F459297

General Info

Members Datasets Scaffolds Average Seq Length
525 309 1050 89

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0049883|Ga0373955_0049883_1076_1357
Length 81
Sequence MAHKKAGGSSRNGRDSNPKMLGVKLFGGEAVAGGNIIVRGMGKDHSLFAVTDGQVSFRQGFKRRTYVSVTNATNPAKRAAE

Samples

Sample ID Description Type Environment
1 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
148 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
155 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
156 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
175 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
183 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
184 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
214 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
215 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
216 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
217 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
218 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
219 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
220 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
221 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
285 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
286 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
287 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
288 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
289 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
290 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
291 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
292 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
293 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
294 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
295 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
296 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
297 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
298 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
299 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
300 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
302 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
303 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
304 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
307 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
308 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
309 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.95
Metatranscriptomes 2.29
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.1
Nodule 0.19
Rhizoplane 2.1
Rhizosphere 76.76
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373955_0049883 3300035172 Bacteria 2274
2 Ga0058863_11824160 3300004799 Bacteria 765
3 Ga0058862_10066198 3300004803 Bacteria 721
4 Ga0070658_10280011 3300005327 Bacteria 1419
5 Ga0070676_10100395 3300005328 Bacteria 1787
6 Ga0070683_100703579 3300005329 Bacteria 968
7 Ga0070690_100548126 3300005330 Bacteria 872
8 Ga0070670_100633093 3300005331 Bacteria 959
9 Ga0070670_100846205 3300005331 Bacteria 828
10 Ga0070677_10200988 3300005333 Bacteria 962
11 Ga0068869_100573145 3300005334 Bacteria 951
12 Ga0070680_100031202 3300005336 Bacteria 4284
13 Ga0070680_101972505 3300005336 Bacteria 506
14 Ga0070682_101098304 3300005337 Bacteria 666
15 Ga0070660_100391882 3300005339 Bacteria 1147
16 Ga0070689_100188705 3300005340 Bacteria 1677
17 Ga0070691_10173148 3300005341 Bacteria 1119
18 Ga0070692_10491311 3300005345 Bacteria 794
19 Ga0070668_101008235 3300005347 Bacteria 748
20 Ga0070669_100310126 3300005353 Bacteria 1272
21 Ga0070675_100150470 3300005354 Bacteria 1995
22 Ga0070675_100948017 3300005354 Bacteria 789
23 Ga0070688_100106570 3300005365 Bacteria 1856
24 Ga0070659_100510728 3300005366 Bacteria 1025
25 Ga0070667_100543350 3300005367 Bacteria 1067
26 Ga0070714_100648553 3300005435 Bacteria 1016
27 Ga0070700_100902423 3300005441 Bacteria 720
28 Ga0070708_100033521 3300005445 Bacteria 4462
29 Ga0070678_101189379 3300005456 Bacteria 707
30 Ga0070678_101432066 3300005456 Bacteria 646
31 Ga0070678_101897202 3300005456 Bacteria 563
32 Ga0070681_10130665 3300005458 Bacteria 2443
33 Ga0070681_10288183 3300005458 Bacteria 1552
34 Ga0070685_10467260 3300005466 Bacteria 887
35 Ga0070706_100495805 3300005467 Bacteria 1136
36 Ga0070706_101032625 3300005467 Bacteria 758
37 Ga0070707_100531793 3300005468 Bacteria 1138
38 Ga0070707_101289630 3300005468 Bacteria 697
39 Ga0070698_100005737 3300005471 Bacteria 13573
40 Ga0070698_100700729 3300005471 Bacteria 955
41 Ga0070699_100506012 3300005518 Bacteria 1097
42 Ga0070699_101335635 3300005518 Bacteria 657
43 Ga0070679_100180350 3300005530 Bacteria 2084
44 Ga0070679_100821241 3300005530 Bacteria 873
45 Ga0070679_101401772 3300005530 Bacteria 645
46 Ga0070697_100499344 3300005536 Bacteria 1064
47 Ga0070697_101078444 3300005536 Bacteria 715
48 Ga0070672_100448033 3300005543 Bacteria 1111
49 Ga0070686_101475011 3300005544 Bacteria 573
50 Ga0070695_100514729 3300005545 Bacteria 927
51 Ga0070693_100697872 3300005547 Bacteria 743
52 Ga0070665_100031937 3300005548 Bacteria 5300
53 Ga0070665_100061484 3300005548 Bacteria 3765
54 Ga0070665_100826560 3300005548 Bacteria 939
55 Ga0070665_101308686 3300005548 Bacteria 734
56 Ga0068855_100056737 3300005563 Bacteria 4593
57 Ga0068855_100935916 3300005563 Bacteria 914
58 Ga0068855_101214449 3300005563 Bacteria 783
59 Ga0068857_100179492 3300005577 Bacteria 1927
60 Ga0068857_101488216 3300005577 Bacteria 659
61 Ga0068854_100427368 3300005578 Bacteria 1102
62 Ga0068854_100993433 3300005578 Bacteria 743
63 Ga0068856_100239808 3300005614 Bacteria 1828
64 Ga0068856_100692424 3300005614 Bacteria 1039
65 Ga0068856_100843372 3300005614 Bacteria 936
66 Ga0068856_101775479 3300005614 Bacteria 629
67 Ga0068856_102409139 3300005614 Bacteria 534
68 Ga0068861_100637840 3300005719 Bacteria 982
69 Ga0068861_101142179 3300005719 Bacteria 750
70 Ga0068870_10863489 3300005840 Bacteria 637
71 Ga0068863_101267393 3300005841 Bacteria 744
72 Ga0068862_100357955 3300005844 Bacteria 1355
73 Ga0068862_100695468 3300005844 Bacteria 984
74 Ga0068862_101754275 3300005844 Bacteria 629
75 Ga0081455_10006200 3300005937 Bacteria 12891
76 Ga0081455_10018711 3300005937 Bacteria 6576
77 Ga0081455_10227891 3300005937 Bacteria 1377
78 Ga0081538_10041139 3300005981 Bacteria 2937
79 Ga0081540_1032464 3300005983 Bacteria 2851
80 Ga0075365_10180398 3300006038 Bacteria 1476
81 Ga0075365_10491112 3300006038 Bacteria 867
82 Ga0075365_10787028 3300006038 Bacteria 671
83 Ga0075365_10841305 3300006038 Bacteria 647
84 Ga0075365_10885668 3300006038 Bacteria 629
85 Ga0075365_10917367 3300006038 Bacteria 617
86 Ga0075368_10119687 3300006042 Bacteria 1090
87 Ga0075368_10127861 3300006042 Bacteria 1055
88 Ga0075368_10237645 3300006042 Bacteria 776
89 Ga0075368_10543431 3300006042 Bacteria 522
90 Ga0075363_100177304 3300006048 Bacteria 1211
91 Ga0075363_100481189 3300006048 Bacteria 736
92 Ga0075363_100551018 3300006048 Bacteria 688
93 Ga0075364_11144591 3300006051 Bacteria 528
94 Ga0070712_100155676 3300006175 Bacteria 1760
95 Ga0075362_10039686 3300006177 Bacteria 2070
96 Ga0075362_10052747 3300006177 Bacteria 1823
97 Ga0075362_10071272 3300006177 Bacteria 1587
98 Ga0075362_10087287 3300006177 Bacteria 1444
99 Ga0075362_10276147 3300006177 Bacteria 830
100 Ga0075367_10207009 3300006178 Bacteria 1226
101 Ga0075367_10327579 3300006178 Bacteria 965
102 Ga0075367_10425671 3300006178 Bacteria 841
103 Ga0075369_10040483 3300006186 Bacteria 1992
104 Ga0075369_10341938 3300006186 Bacteria 701
105 Ga0075369_10417156 3300006186 Bacteria 634
106 Ga0075366_10001070 3300006195 Bacteria 13448
107 Ga0075366_10017552 3300006195 Bacteria 4119
108 Ga0075366_10309124 3300006195 Bacteria 967
109 Ga0075366_10871299 3300006195 Bacteria 561
110 Ga0075370_10071685 3300006353 Bacteria 1982
111 Ga0075370_10091572 3300006353 Bacteria 1754
112 Ga0075370_10311780 3300006353 Bacteria 936
113 Ga0075428_100499485 3300006844 Bacteria 1302
114 Ga0075428_102005863 3300006844 Bacteria 600
115 Ga0075430_100465615 3300006846 Bacteria 1043
116 Ga0075430_101445399 3300006846 Bacteria 565
117 Ga0075431_100870493 3300006847 Bacteria 871
118 Ga0075433_11186649 3300006852 Bacteria 663
119 Ga0075433_11549483 3300006852 Bacteria 572
120 Ga0075436_100406068 3300006914 Bacteria 987
121 Ga0105240_10001848 3300009093 Bacteria 35437
122 Ga0105240_10125540 3300009093 Bacteria 3084
123 Ga0105240_10542705 3300009093 Bacteria 1287
124 Ga0105240_10760763 3300009093 Bacteria 1052
125 Ga0105240_11472875 3300009093 Bacteria 714
126 Ga0111539_10380590 3300009094 Bacteria 1643
127 Ga0111539_10875662 3300009094 Bacteria 1045
128 Ga0111539_11860790 3300009094 Bacteria 698
129 Ga0111539_12024580 3300009094 Bacteria 668
130 Ga0105245_10003180 3300009098 Bacteria 14678
131 Ga0105245_12724418 3300009098 Bacteria 547
132 Ga0105245_12959387 3300009098 Bacteria 526
133 Ga0114129_10024238 3300009147 Bacteria 8598
134 Ga0114129_10697971 3300009147 Bacteria 1304
135 Ga0105243_10497057 3300009148 Bacteria 1155
136 Ga0105242_10856606 3300009176 Bacteria 905
137 Ga0105242_11460129 3300009176 Bacteria 713
138 Ga0105237_10002073 3300009545 Bacteria 25405
139 Ga0105237_12529862 3300009545 Bacteria 524
140 Ga0105238_10265887 3300009551 Bacteria 1695
141 Ga0105238_12987666 3300009551 Bacteria 508
142 Ga0105249_13450215 3300009553 Bacteria 509
143 Ga0105239_10027686 3300010375 Bacteria 6236
144 Ga0105239_11154221 3300010375 Bacteria 892
145 Ga0105239_11824432 3300010375 Bacteria 705
146 Ga0157371_10563889 3300013102 Bacteria 845
147 Ga0157370_10027260 3300013104 Bacteria 5634
148 Ga0157374_12925780 3300013296 Bacteria 505
149 Ga0157378_11161288 3300013297 Bacteria 811
150 Ga0163162_11164855 3300013306 Bacteria 874
151 Ga0157375_13432915 3300013308 Bacteria 528
152 Ga0163163_11562720 3300014325 Bacteria 721
153 Ga0157380_10975514 3300014326 Bacteria 879
154 Ga0182008_10445924 3300014497 Bacteria 703
155 Ga0157377_10655707 3300014745 Bacteria 756
156 Ga0157379_11200703 3300014968 Bacteria 730
157 Ga0157379_12370672 3300014968 Bacteria 529
158 Ga0157376_11038136 3300014969 Bacteria 843
159 Ga0157376_11598693 3300014969 Bacteria 686
160 Ga0163161_10317625 3300017792 Bacteria 1230
161 Ga0197907_10887070 3300020069 Bacteria 2017
162 Ga0206354_10314303 3300020081 Bacteria 614
163 Ga0206353_11763184 3300020082 Bacteria 732
164 Ga0213876_10220215 3300021384 Bacteria 1009
165 Ga0207697_10495339 3300025315 Bacteria 540
166 Ga0207656_10186423 3300025321 Bacteria 998
167 Ga0207682_10153601 3300025893 Bacteria 1039
168 Ga0207682_10164970 3300025893 Bacteria 1006
169 Ga0207642_10275117 3300025899 Bacteria 966
170 Ga0207710_10412950 3300025900 Bacteria 694
171 Ga0207688_10418234 3300025901 Bacteria 833
172 Ga0207699_10231370 3300025906 Bacteria 1266
173 Ga0207645_10977351 3300025907 Bacteria 574
174 Ga0207643_10202039 3300025908 Bacteria 1210
175 Ga0207643_10364268 3300025908 Bacteria 909
176 Ga0207705_10011573 3300025909 Bacteria 6378
177 Ga0207705_10324369 3300025909 Bacteria 1184
178 Ga0207684_10195232 3300025910 Bacteria 1746
179 Ga0207684_10248730 3300025910 Bacteria 1534
180 Ga0207707_10017395 3300025912 Bacteria 6268
181 Ga0207695_10000288 3300025913 Bacteria 125085
182 Ga0207695_10231516 3300025913 Bacteria 1752
183 Ga0207695_10466048 3300025913 Bacteria 1146
184 Ga0207671_10001439 3300025914 Bacteria 27570
185 Ga0207693_10370483 3300025915 Bacteria 1120
186 Ga0207660_10018406 3300025917 Bacteria 4656
187 Ga0207660_11352603 3300025917 Bacteria 578
188 Ga0207662_10200904 3300025918 Bacteria 1290
189 Ga0207657_10044752 3300025919 Bacteria 3890
190 Ga0207649_11436059 3300025920 Bacteria 546
191 Ga0207652_10737916 3300025921 Bacteria 877
192 Ga0207652_11306796 3300025921 Bacteria 628
193 Ga0207652_11732850 3300025921 Bacteria 529
194 Ga0207646_11321609 3300025922 Bacteria 629
195 Ga0207681_10254497 3300025923 Bacteria 1372
196 Ga0207694_10391583 3300025924 Bacteria 1155
197 Ga0207694_10731416 3300025924 Bacteria 835
198 Ga0207694_10825059 3300025924 Bacteria 783
199 Ga0207694_11404600 3300025924 Bacteria 590
200 Ga0207659_10090234 3300025926 Bacteria 2287
201 Ga0207659_10878259 3300025926 Bacteria 771
202 Ga0207687_10009450 3300025927 Bacteria 6378
203 Ga0207687_10835543 3300025927 Bacteria 786
204 Ga0207700_10036777 3300025928 Bacteria 3540
205 Ga0207664_10492288 3300025929 Bacteria 1097
206 Ga0207690_10406546 3300025932 Bacteria 1086
207 Ga0207709_10322801 3300025935 Bacteria 1156
208 Ga0207670_10578773 3300025936 Bacteria 920
209 Ga0207670_11650468 3300025936 Bacteria 545
210 Ga0207669_11002129 3300025937 Bacteria 702
211 Ga0207704_11677021 3300025938 Bacteria 546
212 Ga0207665_11063542 3300025939 Bacteria 645
213 Ga0207665_11401770 3300025939 Bacteria 556
214 Ga0207691_10255323 3300025940 Bacteria 1512
215 Ga0207691_10873167 3300025940 Bacteria 754
216 Ga0207691_10939995 3300025940 Bacteria 723
217 Ga0207691_11042676 3300025940 Bacteria 682
218 Ga0207689_10221265 3300025942 Bacteria 1564
219 Ga0207661_10339107 3300025944 Bacteria 1354
220 Ga0207667_10485246 3300025949 Bacteria 1254
221 Ga0207651_10350571 3300025960 Bacteria 1243
222 Ga0207712_11146994 3300025961 Bacteria 693
223 Ga0207668_10444465 3300025972 Bacteria 1105
224 Ga0207668_10482402 3300025972 Bacteria 1064
225 Ga0207668_10971201 3300025972 Bacteria 758
226 Ga0207640_10005910 3300025981 Bacteria 6681
227 Ga0207640_10976902 3300025981 Bacteria 744
228 Ga0207658_10896115 3300025986 Bacteria 808
229 Ga0207658_11180158 3300025986 Bacteria 700
230 Ga0207678_10480054 3300026067 Bacteria 1082
231 Ga0207678_10555451 3300026067 Bacteria 1004
232 Ga0207702_10519654 3300026078 Bacteria 1162
233 Ga0207702_10575028 3300026078 Bacteria 1104
234 Ga0207702_12207043 3300026078 Bacteria 539
235 Ga0207648_10647170 3300026089 Bacteria 977
236 Ga0207676_11915880 3300026095 Bacteria 591
237 Ga0207674_10363522 3300026116 Bacteria 1399
238 Ga0207675_100485883 3300026118 Bacteria 1228
239 Ga0207683_10640042 3300026121 Bacteria 985
240 Ga0207683_11130608 3300026121 Bacteria 726
241 Ga0207683_11258655 3300026121 Bacteria 685
242 Ga0209998_10209169 3300027717 Bacteria 511
243 Ga0209813_10164694 3300027866 Bacteria 802
244 Ga0209813_10359938 3300027866 Bacteria 578
245 Ga0209813_10428668 3300027866 Bacteria 537
246 Ga0268266_10027748 3300028379 Bacteria 4813
247 Ga0268266_10898374 3300028379 Bacteria 856
248 Ga0268266_10913646 3300028379 Bacteria 849
249 Ga0268265_10213269 3300028380 Bacteria 1684
250 Ga0268265_10224001 3300028380 Bacteria 1648
251 Ga0268264_12672248 3300028381 Bacteria 503
252 Ga0265326_10085783 3300028558 Bacteria 891
253 Ga0265319_1132843 3300028563 Bacteria 774
254 Ga0265334_10000015 3300028573 Bacteria 150318
255 Ga0265334_10133623 3300028573 Bacteria 882
256 Ga0265334_10343520 3300028573 Bacteria 510
257 Ga0265318_10003625 3300028577 Bacteria 7710
258 Ga0265336_10218216 3300028666 Bacteria 566
259 Ga0307517_10329608 3300028786 Bacteria 840
260 Ga0265338_10045043 3300028800 Bacteria 4062
261 Ga0265338_10578405 3300028800 Bacteria 784
262 Ga0310981_1098459 3300029285 Bacteria 679
263 Ga0265324_10071196 3300029957 Bacteria 1185
264 Ga0265776_105880 3300030880 Bacteria 654
265 Ga0265768_115829 3300030963 Bacteria 525
266 Ga0265330_10016351 3300031235 Bacteria 3424
267 Ga0265330_10247853 3300031235 Bacteria 750
268 Ga0265332_10043521 3300031238 Bacteria 1939
269 Ga0265332_10187239 3300031238 Bacteria 862
270 Ga0265332_10252969 3300031238 Bacteria 729
271 Ga0265332_10299676 3300031238 Bacteria 664
272 Ga0265332_10321255 3300031238 Bacteria 639
273 Ga0265328_10002063 3300031239 Bacteria 9070
274 Ga0265328_10164697 3300031239 Bacteria 837
275 Ga0265328_10167750 3300031239 Bacteria 829
276 Ga0265320_10000039 3300031240 Bacteria 134478
277 Ga0265320_10212438 3300031240 Bacteria 863
278 Ga0265320_10363876 3300031240 Bacteria 639
279 Ga0265325_10049564 3300031241 Bacteria 2166
280 Ga0265325_10060004 3300031241 Bacteria 1934
281 Ga0265325_10131945 3300031241 Bacteria 1195
282 Ga0265325_10216227 3300031241 Bacteria 878
283 Ga0265325_10301955 3300031241 Bacteria 714
284 Ga0265325_10303348 3300031241 Bacteria 712
285 Ga0265325_10405890 3300031241 Bacteria 597
286 Ga0265329_10128320 3300031242 Bacteria 816
287 Ga0265340_10042165 3300031247 Bacteria 2241
288 Ga0265340_10090383 3300031247 Bacteria 1432
289 Ga0265339_10082137 3300031249 Bacteria 1701
290 Ga0265339_10238451 3300031249 Bacteria 884
291 Ga0265331_10032871 3300031250 Bacteria 2567
292 Ga0265331_10090354 3300031250 Bacteria 1416
293 Ga0265331_10268182 3300031250 Bacteria 765
294 Ga0265327_10017925 3300031251 Bacteria 4415
295 Ga0265316_10238197 3300031344 Bacteria 1338
296 Ga0265316_10770462 3300031344 Bacteria 676
297 Ga0265316_11156483 3300031344 Bacteria 536
298 Ga0307408_101404445 3300031548 Bacteria 657
299 Ga0265313_10000882 3300031595 Bacteria 30325
300 Ga0265313_10003138 3300031595 Bacteria 13641
301 Ga0265313_10007299 3300031595 Bacteria 7588
302 Ga0265313_10392382 3300031595 Bacteria 545
303 Ga0265314_10003840 3300031711 Bacteria 14341
304 Ga0265314_10035673 3300031711 Bacteria 3624
305 Ga0265314_10072609 3300031711 Bacteria 2298
306 Ga0265314_10077199 3300031711 Bacteria 2210
307 Ga0265314_10408749 3300031711 Bacteria 732
308 Ga0265342_10027858 3300031712 Bacteria 3524
309 Ga0265342_10161518 3300031712 Bacteria 1238
310 Ga0316576_10028797 3300031727 Bacteria 3919
311 Ga0316576_11183743 3300031727 Bacteria 540
312 Ga0316578_10022170 3300031728 Bacteria 3536
313 Ga0316578_10434695 3300031728 Bacteria 776
314 Ga0316577_10197123 3300031733 Bacteria 1138
315 Ga0307413_10780522 3300031824 Bacteria 801
316 Ga0307406_11383678 3300031901 Bacteria 616
317 Ga0307412_10196510 3300031911 Bacteria 1529
318 Ga0307416_100638502 3300032002 Bacteria 1148
319 Ga0307411_11506335 3300032005 Bacteria 618
320 Ga0307415_100421282 3300032126 Bacteria 1146
321 Ga0316585_10066251 3300032137 Bacteria 1170
322 Ga0316580_10004258 3300032139 Bacteria 4138
323 Ga0316593_10019017 3300032168 Bacteria 2118
324 Ga0316593_10069119 3300032168 Bacteria 1219
325 Ga0316593_10172832 3300032168 Bacteria 792
326 Ga0316596_1070962 3300033541 Bacteria 932
327 Ga0373950_0065995 3300034818 Bacteria 734
328 Ga0373929_0069172 3300035085 Bacteria 841
329 Ga0373951_0217588 3300035091 Bacteria 563
330 Ga0373923_0482045 3300035111 Bacteria 604
331 Ga0373936_0060028 3300035113 Bacteria 1551
332 Ga0373936_0115481 3300035113 Bacteria 1143
333 Ga0373939_0161392 3300035114 Bacteria 823
334 Ga0373941_0070831 3300035115 Bacteria 1157
335 Ga0373954_0348398 3300035118 Bacteria 731
336 Ga0373961_0133292 3300035241 Bacteria 834
337 Ga0316574_0292574 3300035398 Unclassified 1036
338 Ga0316574_0443381 3300035398 Bacteria 814
339 Ga0316574_0905499 3300035398 Unclassified 534
340 Ga0373931_0362384 3300035691 Bacteria 910
341 Ga0373935_0164343 3300035692 Bacteria 1515
342 Ga0373935_0743631 3300035692 Bacteria 722
343 Ga0373935_0990576 3300035692 Bacteria 624
344 Ga0373933_0138201 3300035724 Bacteria 1537
345 Ga0373937_0059384 3300036401 Bacteria 3515
346 Ga0373937_0818286 3300036401 Bacteria 879
347 Ga0373937_1454192 3300036401 Bacteria 633
348 Ga0316582_0017797 3300036647 Bacteria 4120
349 Ga0316584_0012231 3300036712 Bacteria 6050
350 Ga0373925_0212879 3300037068 Bacteria 1540
351 Ga0395899_0949716 3300037312 Bacteria 521
352 Ga0395900_0069725 3300037418 Bacteria 3614
353 Ga0395900_0126614 3300037418 Bacteria 2620
354 Ga0395898_0153594 3300037466 Bacteria 2202
355 Ga0395898_1807083 3300037466 Bacteria 532
356 Ga0395901_0010038 3300038443 Bacteria 9601
357 Ga0395901_0542431 3300038443 Bacteria 1179
358 Ga0395901_1507513 3300038443 Bacteria 628
359 Ga0395901_2026035 3300038443 Bacteria 521
360 Ga0436365_0739093 3300039437 Bacteria 1823
361 Ga0436360_0048417 3300039438 Bacteria 2445
362 Ga0436360_0910276 3300039438 Bacteria 1491
363 Ga0436360_0922437 3300039438 Bacteria 650
364 Ga0436361_0698733 3300039447 Bacteria 1986
365 Ga0436363_0625407 3300039450 Bacteria 550
366 Ga0436362_0478547 3300039453 Bacteria 648
367 Ga0439465_0322999 3300041413 Bacteria 580
368 Ga0451800_0939856 3300041459 Bacteria 1184
369 Ga0451802_0695966 3300041460 Bacteria 720
370 Ga0451804_0671897 3300041463 Bacteria 545
371 Ga0451849_1262468 3300041505 Bacteria 771
372 Ga0439437_025399 3300042000 Bacteria 730
373 Ga0439442_032406 3300042002 Bacteria 1092
374 Ga0439445_0113339 3300042004 Bacteria 775
375 Ga0439432_058751 3300042006 Bacteria 1189
376 Ga0439464_0041322 3300042439 Bacteria 1315
377 Ga0466964_0053844 3300044706 Bacteria 1657
378 Ga0466957_0059247 3300044842 Bacteria 2347
379 Ga0466958_0851854 3300045836 Bacteria 595
380 Ga0466967_0009010 3300045976 Bacteria 7374
381 Ga0495629_0848905 3300046459 Bacteria 601
382 Ga0495638_0627866 3300046460 Bacteria 525
383 Ga0495650_0140743 3300046471 Bacteria 873
384 Ga0495650_0195614 3300046471 Bacteria 705
385 Ga0495584_0475933 3300046491 Bacteria 636
386 Ga0495652_0260946 3300046529 Bacteria 1279
387 Ga0495654_0195694 3300046530 Bacteria 868
388 Ga0495647_0070997 3300046681 Bacteria 1394
389 Ga0495685_244577 3300047447 Bacteria 570
390 Ga0495684_0558012 3300047471 Bacteria 779
391 Ga0496101_0944742 3300048904 Bacteria 678
392 Ga0496102_0828080 3300048905 Bacteria 848
393 Ga0496106_0521630 3300048909 Bacteria 954
394 Ga0496107_0436152 3300048910 Bacteria 974
395 Ga0496108_1495476 3300048911 Bacteria 562
396 Ga0496112_0842429 3300048915 Bacteria 841
397 Ga0496112_1876989 3300048915 Bacteria 511
398 Ga0496113_1141010 3300048916 Bacteria 610
399 Ga0496117_0012763 3300048920 Bacteria 7371
400 Ga0496117_0216255 3300048920 Bacteria 1070
401 Ga0496118_0007285 3300048921 Bacteria 11778
402 Ga0496118_0085819 3300048921 Bacteria 2190
403 Ga0496121_0001839 3300048924 Bacteria 34202
404 Ga0496126_0004475 3300048929 Bacteria 16682
405 Ga0496126_0036957 3300048929 Bacteria 4562
406 Ga0496126_0115751 3300048929 Bacteria 2331
407 Ga0501031_0426351 3300049568 Bacteria 857
408 Ga0501032_0222802 3300049569 Bacteria 1227
409 Ga0501033_0027445 3300049570 Bacteria 4280
410 Ga0501033_0226028 3300049570 Bacteria 1331
411 Ga0501033_0678226 3300049570 Bacteria 702
412 Ga0501033_0875350 3300049570 Bacteria 605
413 Ga0501034_0696655 3300049571 Bacteria 915
414 Ga0501034_1274540 3300049571 Bacteria 612
415 Ga0501037_0316656 3300049573 Bacteria 1081
416 Ga0501037_0601863 3300049573 Bacteria 738
417 Ga0501038_1221839 3300049574 Bacteria 545
418 Ga0501042_0387177 3300049578 Bacteria 1013
419 Ga0501043_0176160 3300049579 Bacteria 1667
420 Ga0501043_0291549 3300049579 Bacteria 1249
421 Ga0501043_0380059 3300049579 Bacteria 1069
422 Ga0501046_0012497 3300049580 Bacteria 7226
423 Ga0501046_0947566 3300049580 Bacteria 599
424 Ga0501047_0010038 3300049581 Bacteria 8952
425 Ga0501047_0095340 3300049581 Bacteria 2854
426 Ga0501047_0436728 3300049581 Bacteria 1139
427 Ga0501047_1302186 3300049581 Bacteria 541
428 Ga0501067_0267959 3300049583 Bacteria 951
429 Ga0501067_0359595 3300049583 Bacteria 812
430 Ga0501067_0498612 3300049583 Bacteria 681
431 Ga0501069_0354202 3300049585 Bacteria 865
432 Ga0501070_1285546 3300049586 Bacteria 559
433 Ga0501072_0366211 3300049588 Bacteria 1144
434 Ga0501072_1239409 3300049588 Bacteria 579
435 Ga0501072_1378293 3300049588 Bacteria 546
436 Ga0501074_1170039 3300049590 Bacteria 540
437 Ga0501076_0106262 3300049592 Bacteria 2266
438 Ga0501076_0204285 3300049592 Bacteria 1614
439 Ga0501076_0470989 3300049592 Bacteria 1035
440 Ga0501080_0592481 3300049742 Bacteria 985
441 Ga0501081_0743849 3300049743 Bacteria 737
442 Ga0501083_0046596 3300049744 Bacteria 2931
443 Ga0501083_0258939 3300049744 Bacteria 1132
444 Ga0501035_0035997 3300049822 Bacteria 4489
445 Ga0501035_0220593 3300049822 Bacteria 1619
446 Ga0501035_0955960 3300049822 Bacteria 676
447 Ga0501044_0004434 3300049823 Bacteria 15704
448 Ga0501044_0091539 3300049823 Bacteria 3068
449 Ga0501044_0485876 3300049823 Bacteria 1137
450 Ga0501044_0569804 3300049823 Bacteria 1028
451 Ga0501044_1608012 3300049823 Bacteria 515
452 nmdc:mga03683_19621_c2 3300050489 Bacteria 1205
453 nmdc:mga03683_26032_c1 3300050489 Bacteria 2304
454 nmdc:mga03683_48368_c1 3300050489 Bacteria 1767
455 nmdc:mga03683_64768_c1 3300050489 Bacteria 1552
456 nmdc:mga03n38_131693_c1 3300050490 Bacteria 1240
457 nmdc:mga03n38_609381_c1 3300050490 Bacteria 623
458 nmdc:mga03n38_637655_c1 3300050490 Bacteria 610
459 nmdc:mga00v17_444540_c1 3300050491 Bacteria 842
460 nmdc:mga00v17_921301_c1 3300050491 Bacteria 553
461 nmdc:mga0yw44_137182_c1 3300050492 Bacteria 1588
462 nmdc:mga0yw44_66984_c2 3300050492 Bacteria 1549
463 nmdc:mga0k408_237176_c1 3300050493 Bacteria 1089
464 nmdc:mga0k408_72498_c1 3300050493 Bacteria 2011
465 nmdc:mga06z11_212298_c1 3300050494 Bacteria 1128
466 nmdc:mga06z11_605495_c1 3300050494 Bacteria 666
467 nmdc:mga06z11_80662_c1 3300050494 Bacteria 1745
468 nmdc:mga06z11_94044_c1 3300050494 Bacteria 1633
469 nmdc:mga04h51_191145_c1 3300050495 Bacteria 801
470 nmdc:mga04h51_466749_c1 3300050495 Bacteria 536
471 nmdc:mga07m45_323790_c1 3300050496 Bacteria 896
472 nmdc:mga07m45_473482_c1 3300050496 Bacteria 726
473 nmdc:mga07m45_579837_c1 3300050496 Bacteria 648
474 nmdc:mga07m45_661223_c1 3300050496 Bacteria 602
475 nmdc:mga05p37_258890_c1 3300050507 Bacteria 2083
476 nmdc:mga0qj67_406108_c1 3300050509 Bacteria 1099
477 nmdc:mga06r32_1127168_c1 3300050510 Bacteria 733
478 nmdc:mga08y16_1165105_c1 3300050511 Bacteria 743
479 nmdc:mga0rr50_184382_c1 3300050513 Bacteria 1707
480 nmdc:mga08x19_442776_c1 3300050514 Bacteria 914
481 nmdc:mga08x19_503282_c1 3300050514 Bacteria 855
482 nmdc:mga0a205_1227542_c1 3300050515 Bacteria 597
483 nmdc:mga0sz30_1761_c1 3300050516 Bacteria 7684
484 nmdc:mga0sz30_191855_c1 3300050516 Bacteria 907
485 nmdc:mga0sz30_243878_c1 3300050516 Bacteria 800
486 Ga0495601_0488584 3300053077 Bacteria 795
487 Ga0500643_018671 3300053087 Bacteria 2297
488 Ga0500644_0001590 3300053088 Bacteria 5944
489 Ga0500644_0212305 3300053088 Bacteria 804
490 Ga0500644_0305110 3300053088 Bacteria 682
491 Ga0500646_0413373 3300053090 Bacteria 500
492 Ga0500651_0023030 3300053093 Bacteria 3897
493 Ga0500651_0101566 3300053093 Bacteria 1763
494 Ga0500651_0785841 3300053093 Bacteria 503
495 Ga0500641_0022118 3300053096 Bacteria 2431
496 Ga0500650_0409343 3300053098 Bacteria 586
497 Ga0500557_265713 3300053105 Bacteria 532
498 Ga0500595_000001 3300053119 Bacteria 1088438
499 Ga0500595_001807 3300053119 Bacteria 11096
500 Ga0500595_073797 3300053119 Bacteria 1008
501 Ga0500597_228487 3300053120 Bacteria 770
502 Ga0500614_019885 3300053123 Bacteria 1544
503 Ga0500642_0056591 3300053130 Bacteria 1748
504 Ga0500642_0134035 3300053130 Bacteria 1161
505 Ga0500652_000938 3300053131 Bacteria 9643
506 Ga0500655_008265 3300053133 Bacteria 1873
507 Ga0500655_129626 3300053133 Bacteria 538
508 Ga0500568_0373557 3300053139 Bacteria 517
509 Ga0500573_0091948 3300053140 Bacteria 1713
510 Ga0500573_0402388 3300053140 Bacteria 648
511 Ga0500577_0122310 3300053142 Bacteria 1084
512 Ga0500577_0265652 3300053142 Bacteria 747
513 Ga0500603_172476 3300053150 Bacteria 678
514 Ga0500616_0000001 3300053153 Bacteria 1986011
515 Ga0500616_0001083 3300053153 Bacteria 28382
516 Ga0500620_168115 3300053155 Bacteria 759
517 Ga0500645_002376 3300053730 Bacteria 8468
518 Ga0500645_161976 3300053730 Bacteria 613
519 Ga0500552_012537 3300053733 Bacteria 1085
520 Ga0500552_051086 3300053733 Bacteria 700
521 Ga0501084_1112601 3300054114 Bacteria 663
522 2643758304 2643221547 Bacteria 4740017
523 2891090229 2891088606 Bacteria 4762464
524 643602366 643348564 Bacteria 8839022
525 8002061316 8002060224 Bacteria 4026565
526 Ga0373955_0049883
527 Ga0058863_11824160
528 Ga0058862_10066198
529 Ga0070658_10280011
530 Ga0070676_10100395
531 Ga0070683_100703579
532 Ga0070690_100548126
533 Ga0070670_100633093
534 Ga0070670_100846205
535 Ga0070677_10200988
536 Ga0068869_100573145
537 Ga0070680_100031202
538 Ga0070680_101972505
539 Ga0070682_101098304
540 Ga0070660_100391882
541 Ga0070689_100188705
542 Ga0070691_10173148
543 Ga0070692_10491311
544 Ga0070668_101008235
545 Ga0070669_100310126
546 Ga0070675_100150470
547 Ga0070675_100948017
548 Ga0070688_100106570
549 Ga0070659_100510728
550 Ga0070667_100543350
551 Ga0070714_100648553
552 Ga0070700_100902423
553 Ga0070708_100033521
554 Ga0070678_101189379
555 Ga0070678_101432066
556 Ga0070678_101897202
557 Ga0070681_10130665
558 Ga0070681_10288183
559 Ga0070685_10467260
560 Ga0070706_100495805
561 Ga0070706_101032625
562 Ga0070707_100531793
563 Ga0070707_101289630
564 Ga0070698_100005737
565 Ga0070698_100700729
566 Ga0070699_100506012
567 Ga0070699_101335635
568 Ga0070679_100180350
569 Ga0070679_100821241
570 Ga0070679_101401772
571 Ga0070697_100499344
572 Ga0070697_101078444
573 Ga0070672_100448033
574 Ga0070686_101475011
575 Ga0070695_100514729
576 Ga0070693_100697872
577 Ga0070665_100031937
578 Ga0070665_100061484
579 Ga0070665_100826560
580 Ga0070665_101308686
581 Ga0068855_100056737
582 Ga0068855_100935916
583 Ga0068855_101214449
584 Ga0068857_100179492
585 Ga0068857_101488216
586 Ga0068854_100427368
587 Ga0068854_100993433
588 Ga0068856_100239808
589 Ga0068856_100692424
590 Ga0068856_100843372
591 Ga0068856_101775479
592 Ga0068856_102409139
593 Ga0068861_100637840
594 Ga0068861_101142179
595 Ga0068870_10863489
596 Ga0068863_101267393
597 Ga0068862_100357955
598 Ga0068862_100695468
599 Ga0068862_101754275
600 Ga0081455_10006200
601 Ga0081455_10018711
602 Ga0081455_10227891
603 Ga0081538_10041139
604 Ga0081540_1032464
605 Ga0075365_10180398
606 Ga0075365_10491112
607 Ga0075365_10787028
608 Ga0075365_10841305
609 Ga0075365_10885668
610 Ga0075365_10917367
611 Ga0075368_10119687
612 Ga0075368_10127861
613 Ga0075368_10237645
614 Ga0075368_10543431
615 Ga0075363_100177304
616 Ga0075363_100481189
617 Ga0075363_100551018
618 Ga0075364_11144591
619 Ga0070712_100155676
620 Ga0075362_10039686
621 Ga0075362_10052747
622 Ga0075362_10071272
623 Ga0075362_10087287
624 Ga0075362_10276147
625 Ga0075367_10207009
626 Ga0075367_10327579
627 Ga0075367_10425671
628 Ga0075369_10040483
629 Ga0075369_10341938
630 Ga0075369_10417156
631 Ga0075366_10001070
632 Ga0075366_10017552
633 Ga0075366_10309124
634 Ga0075366_10871299
635 Ga0075370_10071685
636 Ga0075370_10091572
637 Ga0075370_10311780
638 Ga0075428_100499485
639 Ga0075428_102005863
640 Ga0075430_100465615
641 Ga0075430_101445399
642 Ga0075431_100870493
643 Ga0075433_11186649
644 Ga0075433_11549483
645 Ga0075436_100406068
646 Ga0105240_10001848
647 Ga0105240_10125540
648 Ga0105240_10542705
649 Ga0105240_10760763
650 Ga0105240_11472875
651 Ga0111539_10380590
652 Ga0111539_10875662
653 Ga0111539_11860790
654 Ga0111539_12024580
655 Ga0105245_10003180
656 Ga0105245_12724418
657 Ga0105245_12959387
658 Ga0114129_10024238
659 Ga0114129_10697971
660 Ga0105243_10497057
661 Ga0105242_10856606
662 Ga0105242_11460129
663 Ga0105237_10002073
664 Ga0105237_12529862
665 Ga0105238_10265887
666 Ga0105238_12987666
667 Ga0105249_13450215
668 Ga0105239_10027686
669 Ga0105239_11154221
670 Ga0105239_11824432
671 Ga0157371_10563889
672 Ga0157370_10027260
673 Ga0157374_12925780
674 Ga0157378_11161288
675 Ga0163162_11164855
676 Ga0157375_13432915
677 Ga0163163_11562720
678 Ga0157380_10975514
679 Ga0182008_10445924
680 Ga0157377_10655707
681 Ga0157379_11200703
682 Ga0157379_12370672
683 Ga0157376_11038136
684 Ga0157376_11598693
685 Ga0163161_10317625
686 Ga0197907_10887070
687 Ga0206354_10314303
688 Ga0206353_11763184
689 Ga0213876_10220215
690 Ga0207697_10495339
691 Ga0207656_10186423
692 Ga0207682_10153601
693 Ga0207682_10164970
694 Ga0207642_10275117
695 Ga0207710_10412950
696 Ga0207688_10418234
697 Ga0207699_10231370
698 Ga0207645_10977351
699 Ga0207643_10202039
700 Ga0207643_10364268
701 Ga0207705_10011573
702 Ga0207705_10324369
703 Ga0207684_10195232
704 Ga0207684_10248730
705 Ga0207707_10017395
706 Ga0207695_10000288
707 Ga0207695_10231516
708 Ga0207695_10466048
709 Ga0207671_10001439
710 Ga0207693_10370483
711 Ga0207660_10018406
712 Ga0207660_11352603
713 Ga0207662_10200904
714 Ga0207657_10044752
715 Ga0207649_11436059
716 Ga0207652_10737916
717 Ga0207652_11306796
718 Ga0207652_11732850
719 Ga0207646_11321609
720 Ga0207681_10254497
721 Ga0207694_10391583
722 Ga0207694_10731416
723 Ga0207694_10825059
724 Ga0207694_11404600
725 Ga0207659_10090234
726 Ga0207659_10878259
727 Ga0207687_10009450
728 Ga0207687_10835543
729 Ga0207700_10036777
730 Ga0207664_10492288
731 Ga0207690_10406546
732 Ga0207709_10322801
733 Ga0207670_10578773
734 Ga0207670_11650468
735 Ga0207669_11002129
736 Ga0207704_11677021
737 Ga0207665_11063542
738 Ga0207665_11401770
739 Ga0207691_10255323
740 Ga0207691_10873167
741 Ga0207691_10939995
742 Ga0207691_11042676
743 Ga0207689_10221265
744 Ga0207661_10339107
745 Ga0207667_10485246
746 Ga0207651_10350571
747 Ga0207712_11146994
748 Ga0207668_10444465
749 Ga0207668_10482402
750 Ga0207668_10971201
751 Ga0207640_10005910
752 Ga0207640_10976902
753 Ga0207658_10896115
754 Ga0207658_11180158
755 Ga0207678_10480054
756 Ga0207678_10555451
757 Ga0207702_10519654
758 Ga0207702_10575028
759 Ga0207702_12207043
760 Ga0207648_10647170
761 Ga0207676_11915880
762 Ga0207674_10363522
763 Ga0207675_100485883
764 Ga0207683_10640042
765 Ga0207683_11130608
766 Ga0207683_11258655
767 Ga0209998_10209169
768 Ga0209813_10164694
769 Ga0209813_10359938
770 Ga0209813_10428668
771 Ga0268266_10027748
772 Ga0268266_10898374
773 Ga0268266_10913646
774 Ga0268265_10213269
775 Ga0268265_10224001
776 Ga0268264_12672248
777 Ga0265326_10085783
778 Ga0265319_1132843
779 Ga0265334_10000015
780 Ga0265334_10133623
781 Ga0265334_10343520
782 Ga0265318_10003625
783 Ga0265336_10218216
784 Ga0307517_10329608
785 Ga0265338_10045043
786 Ga0265338_10578405
787 Ga0310981_1098459
788 Ga0265324_10071196
789 Ga0265776_105880
790 Ga0265768_115829
791 Ga0265330_10016351
792 Ga0265330_10247853
793 Ga0265332_10043521
794 Ga0265332_10187239
795 Ga0265332_10252969
796 Ga0265332_10299676
797 Ga0265332_10321255
798 Ga0265328_10002063
799 Ga0265328_10164697
800 Ga0265328_10167750
801 Ga0265320_10000039
802 Ga0265320_10212438
803 Ga0265320_10363876
804 Ga0265325_10049564
805 Ga0265325_10060004
806 Ga0265325_10131945
807 Ga0265325_10216227
808 Ga0265325_10301955
809 Ga0265325_10303348
810 Ga0265325_10405890
811 Ga0265329_10128320
812 Ga0265340_10042165
813 Ga0265340_10090383
814 Ga0265339_10082137
815 Ga0265339_10238451
816 Ga0265331_10032871
817 Ga0265331_10090354
818 Ga0265331_10268182
819 Ga0265327_10017925
820 Ga0265316_10238197
821 Ga0265316_10770462
822 Ga0265316_11156483
823 Ga0307408_101404445
824 Ga0265313_10000882
825 Ga0265313_10003138
826 Ga0265313_10007299
827 Ga0265313_10392382
828 Ga0265314_10003840
829 Ga0265314_10035673
830 Ga0265314_10072609
831 Ga0265314_10077199
832 Ga0265314_10408749
833 Ga0265342_10027858
834 Ga0265342_10161518
835 Ga0316576_10028797
836 Ga0316576_11183743
837 Ga0316578_10022170
838 Ga0316578_10434695
839 Ga0316577_10197123
840 Ga0307413_10780522
841 Ga0307406_11383678
842 Ga0307412_10196510
843 Ga0307416_100638502
844 Ga0307411_11506335
845 Ga0307415_100421282
846 Ga0316585_10066251
847 Ga0316580_10004258
848 Ga0316593_10019017
849 Ga0316593_10069119
850 Ga0316593_10172832
851 Ga0316596_1070962
852 Ga0373950_0065995
853 Ga0373929_0069172
854 Ga0373951_0217588
855 Ga0373923_0482045
856 Ga0373936_0060028
857 Ga0373936_0115481
858 Ga0373939_0161392
859 Ga0373941_0070831
860 Ga0373954_0348398
861 Ga0373961_0133292
862 Ga0316574_0292574
863 Ga0316574_0443381
864 Ga0316574_0905499
865 Ga0373931_0362384
866 Ga0373935_0164343
867 Ga0373935_0743631
868 Ga0373935_0990576
869 Ga0373933_0138201
870 Ga0373937_0059384
871 Ga0373937_0818286
872 Ga0373937_1454192
873 Ga0316582_0017797
874 Ga0316584_0012231
875 Ga0373925_0212879
876 Ga0395899_0949716
877 Ga0395900_0069725
878 Ga0395900_0126614
879 Ga0395898_0153594
880 Ga0395898_1807083
881 Ga0395901_0010038
882 Ga0395901_0542431
883 Ga0395901_1507513
884 Ga0395901_2026035
885 Ga0436365_0739093
886 Ga0436360_0048417
887 Ga0436360_0910276
888 Ga0436360_0922437
889 Ga0436361_0698733
890 Ga0436363_0625407
891 Ga0436362_0478547
892 Ga0439465_0322999
893 Ga0451800_0939856
894 Ga0451802_0695966
895 Ga0451804_0671897
896 Ga0451849_1262468
897 Ga0439437_025399
898 Ga0439442_032406
899 Ga0439445_0113339
900 Ga0439432_058751
901 Ga0439464_0041322
902 Ga0466964_0053844
903 Ga0466957_0059247
904 Ga0466958_0851854
905 Ga0466967_0009010
906 Ga0495629_0848905
907 Ga0495638_0627866
908 Ga0495650_0140743
909 Ga0495650_0195614
910 Ga0495584_0475933
911 Ga0495652_0260946
912 Ga0495654_0195694
913 Ga0495647_0070997
914 Ga0495685_244577
915 Ga0495684_0558012
916 Ga0496101_0944742
917 Ga0496102_0828080
918 Ga0496106_0521630
919 Ga0496107_0436152
920 Ga0496108_1495476
921 Ga0496112_0842429
922 Ga0496112_1876989
923 Ga0496113_1141010
924 Ga0496117_0012763
925 Ga0496117_0216255
926 Ga0496118_0007285
927 Ga0496118_0085819
928 Ga0496121_0001839
929 Ga0496126_0004475
930 Ga0496126_0036957
931 Ga0496126_0115751
932 Ga0501031_0426351
933 Ga0501032_0222802
934 Ga0501033_0027445
935 Ga0501033_0226028
936 Ga0501033_0678226
937 Ga0501033_0875350
938 Ga0501034_0696655
939 Ga0501034_1274540
940 Ga0501037_0316656
941 Ga0501037_0601863
942 Ga0501038_1221839
943 Ga0501042_0387177
944 Ga0501043_0176160
945 Ga0501043_0291549
946 Ga0501043_0380059
947 Ga0501046_0012497
948 Ga0501046_0947566
949 Ga0501047_0010038
950 Ga0501047_0095340
951 Ga0501047_0436728
952 Ga0501047_1302186
953 Ga0501067_0267959
954 Ga0501067_0359595
955 Ga0501067_0498612
956 Ga0501069_0354202
957 Ga0501070_1285546
958 Ga0501072_0366211
959 Ga0501072_1239409
960 Ga0501072_1378293
961 Ga0501074_1170039
962 Ga0501076_0106262
963 Ga0501076_0204285
964 Ga0501076_0470989
965 Ga0501080_0592481
966 Ga0501081_0743849
967 Ga0501083_0046596
968 Ga0501083_0258939
969 Ga0501035_0035997
970 Ga0501035_0220593
971 Ga0501035_0955960
972 Ga0501044_0004434
973 Ga0501044_0091539
974 Ga0501044_0485876
975 Ga0501044_0569804
976 Ga0501044_1608012
977 nmdc:mga03683_19621_c2
978 nmdc:mga03683_26032_c1
979 nmdc:mga03683_48368_c1
980 nmdc:mga03683_64768_c1
981 nmdc:mga03n38_131693_c1
982 nmdc:mga03n38_609381_c1
983 nmdc:mga03n38_637655_c1
984 nmdc:mga00v17_444540_c1
985 nmdc:mga00v17_921301_c1
986 nmdc:mga0yw44_137182_c1
987 nmdc:mga0yw44_66984_c2
988 nmdc:mga0k408_237176_c1
989 nmdc:mga0k408_72498_c1
990 nmdc:mga06z11_212298_c1
991 nmdc:mga06z11_605495_c1
992 nmdc:mga06z11_80662_c1
993 nmdc:mga06z11_94044_c1
994 nmdc:mga04h51_191145_c1
995 nmdc:mga04h51_466749_c1
996 nmdc:mga07m45_323790_c1
997 nmdc:mga07m45_473482_c1
998 nmdc:mga07m45_579837_c1
999 nmdc:mga07m45_661223_c1
1000 nmdc:mga05p37_258890_c1
1001 nmdc:mga0qj67_406108_c1
1002 nmdc:mga06r32_1127168_c1
1003 nmdc:mga08y16_1165105_c1
1004 nmdc:mga0rr50_184382_c1
1005 nmdc:mga08x19_442776_c1
1006 nmdc:mga08x19_503282_c1
1007 nmdc:mga0a205_1227542_c1
1008 nmdc:mga0sz30_1761_c1
1009 nmdc:mga0sz30_191855_c1
1010 nmdc:mga0sz30_243878_c1
1011 Ga0495601_0488584
1012 Ga0500643_018671
1013 Ga0500644_0001590
1014 Ga0500644_0212305
1015 Ga0500644_0305110
1016 Ga0500646_0413373
1017 Ga0500651_0023030
1018 Ga0500651_0101566
1019 Ga0500651_0785841
1020 Ga0500641_0022118
1021 Ga0500650_0409343
1022 Ga0500557_265713
1023 Ga0500595_000001
1024 Ga0500595_001807
1025 Ga0500595_073797
1026 Ga0500597_228487
1027 Ga0500614_019885
1028 Ga0500642_0056591
1029 Ga0500642_0134035
1030 Ga0500652_000938
1031 Ga0500655_008265
1032 Ga0500655_129626
1033 Ga0500568_0373557
1034 Ga0500573_0091948
1035 Ga0500573_0402388
1036 Ga0500577_0122310
1037 Ga0500577_0265652
1038 Ga0500603_172476
1039 Ga0500616_0000001
1040 Ga0500616_0001083
1041 Ga0500620_168115
1042 Ga0500645_002376
1043 Ga0500645_161976
1044 Ga0500552_012537
1045 Ga0500552_051086
1046 Ga0501084_1112601
1047 2643758304
1048 2891090229
1049 643602366
1050 8002061316

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

69

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nhn-assembly1.cif.gz_Z vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9839 20 83
6wqq-assembly1.cif.gz_I structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with the antibiotic, radezolid 0.9722 20 85
7sae-assembly1.cif.gz_V 44sr70p class1 ribosomal particle 0.9676 20 84
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9662 20 85
6o90-assembly1.cif.gz_X cryo-em image reconstruction of the 70s ribosome enterococcus faecalis class05 0.9658 20 84
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9662 20 85 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9521 20 85 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9006 29 82 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8692 29 82 2.40.50.100
af_Q9NDU6_129_252_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8577 20 90 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A328ESH9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 1.001 21 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7V3W3R6-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.993 25 83 GO:0003735
GO:0006412
GO:0022625
AF-A0A351YBM2-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9858 21 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A3D3B1Z9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9856 19 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A432T7Q1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9817 25 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map