653
127 Ga0207652_10065539 3300025921 Bacteria 3146
128 Ga0207681_10001711 3300025923 Bacteria 14112
129 Ga0207650_10163320 3300025925 Bacteria 1766
130 Ga0207644_10005495 3300025931 Bacteria 8254
131 Ga0207691_10176525 3300025940 Bacteria 1868
132 Ga0207711_10000713 3300025941 Bacteria 32689
133 Ga0207661_10003990 3300025944 Bacteria 10316
134 Ga0207667_10100355 3300025949 Bacteria 2986
135 Ga0207712_10000005 3300025961 Bacteria 608697
136 Ga0207658_10000316 3300025986 Bacteria 48662
137 Ga0207677_10108471 3300026023 Bacteria 2062
138 Ga0207641_10003321 3300026088 Bacteria 14315
139 Ga0207641_10011331 3300026088 Bacteria 7318
140 Ga0207641_10329744 3300026088 Bacteria 1449
141 Ga0207674_10037704 3300026116 Bacteria 5023
142 Ga0207674_10215566 3300026116 Bacteria 1868
143 Ga0207675_100056433 3300026118 Bacteria 3663
144 Ga0207683_10232652 3300026121 Bacteria 1681
145 Ga0207698_10040157 3300026142 Bacteria 3473
146 Ga0209813_10023746 3300027866 Bacteria 1746
147 Ga0268266_10004670 3300028379 Bacteria 13049
148 Ga0268266_10020334 3300028379 Bacteria 5659
149 Ga0268265_10000005 3300028380 Bacteria 535350
150 Ga0268264_10000005 3300028381 Bacteria 934972
151 Ga0307517_10071568 3300028786 Bacteria 3106
152 Ga0307517_10160254 3300028786 Bacteria 1513
153 Ga0307515_10036058 3300028794 Bacteria 8018
154 Ga0307515_10065813 3300028794 Bacteria 5034
155 Ga0307515_10106730 3300028794 Bacteria 3318
156 Ga0237817_10012 3300030083 Bacteria 76001
157 Ga0237817_10068 3300030083 Bacteria 33736
158 Ga0307511_10013821 3300030521 Bacteria 7877
159 Ga0307512_10005567 3300030522 Bacteria 13089
160 Ga0265327_10000532 3300031251 Bacteria 65543
161 Ga0265327_10003586 3300031251 Bacteria 14659
162 Ga0307513_10067180 3300031456 Bacteria 3763
163 Ga0307509_10049617 3300031507 Bacteria 4499
164 Ga0265342_10008744 3300031712 Bacteria 7223
165 Ga0316576_10029907 3300031727 Bacteria 3854
166 Ga0316576_10039988 3300031727 Bacteria 3368
167 Ga0307516_10002975 3300031730 Bacteria 22144
168 Ga0307413_10037452 3300031824 Bacteria 2801
169 Ga0307413_10090069 3300031824 Bacteria 1995
170 Ga0307410_10245949 3300031852 Bacteria 1388
171 Ga0307411_10122509 3300032005 Bacteria 1884
172 Ga0307415_100078701 3300032126 Bacteria 2346
173 Ga0307507_10106290 3300033179 Bacteria 2318
174 Ga0307510_10206167 3300033180 Bacteria 1494
175 Ga0373926_0052234 3300035083 Bacteria 1477
176 Ga0373951_0000316 3300035091 Bacteria 15083
177 Ga0373945_0047835 3300035116 Bacteria 1565
178 Ga0373927_0000524 3300035695 Bacteria 29117
179 Ga0373947_0000741 3300035725 Bacteria 19572
180 Ga0373947_0144296 3300035725 Bacteria 1529
181 Ga0316584_0001501 3300036712 Bacteria 14046
182 Ga0316584_0156289 3300036712 Bacteria 1696
183 Ga0373925_0001648 3300037068 Bacteria 18821
184 Ga0373925_0051195 3300037068 Bacteria 3082
185 Ga0395899_0001284 3300037312 Bacteria 21770
186 Ga0237819_00064 3300038705 Bacteria 37828
187 Ga0237819_00081 3300038705 Bacteria 34666
188 Ga0400490_19112 3300038726 Bacteria 8222
189 Ga0436365_0548618 3300039437 Bacteria 38439
190 Ga0436365_1573747 3300039437 Bacteria 26695
191 Ga0439461_0004470 3300041410 Bacteria 2336
192 Ga0439466_0001247 3300041411 Bacteria 9888
193 Ga0439466_0007808 3300041411 Bacteria 4042
194 Ga0439465_0001363 3300041413 Bacteria 7873
195 Ga0439465_0060897 3300041413 Bacteria 1250
196 Ga0451853_0317456 3300041512 Bacteria 6444
197 Ga0451853_2568413 3300041512 Bacteria 2232
198 Ga0439431_0001303 3300041997 Bacteria 5481
199 Ga0439442_012830 3300042002 Bacteria 1715
200 Ga0439445_0025219 3300042004 Bacteria 1515
201 Ga0439457_000045 3300042014 Bacteria 26189
202 Ga0439434_0008474 3300042435 Bacteria 3015
203 Ga0466969_0028280 3300044656 Bacteria 2866
204 Ga0466972_0024195 3300044658 Bacteria 3014
205 Ga0466972_0044668 3300044658 Bacteria 2148
206 Ga0466972_0055574 3300044658 Bacteria 1904
207 Ga0466965_0000004 3300044683 Bacteria 229348
208 Ga0466965_0003174 3300044683 Bacteria 7178
209 Ga0466965_0012333 3300044683 Bacteria 4018
210 Ga0466965_0041924 3300044683 Bacteria 2256
211 Ga0466961_0017207 3300044693 Bacteria 4644
212 Ga0466961_0066711 3300044693 Bacteria 2285
213 Ga0453684_0393660 3300044712 Bacteria 1553
214 Ga0466971_0011020 3300044719 Bacteria 3957
215 Ga0466971_0025406 3300044719 Bacteria 2645
216 Ga0466968_0001279 3300044735 Bacteria 8960
217 Ga0466970_0008305 3300044765 Bacteria 5222
218 Ga0466957_0008721 3300044842 Bacteria 5774
219 Ga0466960_0002334 3300044901 Bacteria 7129
220 Ga0466959_0004098 3300045049 Bacteria 9706
221 Ga0466959_0020016 3300045049 Bacteria 4925
222 Ga0451576_0001881 3300045051 Bacteria 33790
223 Ga0466958_0016688 3300045836 Bacteria 4232
224 Ga0466958_0098342 3300045836 Bacteria 1817
225 Ga0466967_0063874 3300045976 Bacteria 3273
226 Ga0466967_0282337 3300045976 Bacteria 1593
227 Ga0495629_0019711 3300046459 Bacteria 4815
228 Ga0495582_0051939 3300046473 Bacteria 2261
229 Ga0495639_0099994 3300046475 Bacteria 1368
230 Ga0495583_0038562 3300046506 Bacteria 2257
231 Ga0495648_0009985 3300046524 Bacteria 7281
232 Ga0495654_0029506 3300046530 Bacteria 2797
233 Ga0495665_0023934 3300046531 Bacteria 3281
234 Ga0495640_0062926 3300046533 Bacteria 2515
235 Ga0495586_0089631 3300046535 Bacteria 1698
236 Ga0495668_0009708 3300046616 Bacteria 5881
237 Ga0495611_0069008 3300046648 Bacteria 1614
238 Ga0495658_0010966 3300046683 Bacteria 4544
239 Ga0495581_0098732 3300047315 Bacteria 1696
240 Ga0495676_0157182 3300047321 Bacteria 1612
241 Ga0495683_0000181 3300047323 Bacteria 61963
242 Ga0495673_0004409 3300047469 Bacteria 8811
243 Ga0495686_0060563 3300047472 Bacteria 2353
244 Ga0495593_0021032 3300047673 Bacteria 3648
245 Ga0496101_0000075 3300048904 Bacteria 112785
246 Ga0496101_0035064 3300048904 Bacteria 3548
247 Ga0496102_0000003 3300048905 Bacteria 592263
248 Ga0496102_0000050 3300048905 Bacteria 179469
249 Ga0496102_0003725 3300048905 Bacteria 12884
250 Ga0496102_0024044 3300048905 Bacteria 5416
251 Ga0496102_0072788 3300048905 Bacteria 3159
252 Ga0496102_0103023 3300048905 Bacteria 2654
253 Ga0496103_0000014 3300048906 Bacteria 290397
254 Ga0496103_0000738 3300048906 Bacteria 24107
255 Ga0496103_0101109 3300048906 Bacteria 1825
256 Ga0496103_0109237 3300048906 Bacteria 1756
257 Ga0496104_0009931 3300048907 Bacteria 8498
258 Ga0496104_0030595 3300048907 Bacteria 5003
259 Ga0496105_0035862 3300048908 Bacteria 4084
260 Ga0496105_0036313 3300048908 Bacteria 4059
261 Ga0496106_0142069 3300048909 Bacteria 1889
262 Ga0496108_0011814 3300048911 Bacteria 7104
263 Ga0496108_0023708 3300048911 Bacteria 5050
264 Ga0496108_0090651 3300048911 Bacteria 2599
265 Ga0496109_0002876 3300048912 Bacteria 14406
266 Ga0496110_0004750 3300048913 Bacteria 10579
267 Ga0496110_0015955 3300048913 Bacteria 6264
268 Ga0496111_0024841 3300048914 Bacteria 4226
269 Ga0496111_0051230 3300048914 Bacteria 2980
270 Ga0496111_0064191 3300048914 Bacteria 2664
271 Ga0496111_0087491 3300048914 Bacteria 2280
272 Ga0496112_0008930 3300048915 Bacteria 8997
273 Ga0496112_0045933 3300048915 Bacteria 4281
274 Ga0496112_0064468 3300048915 Bacteria 3615
275 Ga0496112_0081905 3300048915 Bacteria 3192
276 Ga0496112_0149674 3300048915 Bacteria 2301
277 Ga0496113_0008581 3300048916 Bacteria 6666
278 Ga0496113_0013096 3300048916 Bacteria 5602
279 Ga0496113_0033072 3300048916 Bacteria 3762
280 Ga0496113_0097378 3300048916 Bacteria 2276
281 Ga0496113_0108057 3300048916 Bacteria 2162
282 Ga0496116_0000040 3300048919 Bacteria 346900
283 Ga0496116_0014608 3300048919 Bacteria 6259
284 Ga0496117_0000003 3300048920 Bacteria 1881097
285 Ga0496117_0000014 3300048920 Bacteria 584427
286 Ga0496117_0002221 3300048920 Bacteria 25126
287 Ga0496117_0006545 3300048920 Bacteria 11728
288 Ga0496117_0108289 3300048920 Bacteria 1738
289 Ga0496118_0000001 3300048921 Bacteria 1881100
290 Ga0496118_0001032 3300048921 Bacteria 43337
291 Ga0496118_0009941 3300048921 Bacteria 9499
292 Ga0496119_0000256 3300048922 Bacteria 75557
293 Ga0496119_0000527 3300048922 Bacteria 52100
294 Ga0496119_0005670 3300048922 Bacteria 11848
295 Ga0496119_0021912 3300048922 Bacteria 4595
296 Ga0496119_0033439 3300048922 Bacteria 3407
297 Ga0496119_0105207 3300048922 Bacteria 1577
298 Ga0496120_0000293 3300048923 Bacteria 83834
299 Ga0496120_0003928 3300048923 Bacteria 12955
300 Ga0496120_0006448 3300048923 Bacteria 9012
301 Ga0496120_0022335 3300048923 Bacteria 3982
302 Ga0496120_0049683 3300048923 Bacteria 2406
303 Ga0496120_0071113 3300048923 Bacteria 1911
304 Ga0496121_0000019 3300048924 Bacteria 499976
305 Ga0496122_0000511 3300048925 Bacteria 80182
306 Ga0496122_0009318 3300048925 Bacteria 10375
307 Ga0496123_0000011 3300048926 Bacteria 493925
308 Ga0496123_0002843 3300048926 Bacteria 20464
309 Ga0496123_0023558 3300048926 Bacteria 4708
310 Ga0496124_0001998 3300048927 Bacteria 27787
311 Ga0496124_0013383 3300048927 Bacteria 8011
312 Ga0496125_0019441 3300048928 Bacteria 6405
313 Ga0496125_0033334 3300048928 Bacteria 4558
314 Ga0496126_0001018 3300048929 Bacteria 47580
315 Ga0496126_0001119 3300048929 Bacteria 44895
316 Ga0496126_0001704 3300048929 Bacteria 32650
317 Ga0496126_0002750 3300048929 Bacteria 23226
318 Ga0496126_0005089 3300048929 Bacteria 15250
319 Ga0496126_0007007 3300048929 Bacteria 12447
320 Ga0496126_0025059 3300048929 Bacteria 5749
321 Ga0501031_0113404 3300049568 Bacteria 1770
322 Ga0501032_0047841 3300049569 Bacteria 2888
323 Ga0501032_0059970 3300049569 Bacteria 2552
324 Ga0501033_0007354 3300049570 Bacteria 8575
325 Ga0501033_0020000 3300049570 Bacteria 5060
326 Ga0501034_0027229 3300049571 Bacteria 5815
327 Ga0501034_0075175 3300049571 Bacteria 3386
328 Ga0501036_0013003 3300049572 Bacteria 6911
329 Ga0501036_0033729 3300049572 Bacteria 4329
330 Ga0501036_0112441 3300049572 Bacteria 2301
331 Ga0501037_0000110 3300049573 Bacteria 77484
332 Ga0501037_0027299 3300049573 Bacteria 4218
333 Ga0501038_0002820 3300049574 Bacteria 16173
334 Ga0501038_0013579 3300049574 Bacteria 7421
335 Ga0501038_0098282 3300049574 Bacteria 2441
336 Ga0501039_0000276 3300049575 Bacteria 36811
337 Ga0501039_0015905 3300049575 Bacteria 5760
338 Ga0501040_0012792 3300049576 Bacteria 5509
339 Ga0501042_0057208 3300049578 Bacteria 2783
340 Ga0501043_0000875 3300049579 Bacteria 26714
341 Ga0501046_0007004 3300049580 Bacteria 9929
342 Ga0501046_0077042 3300049580 Bacteria 2582
343 Ga0501047_0053139 3300049581 Bacteria 3916
344 Ga0501047_0231489 3300049581 Bacteria 1701
345 Ga0501048_0041168 3300049582 Bacteria 3310
346 Ga0501070_0002622 3300049586 Bacteria 15709
347 Ga0501074_0186298 3300049590 Bacteria 1480
348 Ga0501075_0060243 3300049591 Bacteria 2860
349 Ga0501076_0062976 3300049592 Bacteria 2954
350 Ga0501079_0031957 3300049741 Bacteria 4045
351 Ga0501081_0103399 3300049743 Bacteria 2015
352 Ga0501035_0023721 3300049822 Bacteria 5629
353 Ga0501035_0033518 3300049822 Bacteria 4671
354 Ga0501035_0153314 3300049822 Bacteria 1998
355 Ga0501044_0012912 3300049823 Bacteria 9040
356 Ga0501044_0019073 3300049823 Bacteria 7343
357 Ga0501044_0056778 3300049823 Bacteria 4019
358 Ga0501044_0215489 3300049823 Bacteria 1873
359 nmdc:mga03683_34246_c1 3300050489 Bacteria 2054
360 nmdc:mga03683_5716_c1 3300050489 Bacteria 4219
361 nmdc:mga03n38_111439_c1 3300050490 Bacteria 1333
362 nmdc:mga00v17_10886_c1 3300050491 Bacteria 4984
363 nmdc:mga00v17_20610_c1 3300050491 Bacteria 3779
364 nmdc:mga00v17_9653_c1 3300050491 Bacteria 5234
365 nmdc:mga0k408_13689_c1 3300050493 Bacteria 4454
366 nmdc:mga04h51_8675_c1 3300050495 Bacteria 2725
367 nmdc:mga0qj67_109433_c1 3300050509 Bacteria 2230
368 nmdc:mga0qj67_759_c1 3300050509 Bacteria 21967
369 nmdc:mga08y16_257633_c1 3300050511 Bacteria 1802
370 nmdc:mga0sz30_2466_c1 3300050516 Bacteria 6585
371 Ga0500610_0008396 3300053079 Bacteria 4498
372 Ga0500643_001858 3300053087 Bacteria 11519
373 Ga0500643_009535 3300053087 Bacteria 3700
374 Ga0500646_0000038 3300053090 Bacteria 37529
375 Ga0500641_0023806 3300053096 Bacteria 2358
376 Ga0500553_115022 3300053101 Bacteria 1122
377 Ga0500593_000883 3300053117 Bacteria 11145
378 Ga0500642_0004128 3300053130 Bacteria 4495
379 Ga0500652_000187 3300053131 Bacteria 23997
380 Ga0500568_0000717 3300053139 Bacteria 23747
381 Ga0500573_0030000 3300053140 Bacteria 3136
382 Ga0500616_0018233 3300053153 Bacteria 3971
383 Ga0500622_0001496 3300053156 Bacteria 18586
384 Ga0500622_0002335 3300053156 Bacteria 13822
385 Ga0501084_0021275 3300054114 Bacteria 5407
386 Ga0501082_0121342 3300060353 Bacteria 2265
387 Ga0466962_0023328 3300061719 Bacteria 2974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041413 Ga0439465_0060897 Ga0439465_0060897_14_1063 343
2 3300046475 Ga0495639_0099994 Ga0495639_0099994_263_1342 345
3 3300053153 Ga0500616_0018233 Ga0500616_0018233_27_1082 345
4 3300053101 Ga0500553_115022 Ga0500553_115022_20_1093 352
5 3300037068 Ga0373925_0051195 Ga0373925_0051195_1649_2881 362
6 3300005329 Ga0070683_100366606 Ga0070683_1003666061 366
7 3300009148 Ga0105243_10165400 Ga0105243_101654001 366
8 3300013308 Ga0157375_10077481 Ga0157375_100774812 366
9 3300014325 Ga0163163_10098763 Ga0163163_100987632 366
10 3300025940 Ga0207691_10176525 Ga0207691_101765252 366
11 3300041512 Ga0451853_2568413 Ga0451853_2568413_114_1334 366
12 3300049569 Ga0501032_0059970 Ga0501032_0059970_1046_2314 374
13 3300049574 Ga0501038_0098282 Ga0501038_0098282_1051_2328 375
14 3300049822 Ga0501035_0153314 Ga0501035_0153314_120_1397 375
15 3300049823 Ga0501044_0056778 Ga0501044_0056778_571_1848 375
16 3300053117 Ga0500593_000883 Ga0500593_000883_382_1668 375
17 3300009092 Ga0105250_10027675 Ga0105250_100276752 376
18 3300013308 Ga0157375_10259032 Ga0157375_102590322 376
19 3300025711 Ga0207696_1021684 Ga0207696_10216842 376
20 3300005577 Ga0068857_100243089 Ga0068857_1002430892 378
21 3300026116 Ga0207674_10215566 Ga0207674_102155662 378
22 3300006048 Ga0075363_100046547 Ga0075363_1000465472 379
23 3300006051 Ga0075364_10011450 Ga0075364_100114504 379
24 3300006186 Ga0075369_10021759 Ga0075369_100217593 379
25 3300049568 Ga0501031_0113404 Ga0501031_0113404_164_1375 379
26 3300049569 Ga0501032_0047841 Ga0501032_0047841_782_1993 379
27 3300049572 Ga0501036_0033729 Ga0501036_0033729_1649_2860 379
28 3300049575 Ga0501039_0015905 Ga0501039_0015905_1406_2617 379
29 3300049576 Ga0501040_0012792 Ga0501040_0012792_1310_2521 379
30 3300049580 Ga0501046_0077042 Ga0501046_0077042_1308_2519 379
31 3300049582 Ga0501048_0041168 Ga0501048_0041168_897_2108 379
32 3300049591 Ga0501075_0060243 Ga0501075_0060243_819_2030 379
33 3300049592 Ga0501076_0062976 Ga0501076_0062976_1008_2219 379
34 3300049741 Ga0501079_0031957 Ga0501079_0031957_1639_2850 379
35 3300049743 Ga0501081_0103399 Ga0501081_0103399_676_1887 379
36 3300049822 Ga0501035_0033518 Ga0501035_0033518_1721_2932 379
37 3300050489 nmdc:mga03683_5716_c1 nmdc:mga03683_5716_c1_847_2088 379
38 3300050491 nmdc:mga00v17_9653_c1 nmdc:mga00v17_9653_c1_2086_3327 379
39 3300053096 Ga0500641_0023806 Ga0500641_0023806_544_1779 379
40 3300054114 Ga0501084_0021275 Ga0501084_0021275_2948_4159 379
41 3300060353 Ga0501082_0121342 Ga0501082_0121342_549_1760 379
42 3300033179 Ga0307507_10106290 Ga0307507_101062901 380
43 3300013307 Ga0157372_10012226 Ga0157372_1001222611 381
44 3300053090 Ga0500646_0000038 Ga0500646_0000038_33674_34882 381
45 3300005618 Ga0068864_100017142 Ga0068864_1000171426 383
46 3300005841 Ga0068863_100359281 Ga0068863_1003592812 383
47 3300009177 Ga0105248_10004546 Ga0105248_100045467 383
48 3300026088 Ga0207641_10329744 Ga0207641_103297441 383
49 3300048907 Ga0496104_0009931 Ga0496104_0009931_2138_3370 383
50 3300048908 Ga0496105_0035862 Ga0496105_0035862_1401_2633 383
51 3300048912 Ga0496109_0002876 Ga0496109_0002876_12647_13879 383
52 3300048913 Ga0496110_0004750 Ga0496110_0004750_6640_7872 383
53 3300048914 Ga0496111_0087491 Ga0496111_0087491_1010_2242 383
54 3300048915 Ga0496112_0149674 Ga0496112_0149674_423_1655 383
55 3300048916 Ga0496113_0108057 Ga0496113_0108057_357_1589 383
56 3300005329 Ga0070683_100000938 Ga0070683_10000093811 386
57 3300005535 Ga0070684_100050198 Ga0070684_1000501982 386
58 3300025944 Ga0207661_10003990 Ga0207661_100039906 386
59 3300032126 Ga0307415_100078701 Ga0307415_1000787012 386
60 3300044712 Ga0453684_0393660 Ga0453684_0393660_283_1458 386
61 3300021384 Ga0213876_10021932 Ga0213876_100219322 389
62 3300038726 Ga0400490_19112 Ga0400490_19112_3107_4285 389
63 3300039437 Ga0436365_0548618 Ga0436365_0548618_7118_8332 389
64 3300005331 Ga0070670_100190230 Ga0070670_1001902302 390
65 3300025925 Ga0207650_10163320 Ga0207650_101633202 390
66 3300042002 Ga0439442_012830 Ga0439442_012830_431_1693 390
67 3300053140 Ga0500573_0030000 Ga0500573_0030000_212_1402 390
68 3300006038 Ga0075365_10033973 Ga0075365_100339732 391
69 3300006051 Ga0075364_10031848 Ga0075364_100318482 391
70 3300006353 Ga0075370_10004873 Ga0075370_100048734 391
71 3300031852 Ga0307410_10245949 Ga0307410_102459491 391
72 3300044658 Ga0466972_0024195 Ga0466972_0024195_536_1753 391
73 3300044683 Ga0466965_0012333 Ga0466965_0012333_2626_3828 391
74 3300044683 Ga0466965_0041924 Ga0466965_0041924_723_1940 391
75 3300044693 Ga0466961_0017207 Ga0466961_0017207_1112_2329 391
76 3300044719 Ga0466971_0025406 Ga0466971_0025406_886_2103 391
77 3300044735 Ga0466968_0001279 Ga0466968_0001279_3865_5067 391
78 3300044765 Ga0466970_0008305 Ga0466970_0008305_2165_3382 391
79 3300044842 Ga0466957_0008721 Ga0466957_0008721_206_1408 391
80 3300045049 Ga0466959_0020016 Ga0466959_0020016_3367_4569 391
81 3300045836 Ga0466958_0016688 Ga0466958_0016688_400_1617 391
82 3300045836 Ga0466958_0098342 Ga0466958_0098342_423_1649 391
83 3300045976 Ga0466967_0063874 Ga0466967_0063874_1534_2736 391
84 3300048923 Ga0496120_0006448 Ga0496120_0006448_5181_6389 391
85 3300061719 Ga0466962_0023328 Ga0466962_0023328_342_1559 391
86 iso_pu_bacteria 3001267043 3001268959 391
87 iso_pu_bacteria 3001272096 3001274396 391
88 iso_pu_bacteria 3006988479 3006993046 391
89 3300005367 Ga0070667_100002503 Ga0070667_10000250313 392
90 3300005456 Ga0070678_100147305 Ga0070678_1001473051 392
91 3300009094 Ga0111539_10137635 Ga0111539_101376353 392
92 3300010375 Ga0105239_10030709 Ga0105239_100307092 392
93 3300026142 Ga0207698_10040157 Ga0207698_100401572 392
94 3300028794 Ga0307515_10065813 Ga0307515_100658133 392
95 3300031251 Ga0265327_10003586 Ga0265327_1000358613 392
96 3300049590 Ga0501074_0186298 Ga0501074_0186298_59_1288 392
97 3300050511 nmdc:mga08y16_257633_c1 nmdc:mga08y16_257633_c1_108_1394 392
98 3300053087 Ga0500643_001858 Ga0500643_001858_8651_9847 392
99 3300053130 Ga0500642_0004128 Ga0500642_0004128_823_2046 392
100 iso_pu_bacteria 2512564013 2512639731 392
101 iso_pu_bacteria 2551306519 2553391838 392
102 iso_pu_bacteria 2554235283 2555468309 392
103 iso_pu_bacteria 2563366752 2563930323 392
104 iso_pu_bacteria 2582581312 2585296051 392
105 iso_pu_bacteria 2643221729 2644707779 392
106 iso_pu_bacteria 2643221730 2644712189 392
107 iso_pu_bacteria 2643221735 2644738875 392
108 iso_pu_bacteria 2684622632 2685149075 392
109 iso_pu_bacteria 2684623153 2686998455 392
110 iso_pu_bacteria 2687453109 2687499732 392
111 iso_pu_bacteria 2695420987 2698324107 392
112 iso_pu_bacteria 2703719227 2705993111 392
113 iso_pu_bacteria 2718218445 2721504457 392
114 iso_pu_bacteria 2738541358 2739156602 392
115 iso_pu_bacteria 2738543006 2739210203 392
116 iso_pu_bacteria 2788500588 2791214994 392
117 iso_pu_bacteria 2808606982 2811844950 392
118 iso_pu_bacteria 2818991443 2819582885 392
119 iso_pu_bacteria 2818991451 2819629776 392
120 iso_pu_bacteria 2818991463 2819695108 392
121 iso_pu_bacteria 2818991468 2819722650 392
122 iso_pu_bacteria 2823526263 2823529563 392
123 iso_pu_bacteria 2857472729 2857475974 392
124 iso_pu_bacteria 2904606771 2904610176 392
125 iso_pu_bacteria 2908665501 2908666934 392
126 iso_pu_bacteria 2915597211 2915600876 392
127 iso_pu_bacteria 2916971899 2916976288 392
128 iso_pu_bacteria 2919093281 2919095052 392
129 iso_pu_bacteria 2929183550 2929186014 392
130 iso_pu_bacteria 2929233124 2929234346 392
131 iso_pu_bacteria 2938917290 2938918517 392
132 iso_pu_bacteria 2939593269 2939598012 392
133 iso_pu_bacteria 2947426588 2947427860 392
134 iso_pu_bacteria 2954773129 2954776898 392
135 iso_pu_bacteria 2956897341 2956902288 392
136 iso_pu_bacteria 2965761152 2965762366 392
137 iso_pu_bacteria 2979083700 2979084776 392
138 iso_pu_bacteria 2980125574 2980130785 392
139 iso_pu_bacteria 8022621104 8022622291 392
140 iso_pu_bacteria 8022792930 8022793462 392
141 iso_pu_bacteria 8023438354 8023443330 392
142 iso_pu_bacteria 8023444577 8023449366 392
143 iso_pu_bacteria 8025478263 8025482312 392
144 iso_pu_bacteria 8054280661 8054284014 392
145 iso_pu_bacteria 8055531788 8055536093 392
146 iso_pu_bacteria 8057582654 8057583855 392
147 3300006051 Ga0075364_10027707 Ga0075364_100277072 393
148 3300013105 Ga0157369_10271441 Ga0157369_102714411 393
149 3300013308 Ga0157375_10354984 Ga0157375_103549842 393
150 3300036712 Ga0316584_0156289 Ga0316584_0156289_73_1290 393
151 3300041411 Ga0439466_0001247 Ga0439466_0001247_6266_7489 393
152 3300041997 Ga0439431_0001303 Ga0439431_0001303_4046_5269 393
153 3300042004 Ga0439445_0025219 Ga0439445_0025219_213_1436 393
154 3300042435 Ga0439434_0008474 Ga0439434_0008474_1556_2779 393
155 3300046473 Ga0495582_0051939 Ga0495582_0051939_601_1815 393
156 3300050491 nmdc:mga00v17_10886_c1 nmdc:mga00v17_10886_c1_1841_3049 393
157 iso_pu_bacteria 2593339131 2595090060 393
158 iso_pu_bacteria 2643221715 2644635628 393
159 iso_pu_bacteria 2671180330 2672337540 393
160 iso_pu_bacteria 2738541264 2738664222 393
161 iso_pu_bacteria 2738543010 2739231655 393
162 iso_pu_bacteria 2757320391 2757567599 393
163 iso_pu_bacteria 2775507177 2777763335 393
164 iso_pu_bacteria 2775507192 2777836260 393
165 iso_pu_bacteria 2808606372 2808899645 393
166 iso_pu_bacteria 2816332186 2816862051 393
167 iso_pu_bacteria 2842682962 2842686664 393
168 iso_pu_bacteria 2849139964 2849141614 393
169 iso_pu_bacteria 2857581216 2857583947 393
170 iso_pu_bacteria 2857586860 2857590106 393
171 iso_pu_bacteria 2902810491 2902813754 393
172 iso_pu_bacteria 2919395869 2919397251 393
173 iso_pu_bacteria 2919726948 2919727627 393
174 iso_pu_bacteria 2936340661 2936345508 393
175 iso_pu_bacteria 3006969106 3006971639 393
176 iso_pu_bacteria 3006984091 3006987133 393
177 iso_pu_bacteria 8022948649 8022953202 393
178 3300005437 Ga0070710_10000261 Ga0070710_100002613 394
179 3300044683 Ga0466965_0000004 Ga0466965_0000004_210274_211500 394
180 3300044693 Ga0466961_0066711 Ga0466961_0066711_766_1971 394
181 3300044719 Ga0466971_0011020 Ga0466971_0011020_2371_3576 394
182 3300045049 Ga0466959_0004098 Ga0466959_0004098_211_1449 394
183 3300048905 Ga0496102_0024044 Ga0496102_0024044_3634_4869 394
184 3300048922 Ga0496119_0000256 Ga0496119_0000256_18984_20201 394
185 3300048923 Ga0496120_0022335 Ga0496120_0022335_1563_2780 394
186 3300049573 Ga0501037_0027299 Ga0501037_0027299_622_1848 394
187 3300049574 Ga0501038_0013579 Ga0501038_0013579_5550_6776 394
188 iso_pu_bacteria 2751185782 2753265019 394
189 iso_pu_bacteria 2831905167 2831908059 394
190 iso_pu_bacteria 2833709550 2833712583 394
191 3300003187 JGI25151J46595_10016140 JGI25151J46595_100161402 395
192 3300003578 Ga0006562J51391_1071400 Ga0006562J51391_107140010 395
193 3300005289 Ga0065704_10089489 Ga0065704_100894892 395
194 3300005337 Ga0070682_100004788 Ga0070682_1000047887 395
195 3300005353 Ga0070669_100000944 Ga0070669_10000094417 395
196 3300005355 Ga0070671_100002004 Ga0070671_10000200413 395
197 3300005367 Ga0070667_100000182 Ga0070667_10000018228 395
198 3300005455 Ga0070663_100069351 Ga0070663_1000693512 395
199 3300005457 Ga0070662_100005256 Ga0070662_10000525610 395
200 3300005459 Ga0068867_100046951 Ga0068867_1000469512 395
201 3300005548 Ga0070665_100008095 Ga0070665_10000809511 395
202 3300005617 Ga0068859_100008871 Ga0068859_1000088712 395
203 3300005618 Ga0068864_100055669 Ga0068864_1000556692 395
204 3300005841 Ga0068863_100012289 Ga0068863_1000122894 395
205 3300005841 Ga0068863_100014842 Ga0068863_1000148426 395
206 3300005842 Ga0068858_100039330 Ga0068858_1000393304 395
207 3300005843 Ga0068860_100000374 Ga0068860_10000037429 395
208 3300005844 Ga0068862_100000276 Ga0068862_10000027631 395
209 3300005844 Ga0068862_100090833 Ga0068862_1000908332 395
210 3300005937 Ga0081455_10017303 Ga0081455_100173033 395
211 3300006048 Ga0075363_100001303 Ga0075363_1000013037 395
212 3300006048 Ga0075363_100028896 Ga0075363_1000288962 395
213 3300006051 Ga0075364_10023675 Ga0075364_100236752 395
214 3300006178 Ga0075367_10003453 Ga0075367_100034532 395
215 3300006186 Ga0075369_10020487 Ga0075369_100204872 395
216 3300006353 Ga0075370_10002037 Ga0075370_100020374 395
217 3300006353 Ga0075370_10003960 Ga0075370_100039602 395
218 3300006844 Ga0075428_100001829 Ga0075428_10000182913 395
219 3300006846 Ga0075430_100001544 Ga0075430_10000154416 395
220 3300006846 Ga0075430_100055026 Ga0075430_1000550262 395
221 3300006847 Ga0075431_100033580 Ga0075431_1000335804 395
222 3300006931 Ga0097620_100008871 Ga0097620_10000887111 395
223 3300009036 Ga0105244_10000719 Ga0105244_1000071929 395
224 3300009098 Ga0105245_10036363 Ga0105245_100363633 395
225 3300009101 Ga0105247_10000181 Ga0105247_1000018129 395
226 3300009148 Ga0105243_10235964 Ga0105243_102359641 395
227 3300009177 Ga0105248_10000652 Ga0105248_100006529 395
228 3300009545 Ga0105237_10003090 Ga0105237_1000309013 395
229 3300009545 Ga0105237_10057184 Ga0105237_100571843 395
230 3300009553 Ga0105249_10000022 Ga0105249_10000022226 395
231 3300010375 Ga0105239_10001222 Ga0105239_1000122236 395
232 3300013306 Ga0163162_10035949 Ga0163162_100359492 395
233 3300013306 Ga0163162_10060900 Ga0163162_100609003 395
234 3300013307 Ga0157372_10104317 Ga0157372_101043173 395
235 3300013308 Ga0157375_10103532 Ga0157375_101035323 395
236 3300014325 Ga0163163_10176172 Ga0163163_101761722 395
237 3300014326 Ga0157380_10006402 Ga0157380_100064022 395
238 3300025728 Ga0207655_1000184 Ga0207655_1000184124 395
239 3300025900 Ga0207710_10000091 Ga0207710_1000009129 395
240 3300025914 Ga0207671_10055321 Ga0207671_100553212 395
241 3300025923 Ga0207681_10001711 Ga0207681_1000171113 395
242 3300025931 Ga0207644_10005495 Ga0207644_100054953 395
243 3300025941 Ga0207711_10000713 Ga0207711_1000071329 395
244 3300025961 Ga0207712_10000005 Ga0207712_10000005228 395
245 3300025986 Ga0207658_10000316 Ga0207658_1000031622 395
246 3300026023 Ga0207677_10108471 Ga0207677_101084712 395
247 3300026088 Ga0207641_10003321 Ga0207641_1000332111 395
248 3300026088 Ga0207641_10011331 Ga0207641_100113315 395
249 3300026118 Ga0207675_100056433 Ga0207675_1000564334 395
250 3300026121 Ga0207683_10232652 Ga0207683_102326522 395
251 3300027866 Ga0209813_10023746 Ga0209813_100237462 395
252 3300028379 Ga0268266_10004670 Ga0268266_1000467013 395
253 3300028379 Ga0268266_10020334 Ga0268266_100203345 395
254 3300028380 Ga0268265_10000005 Ga0268265_10000005520 395
255 3300028381 Ga0268264_10000005 Ga0268264_10000005227 395
256 3300028786 Ga0307517_10071568 Ga0307517_100715682 395
257 3300028786 Ga0307517_10160254 Ga0307517_101602541 395
258 3300028794 Ga0307515_10036058 Ga0307515_100360588 395
259 3300030522 Ga0307512_10005567 Ga0307512_1000556711 395
260 3300031251 Ga0265327_10000532 Ga0265327_1000053237 395
261 3300031507 Ga0307509_10049617 Ga0307509_100496172 395
262 3300031730 Ga0307516_10002975 Ga0307516_100029752 395
263 3300031824 Ga0307413_10037452 Ga0307413_100374522 395
264 3300032005 Ga0307411_10122509 Ga0307411_101225091 395
265 3300035091 Ga0373951_0000316 Ga0373951_0000316_7504_8727 395
266 3300035725 Ga0373947_0144296 Ga0373947_0144296_106_1380 395
267 3300037312 Ga0395899_0001284 Ga0395899_0001284_15969_17213 395
268 3300039437 Ga0436365_1573747 Ga0436365_1573747_9647_10921 395
269 3300041410 Ga0439461_0004470 Ga0439461_0004470_996_2252 395
270 3300041411 Ga0439466_0007808 Ga0439466_0007808_2695_3951 395
271 3300041413 Ga0439465_0001363 Ga0439465_0001363_1561_2817 395
272 3300041512 Ga0451853_0317456 Ga0451853_0317456_3810_5024 395
273 3300044656 Ga0466969_0028280 Ga0466969_0028280_71_1357 395
274 3300044658 Ga0466972_0055574 Ga0466972_0055574_227_1468 395
275 3300045976 Ga0466967_0282337 Ga0466967_0282337_81_1313 395
276 3300046506 Ga0495583_0038562 Ga0495583_0038562_379_1644 395
277 3300046524 Ga0495648_0009985 Ga0495648_0009985_3364_4629 395
278 3300046530 Ga0495654_0029506 Ga0495654_0029506_597_1814 395
279 3300046531 Ga0495665_0023934 Ga0495665_0023934_524_1750 395
280 3300046533 Ga0495640_0062926 Ga0495640_0062926_780_2054 395
281 3300046616 Ga0495668_0009708 Ga0495668_0009708_2580_3845 395
282 3300046648 Ga0495611_0069008 Ga0495611_0069008_173_1414 395
283 3300046683 Ga0495658_0010966 Ga0495658_0010966_879_2153 395
284 3300047315 Ga0495581_0098732 Ga0495581_0098732_145_1419 395
285 3300047321 Ga0495676_0157182 Ga0495676_0157182_202_1476 395
286 3300047323 Ga0495683_0000181 Ga0495683_0000181_10022_11254 395
287 3300047469 Ga0495673_0004409 Ga0495673_0004409_4876_6141 395
288 3300047472 Ga0495686_0060563 Ga0495686_0060563_716_1981 395
289 3300047673 Ga0495593_0021032 Ga0495593_0021032_1335_2609 395
290 3300048904 Ga0496101_0000075 Ga0496101_0000075_34536_35771 395
291 3300048904 Ga0496101_0035064 Ga0496101_0035064_41_1276 395
292 3300048905 Ga0496102_0000003 Ga0496102_0000003_248045_249304 395
293 3300048905 Ga0496102_0000050 Ga0496102_0000050_29397_30662 395
294 3300048905 Ga0496102_0003725 Ga0496102_0003725_11502_12764 395
295 3300048905 Ga0496102_0072788 Ga0496102_0072788_1831_3051 395
296 3300048906 Ga0496103_0000014 Ga0496103_0000014_41312_42547 395
297 3300048906 Ga0496103_0000738 Ga0496103_0000738_21383_22648 395
298 3300048906 Ga0496103_0109237 Ga0496103_0109237_280_1515 395
299 3300048907 Ga0496104_0030595 Ga0496104_0030595_3044_4264 395
300 3300048908 Ga0496105_0036313 Ga0496105_0036313_811_2073 395
301 3300048911 Ga0496108_0011814 Ga0496108_0011814_4680_5930 395
302 3300048911 Ga0496108_0023708 Ga0496108_0023708_2452_3702 395
303 3300048914 Ga0496111_0024841 Ga0496111_0024841_147_1367 395
304 3300048914 Ga0496111_0064191 Ga0496111_0064191_438_1688 395
305 3300048915 Ga0496112_0008930 Ga0496112_0008930_2657_3907 395
306 3300048915 Ga0496112_0045933 Ga0496112_0045933_1067_2302 395
307 3300048916 Ga0496113_0008581 Ga0496113_0008581_3855_5090 395
308 3300048916 Ga0496113_0033072 Ga0496113_0033072_2135_3355 395
309 3300048916 Ga0496113_0097378 Ga0496113_0097378_301_1551 395
310 3300048919 Ga0496116_0000040 Ga0496116_0000040_2685_3944 395
311 3300048919 Ga0496116_0014608 Ga0496116_0014608_1706_2971 395
312 3300048920 Ga0496117_0000003 Ga0496117_0000003_342960_344195 395
313 3300048920 Ga0496117_0000014 Ga0496117_0000014_548965_550182 395
314 3300048920 Ga0496117_0002221 Ga0496117_0002221_23452_24666 395
315 3300048920 Ga0496117_0006545 Ga0496117_0006545_9647_10912 395
316 3300048920 Ga0496117_0108289 Ga0496117_0108289_240_1565 395
317 3300048921 Ga0496118_0000001 Ga0496118_0000001_342963_344198 395
318 3300048921 Ga0496118_0001032 Ga0496118_0001032_29112_30377 395
319 3300048921 Ga0496118_0009941 Ga0496118_0009941_4467_5681 395
320 3300048922 Ga0496119_0000527 Ga0496119_0000527_37452_38711 395
321 3300048922 Ga0496119_0005670 Ga0496119_0005670_10110_11324 395
322 3300048922 Ga0496119_0021912 Ga0496119_0021912_2611_3876 395
323 3300048922 Ga0496119_0033439 Ga0496119_0033439_2143_3357 395
324 3300048922 Ga0496119_0105207 Ga0496119_0105207_292_1512 395
325 3300048923 Ga0496120_0000293 Ga0496120_0000293_79876_81111 395
326 3300048923 Ga0496120_0003928 Ga0496120_0003928_1737_2951 395
327 3300048923 Ga0496120_0049683 Ga0496120_0049683_1024_2238 395
328 3300048923 Ga0496120_0071113 Ga0496120_0071113_165_1400 395
329 3300048924 Ga0496121_0000019 Ga0496121_0000019_257466_258725 395
330 3300048925 Ga0496122_0000511 Ga0496122_0000511_53582_54796 395
331 3300048925 Ga0496122_0009318 Ga0496122_0009318_57_1274 395
332 3300048926 Ga0496123_0000011 Ga0496123_0000011_338103_339317 395
333 3300048926 Ga0496123_0002843 Ga0496123_0002843_13800_15017 395
334 3300048926 Ga0496123_0023558 Ga0496123_0023558_2835_4070 395
335 3300048927 Ga0496124_0001998 Ga0496124_0001998_1666_2880 395
336 3300048927 Ga0496124_0013383 Ga0496124_0013383_2886_4103 395
337 3300048928 Ga0496125_0019441 Ga0496125_0019441_228_1442 395
338 3300048928 Ga0496125_0033334 Ga0496125_0033334_1435_2700 395
339 3300048929 Ga0496126_0001018 Ga0496126_0001018_2701_3960 395
340 3300048929 Ga0496126_0001119 Ga0496126_0001119_3539_4771 395
341 3300048929 Ga0496126_0001704 Ga0496126_0001704_952_2169 395
342 3300048929 Ga0496126_0002750 Ga0496126_0002750_14124_15359 395
343 3300048929 Ga0496126_0005089 Ga0496126_0005089_5232_6446 395
344 3300048929 Ga0496126_0007007 Ga0496126_0007007_10267_11532 395
345 3300048929 Ga0496126_0025059 Ga0496126_0025059_3580_4821 395
346 3300049570 Ga0501033_0007354 Ga0501033_0007354_3915_5156 395
347 3300049570 Ga0501033_0020000 Ga0501033_0020000_3713_4942 395
348 3300049571 Ga0501034_0027229 Ga0501034_0027229_167_1402 395
349 3300049571 Ga0501034_0075175 Ga0501034_0075175_31_1260 395
350 3300049572 Ga0501036_0013003 Ga0501036_0013003_912_2147 395
351 3300049572 Ga0501036_0112441 Ga0501036_0112441_441_1802 395
352 3300049573 Ga0501037_0000110 Ga0501037_0000110_71406_72641 395
353 3300049574 Ga0501038_0002820 Ga0501038_0002820_13819_15054 395
354 3300049575 Ga0501039_0000276 Ga0501039_0000276_30494_31729 395
355 3300049578 Ga0501042_0057208 Ga0501042_0057208_1086_2297 395
356 3300049579 Ga0501043_0000875 Ga0501043_0000875_24360_25595 395
357 3300049580 Ga0501046_0007004 Ga0501046_0007004_2314_3543 395
358 3300049581 Ga0501047_0053139 Ga0501047_0053139_1600_2829 395
359 3300049586 Ga0501070_0002622 Ga0501070_0002622_9977_11212 395
360 3300049822 Ga0501035_0023721 Ga0501035_0023721_1110_2339 395
361 3300049823 Ga0501044_0012912 Ga0501044_0012912_6730_7959 395
362 3300049823 Ga0501044_0019073 Ga0501044_0019073_3091_4326 395
363 3300050489 nmdc:mga03683_34246_c1 nmdc:mga03683_34246_c1_366_1616 395
364 3300050490 nmdc:mga03n38_111439_c1 nmdc:mga03n38_111439_c1_23_1273 395
365 3300050491 nmdc:mga00v17_20610_c1 nmdc:mga00v17_20610_c1_1467_2717 395
366 3300050493 nmdc:mga0k408_13689_c1 nmdc:mga0k408_13689_c1_2897_4147 395
367 3300050495 nmdc:mga04h51_8675_c1 nmdc:mga04h51_8675_c1_1165_2415 395
368 3300050509 nmdc:mga0qj67_109433_c1 nmdc:mga0qj67_109433_c1_691_1923 395
369 3300050509 nmdc:mga0qj67_759_c1 nmdc:mga0qj67_759_c1_13570_14778 395
370 3300050516 nmdc:mga0sz30_2466_c1 nmdc:mga0sz30_2466_c1_1265_2545 395
371 3300053087 Ga0500643_009535 Ga0500643_009535_1938_3179 395
372 3300053131 Ga0500652_000187 Ga0500652_000187_4443_5723 395
373 3300053139 Ga0500568_0000717 Ga0500568_0000717_9276_10514 395
374 iso_pu_bacteria 2511231119 2511701710 395
375 iso_pu_bacteria 2630968484 2631985627 395
376 iso_pu_bacteria 2643221549 2643766905 395
377 iso_pu_bacteria 2643221561 2643827112 395
378 iso_pu_bacteria 2643221566 2643847064 395
379 iso_pu_bacteria 2643221696 2644534465 395
380 iso_pu_bacteria 2648501850 2651531320 395
381 iso_pu_bacteria 2695420354 2695629678 395
382 iso_pu_bacteria 2716884898 2717914628 395
383 iso_pu_bacteria 2757320536 2758225672 395
384 iso_pu_bacteria 2773857758 2774379780 395
385 iso_pu_bacteria 2773857763 2774397874 395
386 iso_pu_bacteria 2808606306 2808629144 395
387 iso_pu_bacteria 2808606399 2809054116 395
388 iso_pu_bacteria 2816332295 2817478499 395
389 iso_pu_bacteria 2842134933 2842136741 395
390 iso_pu_bacteria 2860837431 2860841798 395
391 iso_pu_bacteria 2870782633 2870785019 395
392 iso_pu_bacteria 2877768649 2877772611 395
393 iso_pu_bacteria 2880169592 2880173457 395
394 iso_pu_bacteria 2897109615 2897113739 395
395 iso_pu_bacteria 2902792274 2902792939 395
396 iso_pu_bacteria 2904509784 2904512571 395
397 iso_pu_bacteria 2904560550 2904563336 395
398 iso_pu_bacteria 2908678064 2908679188 395
399 iso_pu_bacteria 2919069694 2919069830 395
400 iso_pu_bacteria 2919443155 2919444438 395
401 iso_pu_bacteria 2969136845 2969140933 395
402 iso_pu_bacteria 2969770375 2969770573 395
403 iso_pu_bacteria 2974294766 2974296003 395
404 iso_pu_bacteria 2974324384 2974327731 395
405 iso_pu_bacteria 2977228692 2977229389 395
406 iso_pu_bacteria 2977236895 2977238567 395
407 iso_pu_bacteria 2977264416 2977264589 395
408 iso_pu_bacteria 2980492589 2980496782 395
409 iso_pu_bacteria 2984542743 2984543651 395
410 iso_pu_bacteria 2990275345 2990276892 395
411 iso_pu_bacteria 3006858327 3006858821 395
412 iso_pu_bacteria 3006879489 3006883475 395
413 iso_pu_bacteria 3006973921 3006976438 395
414 iso_pu_bacteria 8022630665 8022632828 395
415 iso_pu_bacteria 8022653035 8022656617 395
416 iso_pu_bacteria 8045830549 8045833610 395
417 iso_pu_bacteria 8046352972 8046354826 395
418 iso_pu_bacteria 8051952484 8051953776 395
419 iso_pu_bacteria 8052174270 8052178024 395
420 3300002987 JGI25159J45721_1007547 JGI25159J45721_10075472 396
421 3300003187 JGI25151J46595_10000011 JGI25151J46595_10000011158 396
422 3300003187 JGI25151J46595_10004537 JGI25151J46595_100045371 396
423 3300003187 JGI25151J46595_10006351 JGI25151J46595_100063514 396
424 3300003187 JGI25151J46595_10014009 JGI25151J46595_100140092 396
425 3300003187 JGI25151J46595_10017178 JGI25151J46595_100171785 396
426 3300003578 Ga0006562J51391_1000095 Ga0006562J51391_10000956 396
427 3300003758 Ga0055532_1000024 Ga0055532_100002498 396
428 3300005295 Ga0065707_10128256 Ga0065707_101282561 396
429 3300005327 Ga0070658_10011701 Ga0070658_100117014 396
430 3300005458 Ga0070681_10130384 Ga0070681_101303842 396
431 3300005530 Ga0070679_100044651 Ga0070679_1000446512 396
432 3300005548 Ga0070665_100179842 Ga0070665_1001798422 396
433 3300005563 Ga0068855_100060699 Ga0068855_1000606993 396
434 3300005841 Ga0068863_100120243 Ga0068863_1001202432 396
435 3300006844 Ga0075428_100025039 Ga0075428_1000250393 396
436 3300009036 Ga0105244_10020287 Ga0105244_100202871 396
437 3300009092 Ga0105250_10005754 Ga0105250_100057543 396
438 3300011119 Ga0105246_10012025 Ga0105246_100120253 396
439 3300014325 Ga0163163_10072568 Ga0163163_100725683 396
440 3300025224 Ga0209784_100061 Ga0209784_100061171 396
441 3300025229 Ga0209147_100020 Ga0209147_100020265 396
442 3300025284 Ga0209130_1000311 Ga0209130_10003111 396
443 3300025284 Ga0209130_1006242 Ga0209130_10062423 396
444 3300025284 Ga0209130_1006505 Ga0209130_10065055 396
445 3300025291 Ga0209675_1012279 Ga0209675_10122793 396
446 3300025292 Ga0209676_1000274 Ga0209676_100027461 396
447 3300025292 Ga0209676_1000808 Ga0209676_100080834 396
448 3300025294 Ga0209025_1000011 Ga0209025_1000011682 396
449 3300025294 Ga0209025_1000043 Ga0209025_1000043187 396
450 3300025294 Ga0209025_1000209 Ga0209025_1000209116 396
451 3300025294 Ga0209025_1000851 Ga0209025_100085148 396
452 3300025294 Ga0209025_1001029 Ga0209025_10010292 396
453 3300025294 Ga0209025_1002458 Ga0209025_100245812 396
454 3300025294 Ga0209025_1003417 Ga0209025_10034174 396
455 3300025294 Ga0209025_1006279 Ga0209025_10062793 396
456 3300025294 Ga0209025_1006597 Ga0209025_10065977 396
457 3300025294 Ga0209025_1016765 Ga0209025_10167652 396
458 3300025294 Ga0209025_1024252 Ga0209025_10242524 396
459 3300025294 Ga0209025_1028312 Ga0209025_10283122 396
460 3300025711 Ga0207696_1005618 Ga0207696_100561810 396
461 3300025728 Ga0207655_1002232 Ga0207655_10022324 396
462 3300025909 Ga0207705_10022680 Ga0207705_100226804 396
463 3300025912 Ga0207707_10067445 Ga0207707_100674452 396
464 3300025919 Ga0207657_10209240 Ga0207657_102092402 396
465 3300025921 Ga0207652_10013343 Ga0207652_100133434 396
466 3300025921 Ga0207652_10065539 Ga0207652_100655393 396
467 3300025949 Ga0207667_10100355 Ga0207667_101003553 396
468 3300026116 Ga0207674_10037704 Ga0207674_100377045 396
469 3300028794 Ga0307515_10106730 Ga0307515_101067304 396
470 3300030083 Ga0237817_10012 Ga0237817_100124 396
471 3300030083 Ga0237817_10068 Ga0237817_1006839 396
472 3300030521 Ga0307511_10013821 Ga0307511_100138211 396
473 3300031456 Ga0307513_10067180 Ga0307513_100671805 396
474 3300031712 Ga0265342_10008744 Ga0265342_100087444 396
475 3300031727 Ga0316576_10029907 Ga0316576_100299071 396
476 3300031727 Ga0316576_10039988 Ga0316576_100399882 396
477 3300031824 Ga0307413_10090069 Ga0307413_100900691 396
478 3300033180 Ga0307510_10206167 Ga0307510_102061672 396
479 3300035083 Ga0373926_0052234 Ga0373926_0052234_119_1318 396
480 3300035116 Ga0373945_0047835 Ga0373945_0047835_303_1502 396
481 3300035695 Ga0373927_0000524 Ga0373927_0000524_8402_9601 396
482 3300035725 Ga0373947_0000741 Ga0373947_0000741_1585_2784 396
483 3300036712 Ga0316584_0001501 Ga0316584_0001501_10731_11948 396
484 3300037068 Ga0373925_0001648 Ga0373925_0001648_4762_5961 396
485 3300038705 Ga0237819_00064 Ga0237819_00064_28056_29246 396
486 3300038705 Ga0237819_00081 Ga0237819_00081_2886_4076 396
487 3300042014 Ga0439457_000045 Ga0439457_000045_5568_6794 396
488 3300044658 Ga0466972_0044668 Ga0466972_0044668_91_1371 396
489 3300044683 Ga0466965_0003174 Ga0466965_0003174_5035_6315 396
490 3300044901 Ga0466960_0002334 Ga0466960_0002334_2582_3862 396
491 3300045051 Ga0451576_0001881 Ga0451576_0001881_26279_27493 396
492 3300046459 Ga0495629_0019711 Ga0495629_0019711_541_1908 396
493 3300046535 Ga0495586_0089631 Ga0495586_0089631_424_1623 396
494 3300048905 Ga0496102_0103023 Ga0496102_0103023_466_1677 396
495 3300048906 Ga0496103_0101109 Ga0496103_0101109_400_1662 396
496 3300048909 Ga0496106_0142069 Ga0496106_0142069_220_1431 396
497 3300048911 Ga0496108_0090651 Ga0496108_0090651_848_2041 396
498 3300048913 Ga0496110_0015955 Ga0496110_0015955_4595_5788 396
499 3300048914 Ga0496111_0051230 Ga0496111_0051230_1214_2407 396
500 3300048915 Ga0496112_0064468 Ga0496112_0064468_1663_2865 396
501 3300048915 Ga0496112_0081905 Ga0496112_0081905_1778_2977 396
502 3300048916 Ga0496113_0013096 Ga0496113_0013096_2909_4111 396
503 3300049581 Ga0501047_0231489 Ga0501047_0231489_432_1655 396
504 3300049823 Ga0501044_0215489 Ga0501044_0215489_169_1371 396
505 3300053079 Ga0500610_0008396 Ga0500610_0008396_869_2134 396
506 3300053156 Ga0500622_0001496 Ga0500622_0001496_2401_3603 396
507 3300053156 Ga0500622_0002335 Ga0500622_0002335_1830_3032 396
508 iso_pu_bacteria 2540341094 2540608956 396
509 iso_pu_bacteria 2545555800 2545557550 396
510 iso_pu_bacteria 2576861599 2578931937 396
511 iso_pu_bacteria 2671180844 2674421333 396
512 iso_pu_bacteria 2808606375 2808918102 396
513 iso_pu_bacteria 2811994879 2812360594 396
514 iso_pu_bacteria 2837268691 2837274540 396
515 iso_pu_bacteria 2862290372 2862294647 396
516 iso_pu_bacteria 2867428634 2867432576 396
517 iso_pu_bacteria 2919414237 2919414250 396
518 iso_pu_bacteria 2939582691 2939586659 396
519 iso_pu_bacteria 2956897341 2956902459 396
520 iso_pu_bacteria 2962290636 2962295050 396
521 iso_pu_bacteria 2969141011 2969145186 396
522 iso_pu_bacteria 2969765954 2969766070 396
523 iso_pu_bacteria 2971893375 2971897313 396
524 iso_pu_bacteria 2984576629 2984579088 396
525 iso_pu_bacteria 2990256926 2990260018 396

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

82

463

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ruy-assembly1.cif.gz_B crystal structure of the ornithine-oxo acid transaminase rocd from bacillus anthracis 0.9877 6 396
7lk1-assembly1.cif.gz_A ornithine aminotransferase (oat) with its potent inhibitor - (s)-3-amino-4,4-difluorocyclopent-1-enecarboxylic acid (ss-1-148) - 1 hour soaking 0.9847 1 395
2byj-assembly2.cif.gz_C-2 ornithine aminotransferase mutant y85i 0.9847 1 395
2byl-assembly2.cif.gz_C-2 structure of ornithine aminotransferase triple mutant y85i y55a g320f 0.9838 2 395
3ruy-assembly1.cif.gz_B crystal structure of the ornithine-oxo acid transaminase rocd from bacillus anthracis 0.9827 6 396
ID Description Score Start End Superfamily
af_Q2G1H3_305_391_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9904 310 393 3.90.1150.10
af_Q54JP5_319_410_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9793 308 393 3.90.1150.10
af_Q18040_325_412_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9721 308 391 3.90.1150.10
3ruyB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9717 6 396 3.90.1150.10
af_Q6LFH8_318_406_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9702 312 393 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A4P6URK6-F1-model_v4 Ornithine aminotransferase (OAT) (EC 2.6.1.13) (Ornithine--oxo-acid aminotransferase) 0.9912 1 396 GO:0004587
GO:0005737
GO:0030170
GO:0042802
GO:0055129
AF-A0A4P6URK6-F1-model_v4 Ornithine aminotransferase (OAT) (EC 2.6.1.13) (Ornithine--oxo-acid aminotransferase) 0.9887 1 396 GO:0004587
GO:0005737
GO:0030170
GO:0042802
GO:0055129
AF-G8NSV4-F1-model_v4 ornithine aminotransferase (EC 2.6.1.13) (Ornithine--oxo-acid aminotransferase) 0.9883 4 395 GO:0004587
GO:0030170
GO:0042802
GO:0055129
AF-A0A2A5K0P4-F1-model_v4 deleted 0.9872 46 395
AF-A0A4U3BUA0-F1-model_v4 deleted 0.9872 1 259

Feature Viewer

pLDDT pTM Quality
93.85 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map