F459294

General Info

Members Datasets Scaffolds Average Seq Length
525 191 524 195

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100449937|Ga0307415_1004499371
Length 209
Sequence MRFHYNCDTPPMRWAARKGFRFGPDGFHFDWGDDGPGGFGGGHRRRDRKRMFEGGELRLVLLKLIADEPRHGYQLIKAVEDLTEGDYAPSPGIVYPTLTMLEDMGHIREQKSKDSKKVFEATDEGRAHLEENADEVDELFEKLEGHGRTRRHGQRPEIGRAIGNLMAAMRNRVAAEGWNDKLLEEVTDILDDAAQRIERARKGKRDEED

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
128 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
176 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
177 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
178 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
179 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
180 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
181 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
182 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
183 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
184 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
185 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
186 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
187 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
188 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4
Rhizosphere 95.81
Stem 0
Stem Tuber 0.19
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2933200 2162886012 Bacteria 990
2 JGI24746J21847_1007738 3300001977 Bacteria 1635
3 JGI24739J22299_10042427 3300001989 Bacteria 1509
4 JGI24737J22298_10053878 3300001990 Bacteria 1218
5 JGI24750J21931_1032392 3300002070 Bacteria 771
6 JGI24738J21930_10016704 3300002075 Bacteria 1547
7 JGI24749J21850_1007612 3300002076 Bacteria 1509
8 JGI24744J21845_10000079 3300002077 Bacteria 12357
9 Ga0065715_10000733 3300005293 Bacteria 14824
10 Ga0065715_10122837 3300005293 Bacteria 2194
11 Ga0070658_10041142 3300005327 Bacteria 3728
12 Ga0070658_10158355 3300005327 Bacteria 1899
13 Ga0070658_10375249 3300005327 Bacteria 1219
14 Ga0070658_10520258 3300005327 Bacteria 1028
15 Ga0070676_10006117 3300005328 Bacteria 6428
16 Ga0070683_100552509 3300005329 Bacteria 1101
17 Ga0070670_100004328 3300005331 Bacteria 11886
18 Ga0070670_100043409 3300005331 Bacteria 3864
19 Ga0070670_101123137 3300005331 Bacteria 717
20 Ga0070677_10003092 3300005333 Bacteria 5347
21 Ga0070677_10170815 3300005333 Bacteria 1027
22 Ga0068869_100125270 3300005334 Bacteria 1969
23 Ga0070666_10068191 3300005335 Bacteria 2417
24 Ga0070666_10803536 3300005335 Bacteria 693
25 Ga0070680_100001313 3300005336 Bacteria 18015
26 Ga0070680_100071053 3300005336 Bacteria 2859
27 Ga0070680_100180123 3300005336 Bacteria 1780
28 Ga0070680_100208760 3300005336 Bacteria 1647
29 Ga0068868_100142705 3300005338 Bacteria 1967
30 Ga0070660_100064232 3300005339 Bacteria 2855
31 Ga0070660_100076986 3300005339 Bacteria 2613
32 Ga0070660_100118743 3300005339 Bacteria 2109
33 Ga0070660_100130490 3300005339 Bacteria 2010
34 Ga0070660_100285329 3300005339 Bacteria 1351
35 Ga0070661_100032148 3300005344 Bacteria 3797
36 Ga0070661_100038351 3300005344 Bacteria 3487
37 Ga0070661_100082063 3300005344 Bacteria 2381
38 Ga0070668_100003373 3300005347 Bacteria 11777
39 Ga0070668_100057277 3300005347 Bacteria 3011
40 Ga0070668_100157807 3300005347 Bacteria 1839
41 Ga0070668_100317428 3300005347 Bacteria 1311
42 Ga0070669_100000714 3300005353 Bacteria 24315
43 Ga0070669_100242622 3300005353 Bacteria 1432
44 Ga0070669_100315551 3300005353 Bacteria 1261
45 Ga0070669_100354331 3300005353 Bacteria 1192
46 Ga0070675_100000410 3300005354 Bacteria 29182
47 Ga0070675_100547970 3300005354 Bacteria 1046
48 Ga0070671_100002716 3300005355 Bacteria 13731
49 Ga0070671_100003073 3300005355 Bacteria 12979
50 Ga0070671_100073336 3300005355 Bacteria 2859
51 Ga0070671_100123093 3300005355 Bacteria 2183
52 Ga0070671_100271604 3300005355 Bacteria 1441
53 Ga0070674_100000855 3300005356 Bacteria 15805
54 Ga0070674_100024054 3300005356 Bacteria 3951
55 Ga0070673_100109852 3300005364 Bacteria 2285
56 Ga0070673_100131244 3300005364 Bacteria 2102
57 Ga0070673_100132789 3300005364 Bacteria 2091
58 Ga0070673_100288535 3300005364 Bacteria 1441
59 Ga0070673_100707949 3300005364 Bacteria 925
60 Ga0070659_100031589 3300005366 Bacteria 4102
61 Ga0070659_100047299 3300005366 Bacteria 3374
62 Ga0070659_100078966 3300005366 Bacteria 2626
63 Ga0070659_100086591 3300005366 Bacteria 2507
64 Ga0070659_100089122 3300005366 Bacteria 2471
65 Ga0070659_100384134 3300005366 Bacteria 1183
66 Ga0070659_100669248 3300005366 Bacteria 896
67 Ga0070667_100039219 3300005367 Bacteria 3970
68 Ga0070667_100195072 3300005367 Bacteria 1795
69 Ga0070714_100106078 3300005435 Bacteria 2482
70 Ga0070714_100553058 3300005435 Bacteria 1102
71 Ga0070713_100056673 3300005436 Bacteria 3259
72 Ga0070701_10108632 3300005438 Bacteria 1547
73 Ga0070700_100985282 3300005441 Bacteria 692
74 Ga0070663_100040535 3300005455 Bacteria 3261
75 Ga0070663_100054421 3300005455 Bacteria 2860
76 Ga0070663_100197635 3300005455 Bacteria 1568
77 Ga0070663_100374382 3300005455 Bacteria 1158
78 Ga0070678_100008631 3300005456 Bacteria 6110
79 Ga0070678_100505515 3300005456 Bacteria 1067
80 Ga0070662_100000230 3300005457 Bacteria 32939
81 Ga0070662_100007321 3300005457 Bacteria 7149
82 Ga0070662_100033130 3300005457 Bacteria 3636
83 Ga0070662_100033215 3300005457 Bacteria 3631
84 Ga0070662_100064386 3300005457 Bacteria 2684
85 Ga0070662_100072267 3300005457 Bacteria 2546
86 Ga0070681_10010885 3300005458 Bacteria 8992
87 Ga0070681_10038415 3300005458 Bacteria 4800
88 Ga0070681_10102974 3300005458 Bacteria 2799
89 Ga0070681_10219383 3300005458 Bacteria 1817
90 Ga0070681_10567366 3300005458 Bacteria 1049
91 Ga0068867_100010095 3300005459 Bacteria 6654
92 Ga0068867_100050293 3300005459 Bacteria 3071
93 Ga0068867_100301117 3300005459 Bacteria 1322
94 Ga0070679_100032785 3300005530 Bacteria 5141
95 Ga0070679_100059664 3300005530 Bacteria 3802
96 Ga0070679_100074065 3300005530 Bacteria 3396
97 Ga0070679_100213668 3300005530 Bacteria 1892
98 Ga0068853_100103225 3300005539 Bacteria 2523
99 Ga0068853_100231927 3300005539 Bacteria 1689
100 Ga0068853_100566497 3300005539 Bacteria 1077
101 Ga0070672_100002028 3300005543 Bacteria 12733
102 Ga0070672_100020660 3300005543 Bacteria 4806
103 Ga0070672_100054735 3300005543 Bacteria 3124
104 Ga0070672_100416203 3300005543 Bacteria 1154
105 Ga0070704_100097113 3300005549 Bacteria 2210
106 Ga0068855_100225536 3300005563 Bacteria 2100
107 Ga0070664_100019027 3300005564 Bacteria 5647
108 Ga0070664_100021419 3300005564 Bacteria 5328
109 Ga0070664_100031253 3300005564 Bacteria 4447
110 Ga0070664_100068993 3300005564 Bacteria 3024
111 Ga0070664_100273653 3300005564 Bacteria 1521
112 Ga0068857_100226359 3300005577 Bacteria 1709
113 Ga0068857_100931333 3300005577 Bacteria 834
114 Ga0068854_100032155 3300005578 Bacteria 3649
115 Ga0068854_100038416 3300005578 Bacteria 3367
116 Ga0068854_100058992 3300005578 Bacteria 2772
117 Ga0068854_100986280 3300005578 Bacteria 745
118 Ga0068856_100045520 3300005614 Bacteria 4321
119 Ga0068852_100072470 3300005616 Bacteria 3027
120 Ga0068852_100482772 3300005616 Bacteria 1232
121 Ga0068852_101037627 3300005616 Bacteria 839
122 Ga0068859_100016407 3300005617 Bacteria 7440
123 Ga0068859_100908229 3300005617 Bacteria 965
124 Ga0068864_100024183 3300005618 Bacteria 5107
125 Ga0068864_100051540 3300005618 Bacteria 3546
126 Ga0068864_100965957 3300005618 Bacteria 844
127 Ga0068866_10023584 3300005718 Bacteria 2865
128 Ga0068866_10242788 3300005718 Bacteria 1098
129 Ga0068861_101136565 3300005719 Bacteria 752
130 Ga0068851_10109534 3300005834 Bacteria 1473
131 Ga0068870_10067179 3300005840 Bacteria 1944
132 Ga0068863_100106630 3300005841 Bacteria 2666
133 Ga0068858_100249944 3300005842 Bacteria 1684
134 Ga0068858_100799760 3300005842 Bacteria 920
135 Ga0068860_100071380 3300005843 Bacteria 3300
136 Ga0068862_100020853 3300005844 Bacteria 5474
137 Ga0068862_100116174 3300005844 Bacteria 2354
138 Ga0068862_101012889 3300005844 Bacteria 822
139 Ga0097621_100119720 3300006237 Bacteria 2232
140 Ga0097621_100440632 3300006237 Bacteria 1172
141 Ga0075431_100073975 3300006847 Bacteria 3516
142 Ga0068865_100035287 3300006881 Bacteria 3361
143 Ga0068865_100175050 3300006881 Bacteria 1648
144 Ga0097620_100016407 3300006931 Bacteria 7440
145 Ga0097620_100908212 3300006931 Bacteria 965
146 Ga0111539_10028693 3300009094 Bacteria 6787
147 Ga0111539_10594412 3300009094 Bacteria 1289
148 Ga0105248_10002873 3300009177 Bacteria 19111
149 Ga0105248_10015455 3300009177 Bacteria 8413
150 Ga0105248_10041406 3300009177 Bacteria 5164
151 Ga0105248_10168485 3300009177 Bacteria 2469
152 Ga0105248_10230880 3300009177 Bacteria 2083
153 Ga0105249_10010976 3300009553 Bacteria 7959
154 Ga0157373_10057023 3300013100 Bacteria 2771
155 Ga0157373_10057275 3300013100 Bacteria 2765
156 Ga0157373_10136847 3300013100 Bacteria 1722
157 Ga0157373_10187908 3300013100 Bacteria 1455
158 Ga0157373_10244735 3300013100 Bacteria 1268
159 Ga0157369_10356362 3300013105 Bacteria 1519
160 Ga0157369_10505986 3300013105 Bacteria 1250
161 Ga0157369_10521906 3300013105 Bacteria 1229
162 Ga0157378_10036975 3300013297 Bacteria 4322
163 Ga0163162_10025551 3300013306 Bacteria 5836
164 Ga0157375_10002721 3300013308 Bacteria 15280
165 Ga0157375_10844328 3300013308 Bacteria 1063
166 Ga0157380_10000743 3300014326 Bacteria 20330
167 Ga0157380_10002497 3300014326 Bacteria 12394
168 Ga0157380_10693907 3300014326 Bacteria 1022
169 Ga0157380_10912323 3300014326 Bacteria 905
170 Ga0163161_10005605 3300017792 Bacteria 8705
171 Ga0163161_10005788 3300017792 Bacteria 8570
172 Ga0163161_10010334 3300017792 Bacteria 6463
173 Ga0207697_10001412 3300025315 Bacteria 13151
174 Ga0207697_10084843 3300025315 Bacteria 1337
175 Ga0207697_10168778 3300025315 Bacteria 957
176 Ga0207656_10154208 3300025321 Bacteria 1089
177 Ga0207682_10000869 3300025893 Bacteria 14040
178 Ga0207682_10013481 3300025893 Bacteria 3184
179 Ga0207682_10106153 3300025893 Bacteria 1232
180 Ga0207642_10007534 3300025899 Bacteria 3683
181 Ga0207688_10007823 3300025901 Bacteria 5816
182 Ga0207688_10043506 3300025901 Bacteria 2501
183 Ga0207688_10059031 3300025901 Bacteria 2160
184 Ga0207680_10521686 3300025903 Bacteria 847
185 Ga0207647_10044274 3300025904 Bacteria 2782
186 Ga0207645_10062732 3300025907 Bacteria 2374
187 Ga0207645_10064192 3300025907 Bacteria 2346
188 Ga0207645_10066220 3300025907 Bacteria 2309
189 Ga0207643_10058843 3300025908 Bacteria 2191
190 Ga0207705_10104914 3300025909 Bacteria 2083
191 Ga0207705_10205406 3300025909 Bacteria 1493
192 Ga0207705_10437192 3300025909 Bacteria 1014
193 Ga0207707_10009893 3300025912 Bacteria 8269
194 Ga0207707_10199167 3300025912 Bacteria 1746
195 Ga0207707_10217198 3300025912 Bacteria 1665
196 Ga0207660_10261431 3300025917 Bacteria 1369
197 Ga0207662_10204551 3300025918 Bacteria 1279
198 Ga0207657_10002445 3300025919 Bacteria 20068
199 Ga0207657_10059384 3300025919 Bacteria 3286
200 Ga0207657_10078612 3300025919 Bacteria 2777
201 Ga0207657_10121060 3300025919 Bacteria 2153
202 Ga0207649_10020613 3300025920 Bacteria 3782
203 Ga0207649_10036061 3300025920 Bacteria 2975
204 Ga0207652_10018851 3300025921 Bacteria 5663
205 Ga0207652_10180092 3300025921 Bacteria 1899
206 Ga0207652_10663514 3300025921 Bacteria 932
207 Ga0207652_10849844 3300025921 Bacteria 808
208 Ga0207681_10000376 3300025923 Bacteria 31532
209 Ga0207681_10074964 3300025923 Bacteria 2372
210 Ga0207681_10170124 3300025923 Bacteria 1651
211 Ga0207681_10220365 3300025923 Bacteria 1467
212 Ga0207650_10003665 3300025925 Bacteria 10507
213 Ga0207650_10055903 3300025925 Bacteria 2931
214 Ga0207650_10754342 3300025925 Bacteria 824
215 Ga0207659_10000215 3300025926 Bacteria 34824
216 Ga0207659_10283294 3300025926 Bacteria 1356
217 Ga0207664_10216916 3300025929 Bacteria 1657
218 Ga0207644_10001983 3300025931 Bacteria 13239
219 Ga0207644_10002558 3300025931 Bacteria 11707
220 Ga0207644_10015737 3300025931 Bacteria 5082
221 Ga0207644_10054326 3300025931 Bacteria 2884
222 Ga0207644_10057571 3300025931 Bacteria 2807
223 Ga0207644_10142042 3300025931 Bacteria 1849
224 Ga0207644_10295201 3300025931 Bacteria 1304
225 Ga0207644_11034895 3300025931 Bacteria 689
226 Ga0207690_10033129 3300025932 Bacteria 3320
227 Ga0207690_10137727 3300025932 Bacteria 1794
228 Ga0207690_10149230 3300025932 Bacteria 1732
229 Ga0207690_10332530 3300025932 Bacteria 1197
230 Ga0207690_10724160 3300025932 Bacteria 819
231 Ga0207706_10000378 3300025933 Bacteria 48430
232 Ga0207706_10000557 3300025933 Bacteria 39725
233 Ga0207706_10011585 3300025933 Bacteria 8031
234 Ga0207706_10116711 3300025933 Bacteria 2348
235 Ga0207706_10124000 3300025933 Bacteria 2273
236 Ga0207706_10178493 3300025933 Bacteria 1865
237 Ga0207706_10211192 3300025933 Bacteria 1701
238 Ga0207706_10368332 3300025933 Bacteria 1248
239 Ga0207706_10677029 3300025933 Bacteria 882
240 Ga0207669_10003525 3300025937 Bacteria 6777
241 Ga0207669_10311252 3300025937 Bacteria 1201
242 Ga0207704_10014668 3300025938 Bacteria 3965
243 Ga0207691_10001956 3300025940 Bacteria 20121
244 Ga0207691_10085412 3300025940 Bacteria 2832
245 Ga0207691_10123293 3300025940 Bacteria 2294
246 Ga0207691_10318130 3300025940 Bacteria 1335
247 Ga0207711_10000055 3300025941 Bacteria 136126
248 Ga0207711_10026817 3300025941 Bacteria 4836
249 Ga0207711_10031426 3300025941 Bacteria 4482
250 Ga0207711_10089903 3300025941 Bacteria 2699
251 Ga0207689_10011938 3300025942 Bacteria 7445
252 Ga0207689_10109530 3300025942 Bacteria 2269
253 Ga0207661_10441819 3300025944 Bacteria 1184
254 Ga0207679_10007501 3300025945 Bacteria 6923
255 Ga0207679_10054548 3300025945 Bacteria 2943
256 Ga0207679_10059284 3300025945 Bacteria 2839
257 Ga0207679_10117907 3300025945 Bacteria 2107
258 Ga0207679_10367097 3300025945 Bacteria 1259
259 Ga0207667_10309098 3300025949 Bacteria 1615
260 Ga0207651_10016944 3300025960 Bacteria 4288
261 Ga0207651_10029479 3300025960 Bacteria 3478
262 Ga0207651_10120528 3300025960 Bacteria 1988
263 Ga0207712_10017790 3300025961 Bacteria 4621
264 Ga0207668_10000233 3300025972 Bacteria 37280
265 Ga0207668_10141127 3300025972 Bacteria 1853
266 Ga0207668_10144269 3300025972 Bacteria 1835
267 Ga0207640_10008846 3300025981 Bacteria 5606
268 Ga0207640_10032594 3300025981 Bacteria 3232
269 Ga0207640_10112017 3300025981 Bacteria 1936
270 Ga0207658_10165145 3300025986 Bacteria 1818
271 Ga0207677_10061429 3300026023 Bacteria 2602
272 Ga0207677_10189787 3300026023 Bacteria 1624
273 Ga0207703_10296770 3300026035 Bacteria 1473
274 Ga0207639_10087102 3300026041 Bacteria 2489
275 Ga0207639_10315813 3300026041 Bacteria 1386
276 Ga0207678_10018879 3300026067 Bacteria 6057
277 Ga0207678_10039635 3300026067 Bacteria 4088
278 Ga0207678_10053088 3300026067 Bacteria 3494
279 Ga0207678_10109077 3300026067 Bacteria 2361
280 Ga0207678_10271437 3300026067 Bacteria 1454
281 Ga0207678_10325698 3300026067 Bacteria 1322
282 Ga0207708_10244654 3300026075 Bacteria 1444
283 Ga0207702_10052958 3300026078 Bacteria 3435
284 Ga0207641_10099229 3300026088 Bacteria 2562
285 Ga0207641_10666141 3300026088 Bacteria 1023
286 Ga0207648_10002819 3300026089 Bacteria 18431
287 Ga0207648_10005688 3300026089 Bacteria 12503
288 Ga0207648_10193143 3300026089 Bacteria 1805
289 Ga0207648_10221516 3300026089 Bacteria 1682
290 Ga0207676_10021148 3300026095 Bacteria 4771
291 Ga0207676_10045195 3300026095 Bacteria 3402
292 Ga0207676_10117544 3300026095 Bacteria 2236
293 Ga0207674_10011365 3300026116 Bacteria 10005
294 Ga0207674_10222297 3300026116 Bacteria 1836
295 Ga0207674_10248078 3300026116 Bacteria 1727
296 Ga0207675_100337126 3300026118 Bacteria 1475
297 Ga0207683_10063894 3300026121 Bacteria 3243
298 Ga0207683_10125289 3300026121 Bacteria 2308
299 Ga0207683_10157029 3300026121 Bacteria 2055
300 Ga0207683_10297113 3300026121 Bacteria 1477
301 Ga0207683_10694825 3300026121 Bacteria 943
302 Ga0207698_10384933 3300026142 Bacteria 1336
303 Ga0207698_10405690 3300026142 Bacteria 1304
304 Ga0207698_10856131 3300026142 Bacteria 914
305 Ga0209971_1025046 3300027682 Bacteria 1425
306 Ga0209974_10000170 3300027876 Bacteria 20007
307 Ga0207428_10123455 3300027907 Bacteria 1984
308 Ga0268266_10365191 3300028379 Bacteria 1359
309 Ga0268265_10195492 3300028380 Bacteria 1750
310 Ga0268265_10231729 3300028380 Bacteria 1623
311 Ga0316181_1064600 3300030744 Bacteria 1055
312 Ga0316182_1074158 3300030745 Bacteria 4099
313 Ga0307408_100095562 3300031548 Bacteria 2253
314 Ga0307408_100156468 3300031548 Bacteria 1805
315 Ga0307408_100167680 3300031548 Bacteria 1751
316 Ga0307408_100231015 3300031548 Bacteria 1515
317 Ga0307408_100558087 3300031548 Bacteria 1011
318 Ga0307405_10002439 3300031731 Bacteria 8198
319 Ga0307405_10004000 3300031731 Bacteria 6909
320 Ga0307405_10008327 3300031731 Bacteria 5246
321 Ga0307405_10052449 3300031731 Bacteria 2536
322 Ga0307405_10130708 3300031731 Bacteria 1734
323 Ga0307405_10219263 3300031731 Bacteria 1394
324 Ga0307405_10522836 3300031731 Bacteria 955
325 Ga0307413_10004882 3300031824 Bacteria 5898
326 Ga0307413_10008551 3300031824 Bacteria 4842
327 Ga0307413_10012194 3300031824 Bacteria 4269
328 Ga0307413_10027348 3300031824 Bacteria 3159
329 Ga0307413_10027756 3300031824 Bacteria 3142
330 Ga0307413_10035286 3300031824 Bacteria 2867
331 Ga0307413_10109112 3300031824 Bacteria 1848
332 Ga0307413_10152183 3300031824 Bacteria 1614
333 Ga0307413_10154148 3300031824 Bacteria 1605
334 Ga0307413_10277311 3300031824 Bacteria 1259
335 Ga0307413_10517655 3300031824 Bacteria 961
336 Ga0307413_10761154 3300031824 Bacteria 810
337 Ga0307413_11007247 3300031824 Bacteria 714
338 Ga0307410_10016156 3300031852 Bacteria 4444
339 Ga0307410_10016521 3300031852 Bacteria 4404
340 Ga0307410_10024012 3300031852 Bacteria 3802
341 Ga0307410_10024277 3300031852 Bacteria 3785
342 Ga0307410_10060091 3300031852 Bacteria 2597
343 Ga0307410_10065493 3300031852 Bacteria 2499
344 Ga0307410_10094638 3300031852 Bacteria 2128
345 Ga0307410_10139382 3300031852 Bacteria 1792
346 Ga0307410_10318413 3300031852 Bacteria 1233
347 Ga0307410_10368924 3300031852 Bacteria 1152
348 Ga0307410_10484048 3300031852 Bacteria 1015
349 Ga0307406_10011631 3300031901 Bacteria 4998
350 Ga0307406_10013782 3300031901 Bacteria 4638
351 Ga0307406_10023951 3300031901 Bacteria 3640
352 Ga0307406_10025347 3300031901 Bacteria 3550
353 Ga0307406_10081414 3300031901 Bacteria 2153
354 Ga0307406_10090707 3300031901 Bacteria 2057
355 Ga0307406_10163711 3300031901 Bacteria 1602
356 Ga0307406_10283793 3300031901 Bacteria 1264
357 Ga0307406_10377061 3300031901 Bacteria 1117
358 Ga0307407_10008654 3300031903 Bacteria 4687
359 Ga0307407_10026018 3300031903 Bacteria 3093
360 Ga0307407_10053800 3300031903 Bacteria 2318
361 Ga0307407_10062993 3300031903 Bacteria 2174
362 Ga0307407_10064437 3300031903 Bacteria 2154
363 Ga0307407_10102819 3300031903 Bacteria 1777
364 Ga0307407_10225696 3300031903 Bacteria 1269
365 Ga0307407_10292533 3300031903 Bacteria 1132
366 Ga0307412_10013021 3300031911 Bacteria 4862
367 Ga0307412_10013987 3300031911 Bacteria 4723
368 Ga0307412_10052406 3300031911 Bacteria 2702
369 Ga0307412_10122572 3300031911 Bacteria 1874
370 Ga0307412_10201069 3300031911 Bacteria 1513
371 Ga0307412_10211736 3300031911 Bacteria 1479
372 Ga0307412_10537320 3300031911 Bacteria 979
373 Ga0307412_10731322 3300031911 Bacteria 852
374 Ga0307412_10751149 3300031911 Bacteria 842
375 Ga0307409_100001426 3300031995 Bacteria 11737
376 Ga0307409_100037278 3300031995 Bacteria 3583
377 Ga0307409_100089144 3300031995 Bacteria 2520
378 Ga0307409_100118067 3300031995 Bacteria 2239
379 Ga0307409_100257620 3300031995 Bacteria 1599
380 Ga0307409_100327553 3300031995 Bacteria 1436
381 Ga0307409_100393647 3300031995 Bacteria 1321
382 Ga0307409_100762631 3300031995 Bacteria 972
383 Ga0307409_101335757 3300031995 Bacteria 742
384 Ga0307416_100007235 3300032002 Bacteria 7033
385 Ga0307416_100009009 3300032002 Bacteria 6493
386 Ga0307416_100041851 3300032002 Bacteria 3571
387 Ga0307416_100205742 3300032002 Bacteria 1872
388 Ga0307416_100315935 3300032002 Bacteria 1561
389 Ga0307416_100327123 3300032002 Bacteria 1538
390 Ga0307416_100340730 3300032002 Bacteria 1512
391 Ga0307416_100498477 3300032002 Bacteria 1281
392 Ga0307416_100574686 3300032002 Bacteria 1203
393 Ga0307416_100900926 3300032002 Bacteria 984
394 Ga0307414_10014541 3300032004 Bacteria 4724
395 Ga0307414_10016360 3300032004 Bacteria 4507
396 Ga0307414_10061711 3300032004 Bacteria 2656
397 Ga0307414_10074658 3300032004 Bacteria 2457
398 Ga0307414_10087210 3300032004 Bacteria 2305
399 Ga0307414_10092131 3300032004 Bacteria 2255
400 Ga0307414_10112254 3300032004 Bacteria 2077
401 Ga0307414_10114544 3300032004 Bacteria 2060
402 Ga0307414_10193376 3300032004 Bacteria 1648
403 Ga0307414_10211781 3300032004 Bacteria 1584
404 Ga0307414_10213135 3300032004 Bacteria 1580
405 Ga0307414_10233205 3300032004 Bacteria 1519
406 Ga0307414_10325717 3300032004 Bacteria 1309
407 Ga0307414_10407679 3300032004 Bacteria 1182
408 Ga0307414_10491216 3300032004 Bacteria 1084
409 Ga0307411_10001278 3300032005 Bacteria 10092
410 Ga0307411_10004534 3300032005 Bacteria 6668
411 Ga0307411_10021320 3300032005 Bacteria 3788
412 Ga0307411_10024976 3300032005 Bacteria 3571
413 Ga0307411_10059379 3300032005 Bacteria 2535
414 Ga0307411_10061224 3300032005 Bacteria 2504
415 Ga0307411_10062328 3300032005 Bacteria 2487
416 Ga0307411_10068245 3300032005 Bacteria 2396
417 Ga0307411_10068649 3300032005 Bacteria 2390
418 Ga0307411_10091724 3300032005 Bacteria 2123
419 Ga0307411_10235652 3300032005 Bacteria 1429
420 Ga0307411_10297703 3300032005 Bacteria 1292
421 Ga0307411_10472198 3300032005 Bacteria 1054
422 Ga0307415_100003694 3300032126 Bacteria 7833
423 Ga0307415_100014963 3300032126 Bacteria 4579
424 Ga0307415_100015686 3300032126 Bacteria 4495
425 Ga0307415_100019323 3300032126 Bacteria 4135
426 Ga0307415_100058293 3300032126 Bacteria 2658
427 Ga0307415_100116758 3300032126 Bacteria 1991
428 Ga0307415_100355261 3300032126 Bacteria 1235
429 Ga0307415_100449937 3300032126 Bacteria 1113
430 Ga0307415_100778041 3300032126 Bacteria 871
431 Ga0395899_0067467 3300037312 Bacteria 2624
432 Ga0395899_0070990 3300037312 Bacteria 2548
433 Ga0395900_0001005 3300037418 Bacteria 36540
434 Ga0395900_0015800 3300037418 Bacteria 7696
435 Ga0395900_0026202 3300037418 Bacteria 5970
436 Ga0395900_0033072 3300037418 Bacteria 5322
437 Ga0395900_0200948 3300037418 Bacteria 2016
438 Ga0395900_0229637 3300037418 Bacteria 1867
439 Ga0395900_0389216 3300037418 Bacteria 1360
440 Ga0395898_0014896 3300037466 Bacteria 7982
441 Ga0395898_0240600 3300037466 Bacteria 1726
442 Ga0395905_0000128 3300037471 Bacteria 124305
443 Ga0395905_0030134 3300037471 Bacteria 5114
444 Ga0395905_0059243 3300037471 Bacteria 3579
445 Ga0395905_0075778 3300037471 Bacteria 3153
446 Ga0395905_0118888 3300037471 Bacteria 2484
447 Ga0395905_0128299 3300037471 Bacteria 2385
448 Ga0395905_0313866 3300037471 Bacteria 1456
449 Ga0395905_0457254 3300037471 Bacteria 1175
450 Ga0395901_0003812 3300038443 Bacteria 15192
451 Ga0395901_0084384 3300038443 Bacteria 3320
452 Ga0395901_0120545 3300038443 Bacteria 2756
453 Ga0466966_0043165 3300044684 Bacteria 2891
454 Ga0466966_0088625 3300044684 Bacteria 1922
455 Ga0466966_0307482 3300044684 Bacteria 953
456 Ga0466961_0036424 3300044693 Bacteria 3158
457 Ga0466961_0071958 3300044693 Bacteria 2193
458 Ga0466963_0028781 3300044694 Bacteria 3571
459 Ga0466971_0013690 3300044719 Bacteria 3567
460 Ga0466971_0047890 3300044719 Bacteria 1922
461 Ga0466970_0139931 3300044765 Bacteria 1333
462 Ga0466970_0382095 3300044765 Bacteria 802
463 Ga0466957_0155147 3300044842 Bacteria 1483
464 Ga0466957_0197055 3300044842 Bacteria 1321
465 Ga0466959_0606074 3300045049 Bacteria 736
466 Ga0466958_0039140 3300045836 Bacteria 2847
467 Ga0466958_0160675 3300045836 Bacteria 1419
468 Ga0466967_0082319 3300045976 Bacteria 2908
469 Ga0466967_0188712 3300045976 Bacteria 1947
470 Ga0466967_0251154 3300045976 Bacteria 1689
471 Ga0495663_0003858 3300046525 Bacteria 4274
472 Ga0495663_0008266 3300046525 Bacteria 2881
473 Ga0495663_0063743 3300046525 Bacteria 1162
474 Ga0495642_0032759 3300046528 Bacteria 2086
475 Ga0495642_0063890 3300046528 Bacteria 1531
476 Ga0495621_0000466 3300046539 Bacteria 9922
477 Ga0495621_0003239 3300046539 Bacteria 4472
478 Ga0495668_0072563 3300046616 Bacteria 1891
479 Ga0495659_0120730 3300046664 Bacteria 1031
480 Ga0495669_0038784 3300046684 Bacteria 2109
481 Ga0495670_0024838 3300046691 Bacteria 2962
482 Ga0495670_0025124 3300046691 Bacteria 2946
483 Ga0495670_0048319 3300046691 Bacteria 2129
484 Ga0495677_0183638 3300047445 Bacteria 811
485 Ga0496101_0008073 3300048904 Bacteria 6864
486 Ga0496102_0155023 3300048905 Bacteria 2153
487 Ga0496102_0765692 3300048905 Bacteria 888
488 Ga0496103_0038726 3300048906 Bacteria 2927
489 Ga0496104_0195662 3300048907 Bacteria 1934
490 Ga0496106_0008395 3300048909 Bacteria 7643
491 Ga0496107_0001705 3300048910 Bacteria 13777
492 Ga0496107_0015909 3300048910 Bacteria 5277
493 Ga0496108_0048801 3300048911 Bacteria 3540
494 Ga0496108_0168275 3300048911 Bacteria 1895
495 Ga0496109_0046592 3300048912 Bacteria 3938
496 Ga0496109_0221268 3300048912 Bacteria 1780
497 Ga0496110_0009252 3300048913 Bacteria 7962
498 Ga0496110_0011708 3300048913 Bacteria 7196
499 Ga0496110_0022628 3300048913 Bacteria 5339
500 Ga0496111_0001851 3300048914 Bacteria 12479
501 Ga0496111_0049002 3300048914 Bacteria 3046
502 Ga0496112_0009799 3300048915 Bacteria 8653
503 Ga0496112_0011344 3300048915 Bacteria 8134
504 Ga0496112_0412007 3300048915 Bacteria 1290
505 Ga0496114_0005601 3300048917 Bacteria 9846
506 Ga0501209_021571 3300049656 Bacteria 1533
507 Ga0501216_012338 3300049660 Bacteria 1402
508 Ga0501217_009851 3300049661 Bacteria 2085
509 Ga0501223_026426 3300049663 Bacteria 1129
510 Ga0501230_028954 3300049667 Bacteria 1021
511 Ga0501235_020823 3300049669 Bacteria 1456
512 Ga0501249_001127 3300049679 Bacteria 5635
513 Ga0501257_057914 3300049686 Bacteria 975
514 Ga0501258_007531 3300049687 Bacteria 1103
515 Ga0501221_001664 3300049704 Bacteria 3691
516 Ga0501270_033514 3300049767 Bacteria 860
517 Ga0501272_011791 3300049769 Bacteria 987
518 Ga0501283_023880 3300049779 Bacteria 994
519 Ga0501204_014674 3300049850 Bacteria 964
520 nmdc:mga06r32_2711_c1 3300050510 Bacteria 15846
521 nmdc:mga08y16_1163425_c1 3300050511 Bacteria 744
522 nmdc:mga08y16_232229_c1 3300050511 Bacteria 1908
523 Ga0466962_0046673 3300061719 Bacteria 2070
524 Ga0466962_0085196 3300061719 Bacteria 1513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10594412 Ga0111539_105944122 147
2 3300050511 nmdc:mga08y16_1163425_c1 nmdc:mga08y16_1163425_c1_23_559 147
3 3300031901 Ga0307406_10283793 Ga0307406_102837932 154
4 3300005353 Ga0070669_100315551 Ga0070669_1003155512 156
5 3300005441 Ga0070700_100985282 Ga0070700_1009852821 156
6 3300025923 Ga0207681_10074964 Ga0207681_100749642 156
7 3300005844 Ga0068862_100116174 Ga0068862_1001161742 157
8 3300028380 Ga0268265_10195492 Ga0268265_101954922 157
9 3300031731 Ga0307405_10052449 Ga0307405_100524493 158
10 3300031852 Ga0307410_10484048 Ga0307410_104840481 158
11 3300032002 Ga0307416_100574686 Ga0307416_1005746861 158
12 3300032004 Ga0307414_10112254 Ga0307414_101122542 158
13 3300032005 Ga0307411_10021320 Ga0307411_100213202 158
14 3300014326 Ga0157380_10000743 Ga0157380_100007439 159
15 3300005347 Ga0070668_100157807 Ga0070668_1001578072 160
16 3300005347 Ga0070668_100317428 Ga0070668_1003174281 160
17 3300005353 Ga0070669_100354331 Ga0070669_1003543312 160
18 3300005577 Ga0068857_100931333 Ga0068857_1009313332 160
19 3300005844 Ga0068862_101012889 Ga0068862_1010128891 160
20 3300025923 Ga0207681_10170124 Ga0207681_101701242 160
21 3300025972 Ga0207668_10141127 Ga0207668_101411272 160
22 3300025972 Ga0207668_10144269 Ga0207668_101442692 160
23 3300031548 Ga0307408_100095562 Ga0307408_1000955622 160
24 3300046664 Ga0495659_0120730 Ga0495659_0120730_240_776 160
25 3300027682 Ga0209971_1025046 Ga0209971_10250462 161
26 3300031731 Ga0307405_10130708 Ga0307405_101307082 161
27 3300031824 Ga0307413_10152183 Ga0307413_101521832 161
28 3300031901 Ga0307406_10090707 Ga0307406_100907072 161
29 3300031995 Ga0307409_100001426 Ga0307409_1000014266 161
30 3300032126 Ga0307415_100019323 Ga0307415_1000193234 161
31 3300005347 Ga0070668_100057277 Ga0070668_1000572773 162
32 3300005355 Ga0070671_100271604 Ga0070671_1002716042 162
33 3300005364 Ga0070673_100707949 Ga0070673_1007079492 162
34 3300005455 Ga0070663_100197635 Ga0070663_1001976352 162
35 3300005539 Ga0068853_100231927 Ga0068853_1002319272 162
36 3300005616 Ga0068852_101037627 Ga0068852_1010376271 162
37 3300005617 Ga0068859_100908229 Ga0068859_1009082292 162
38 3300005719 Ga0068861_101136565 Ga0068861_1011365651 162
39 3300005842 Ga0068858_100249944 Ga0068858_1002499442 162
40 3300006881 Ga0068865_100175050 Ga0068865_1001750502 162
41 3300006931 Ga0097620_100908212 Ga0097620_1009082122 162
42 3300009177 Ga0105248_10015455 Ga0105248_100154558 162
43 3300013306 Ga0163162_10025551 Ga0163162_100255512 162
44 3300013308 Ga0157375_10002721 Ga0157375_1000272112 162
45 3300014326 Ga0157380_10912323 Ga0157380_109123231 162
46 3300031731 Ga0307405_10002439 Ga0307405_100024398 162
47 3300031824 Ga0307413_10109112 Ga0307413_101091122 162
48 3300031852 Ga0307410_10065493 Ga0307410_100654932 162
49 3300031903 Ga0307407_10026018 Ga0307407_100260185 162
50 3300031911 Ga0307412_10013021 Ga0307412_100130213 162
51 3300031995 Ga0307409_100118067 Ga0307409_1001180672 162
52 3300032002 Ga0307416_100009009 Ga0307416_1000090092 162
53 3300032004 Ga0307414_10016360 Ga0307414_100163604 162
54 3300032005 Ga0307411_10061224 Ga0307411_100612241 162
55 3300032126 Ga0307415_100116758 Ga0307415_1001167582 162
56 3300049656 Ga0501209_021571 Ga0501209_021571_53_691 162
57 3300049660 Ga0501216_012338 Ga0501216_012338_108_746 162
58 3300049661 Ga0501217_009851 Ga0501217_009851_1412_2050 162
59 3300049663 Ga0501223_026426 Ga0501223_026426_218_856 162
60 3300049667 Ga0501230_028954 Ga0501230_028954_36_674 162
61 3300049669 Ga0501235_020823 Ga0501235_020823_497_1135 162
62 3300049679 Ga0501249_001127 Ga0501249_001127_1517_2155 162
63 3300049686 Ga0501257_057914 Ga0501257_057914_232_870 162
64 3300049687 Ga0501258_007531 Ga0501258_007531_277_915 162
65 3300049704 Ga0501221_001664 Ga0501221_001664_339_977 162
66 3300049767 Ga0501270_033514 Ga0501270_033514_141_779 162
67 3300049769 Ga0501272_011791 Ga0501272_011791_212_850 162
68 3300049779 Ga0501283_023880 Ga0501283_023880_36_674 162
69 3300049850 Ga0501204_014674 Ga0501204_014674_272_910 162
70 3300017792 Ga0163161_10005605 Ga0163161_100056057 163
71 3300025931 Ga0207644_11034895 Ga0207644_110348951 163
72 3300025941 Ga0207711_10031426 Ga0207711_100314262 163
73 3300026035 Ga0207703_10296770 Ga0207703_102967702 163
74 3300026041 Ga0207639_10315813 Ga0207639_103158132 163
75 3300026067 Ga0207678_10109077 Ga0207678_101090772 163
76 3300026118 Ga0207675_100337126 Ga0207675_1003371261 163
77 3300026142 Ga0207698_10856131 Ga0207698_108561311 163
78 3300031824 Ga0307413_11007247 Ga0307413_110072471 163
79 3300048910 Ga0496107_0015909 Ga0496107_0015909_1273_1935 163
80 3300048912 Ga0496109_0221268 Ga0496109_0221268_815_1477 163
81 3300048913 Ga0496110_0022628 Ga0496110_0022628_4475_5137 163
82 3300048914 Ga0496111_0049002 Ga0496111_0049002_1297_1959 163
83 3300048917 Ga0496114_0005601 Ga0496114_0005601_6313_6975 163
84 3300031824 Ga0307413_10008551 Ga0307413_100085516 164
85 3300031852 Ga0307410_10024012 Ga0307410_100240123 164
86 3300031903 Ga0307407_10102819 Ga0307407_101028192 164
87 3300032004 Ga0307414_10074658 Ga0307414_100746582 164
88 3300032005 Ga0307411_10004534 Ga0307411_100045342 164
89 3300025893 Ga0207682_10106153 Ga0207682_101061532 165
90 3300031548 Ga0307408_100231015 Ga0307408_1002310152 165
91 3300014326 Ga0157380_10693907 Ga0157380_106939071 166
92 3300031995 Ga0307409_100393647 Ga0307409_1003936472 166
93 3300005435 Ga0070714_100553058 Ga0070714_1005530582 167
94 3300027876 Ga0209974_10000170 Ga0209974_100001709 167
95 3300031548 Ga0307408_100558087 Ga0307408_1005580871 167
96 3300031731 Ga0307405_10004000 Ga0307405_100040006 167
97 3300031824 Ga0307413_10012194 Ga0307413_100121942 167
98 3300031824 Ga0307413_10027348 Ga0307413_100273482 167
99 3300031852 Ga0307410_10016156 Ga0307410_100161563 167
100 3300031901 Ga0307406_10011631 Ga0307406_100116315 167
101 3300031901 Ga0307406_10025347 Ga0307406_100253472 167
102 3300031903 Ga0307407_10008654 Ga0307407_100086543 167
103 3300031903 Ga0307407_10292533 Ga0307407_102925332 167
104 3300031911 Ga0307412_10013987 Ga0307412_100139872 167
105 3300031911 Ga0307412_10122572 Ga0307412_101225722 167
106 3300031911 Ga0307412_10201069 Ga0307412_102010692 167
107 3300031995 Ga0307409_100762631 Ga0307409_1007626312 167
108 3300032002 Ga0307416_100007235 Ga0307416_1000072358 167
109 3300032002 Ga0307416_100041851 Ga0307416_1000418513 167
110 3300032002 Ga0307416_100340730 Ga0307416_1003407302 167
111 3300032005 Ga0307411_10059379 Ga0307411_100593792 167
112 3300032005 Ga0307411_10062328 Ga0307411_100623283 167
113 3300032005 Ga0307411_10235652 Ga0307411_102356522 167
114 3300032005 Ga0307411_10297703 Ga0307411_102977032 167
115 3300032126 Ga0307415_100015686 Ga0307415_1000156865 167
116 3300031901 Ga0307406_10377061 Ga0307406_103770612 168
117 3300037418 Ga0395900_0001005 Ga0395900_0001005_20051_20701 168
118 3300037466 Ga0395898_0240600 Ga0395898_0240600_888_1538 168
119 3300037471 Ga0395905_0000128 Ga0395905_0000128_9362_10012 168
120 3300038443 Ga0395901_0003812 Ga0395901_0003812_10717_11367 168
121 3300045976 Ga0466967_0188712 Ga0466967_0188712_69_653 168
122 3300006847 Ga0075431_100073975 Ga0075431_1000739752 169
123 3300009177 Ga0105248_10041406 Ga0105248_100414066 169
124 3300025931 Ga0207644_10054326 Ga0207644_100543265 169
125 3300025941 Ga0207711_10026817 Ga0207711_100268176 169
126 3300044693 Ga0466961_0036424 Ga0466961_0036424_1878_2504 169
127 3300044765 Ga0466970_0382095 Ga0466970_0382095_94_720 169
128 3300044842 Ga0466957_0197055 Ga0466957_0197055_581_1201 169
129 3300046525 Ga0495663_0008266 Ga0495663_0008266_1740_2366 169
130 3300046539 Ga0495621_0003239 Ga0495621_0003239_3836_4462 169
131 3300046691 Ga0495670_0024838 Ga0495670_0024838_1716_2342 169
132 3300047445 Ga0495677_0183638 Ga0495677_0183638_12_638 169
133 3300048915 Ga0496112_0011344 Ga0496112_0011344_6679_7305 169
134 3300005530 Ga0070679_100213668 Ga0070679_1002136682 170
135 3300025921 Ga0207652_10180092 Ga0207652_101800922 170
136 3300026116 Ga0207674_10011365 Ga0207674_100113656 170
137 3300031731 Ga0307405_10522836 Ga0307405_105228362 170
138 3300031911 Ga0307412_10751149 Ga0307412_107511491 170
139 3300031995 Ga0307409_101335757 Ga0307409_1013357571 170
140 3300032004 Ga0307414_10213135 Ga0307414_102131352 170
141 3300046616 Ga0495668_0072563 Ga0495668_0072563_958_1605 170
142 3300050510 nmdc:mga06r32_2711_c1 nmdc:mga06r32_2711_c1_13716_14360 170
143 3300005336 Ga0070680_100001313 Ga0070680_10000131311 171
144 3300005353 Ga0070669_100242622 Ga0070669_1002426222 171
145 3300005354 Ga0070675_100547970 Ga0070675_1005479702 171
146 3300005563 Ga0068855_100225536 Ga0068855_1002255362 171
147 3300013100 Ga0157373_10244735 Ga0157373_102447351 171
148 3300013105 Ga0157369_10356362 Ga0157369_103563622 171
149 3300013105 Ga0157369_10505986 Ga0157369_105059862 171
150 3300025315 Ga0207697_10084843 Ga0207697_100848431 171
151 3300025923 Ga0207681_10220365 Ga0207681_102203652 171
152 3300025926 Ga0207659_10283294 Ga0207659_102832942 171
153 3300025933 Ga0207706_10211192 Ga0207706_102111922 171
154 3300025949 Ga0207667_10309098 Ga0207667_103090982 171
155 3300037471 Ga0395905_0457254 Ga0395905_0457254_331_939 171
156 3300046528 Ga0495642_0063890 Ga0495642_0063890_712_1338 171
157 3300061719 Ga0466962_0085196 Ga0466962_0085196_878_1486 171
158 3300001990 JGI24737J22298_10053878 JGI24737J22298_100538782 172
159 3300005327 Ga0070658_10041142 Ga0070658_100411423 172
160 3300005331 Ga0070670_101123137 Ga0070670_1011231371 172
161 3300005364 Ga0070673_100288535 Ga0070673_1002885352 172
162 3300005455 Ga0070663_100040535 Ga0070663_1000405353 172
163 3300005459 Ga0068867_100301117 Ga0068867_1003011172 172
164 3300005564 Ga0070664_100068993 Ga0070664_1000689931 172
165 3300005578 Ga0068854_100038416 Ga0068854_1000384162 172
166 3300005578 Ga0068854_100986280 Ga0068854_1009862801 172
167 3300005614 Ga0068856_100045520 Ga0068856_1000455203 172
168 3300005834 Ga0068851_10109534 Ga0068851_101095342 172
169 3300006237 Ga0097621_100119720 Ga0097621_1001197202 172
170 3300009177 Ga0105248_10168485 Ga0105248_101684852 172
171 3300013100 Ga0157373_10136847 Ga0157373_101368472 172
172 3300025321 Ga0207656_10154208 Ga0207656_101542082 172
173 3300025925 Ga0207650_10754342 Ga0207650_107543421 172
174 3300025931 Ga0207644_10057571 Ga0207644_100575712 172
175 3300025931 Ga0207644_10295201 Ga0207644_102952012 172
176 3300025933 Ga0207706_10368332 Ga0207706_103683322 172
177 3300025941 Ga0207711_10089903 Ga0207711_100899032 172
178 3300025945 Ga0207679_10367097 Ga0207679_103670972 172
179 3300025981 Ga0207640_10008846 Ga0207640_100088466 172
180 3300026067 Ga0207678_10018879 Ga0207678_100188795 172
181 3300026078 Ga0207702_10052958 Ga0207702_100529584 172
182 3300026089 Ga0207648_10221516 Ga0207648_102215162 172
183 3300026095 Ga0207676_10045195 Ga0207676_100451953 172
184 3300026142 Ga0207698_10405690 Ga0207698_104056902 172
185 3300028379 Ga0268266_10365191 Ga0268266_103651912 172
186 3300031852 Ga0307410_10016521 Ga0307410_100165211 172
187 3300032004 Ga0307414_10014541 Ga0307414_100145413 172
188 3300037471 Ga0395905_0030134 Ga0395905_0030134_4300_4932 172
189 3300044684 Ga0466966_0043165 Ga0466966_0043165_1950_2582 172
190 3300048905 Ga0496102_0765692 Ga0496102_0765692_233_862 172
191 3300048907 Ga0496104_0195662 Ga0496104_0195662_687_1319 172
192 3300048911 Ga0496108_0168275 Ga0496108_0168275_1060_1692 172
193 3300048913 Ga0496110_0011708 Ga0496110_0011708_4143_4775 172
194 3300048915 Ga0496112_0412007 Ga0496112_0412007_361_993 172
195 iso_pu_bacteria 2885427238 2885428847 172
196 3300001977 JGI24746J21847_1007738 JGI24746J21847_10077382 173
197 3300002070 JGI24750J21931_1032392 JGI24750J21931_10323921 173
198 3300002076 JGI24749J21850_1007612 JGI24749J21850_10076122 173
199 3300005293 Ga0065715_10000733 Ga0065715_100007333 173
200 3300005327 Ga0070658_10375249 Ga0070658_103752492 173
201 3300005328 Ga0070676_10006117 Ga0070676_100061178 173
202 3300005331 Ga0070670_100004328 Ga0070670_1000043286 173
203 3300005333 Ga0070677_10003092 Ga0070677_100030924 173
204 3300005335 Ga0070666_10068191 Ga0070666_100681912 173
205 3300005336 Ga0070680_100071053 Ga0070680_1000710532 173
206 3300005336 Ga0070680_100180123 Ga0070680_1001801232 173
207 3300005336 Ga0070680_100208760 Ga0070680_1002087602 173
208 3300005339 Ga0070660_100130490 Ga0070660_1001304902 173
209 3300005344 Ga0070661_100038351 Ga0070661_1000383512 173
210 3300005347 Ga0070668_100003373 Ga0070668_1000033732 173
211 3300005353 Ga0070669_100000714 Ga0070669_10000071418 173
212 3300005354 Ga0070675_100000410 Ga0070675_10000041010 173
213 3300005355 Ga0070671_100003073 Ga0070671_1000030739 173
214 3300005356 Ga0070674_100000855 Ga0070674_10000085511 173
215 3300005366 Ga0070659_100031589 Ga0070659_1000315892 173
216 3300005366 Ga0070659_100047299 Ga0070659_1000472993 173
217 3300005366 Ga0070659_100086591 Ga0070659_1000865912 173
218 3300005366 Ga0070659_100669248 Ga0070659_1006692481 173
219 3300005367 Ga0070667_100039219 Ga0070667_1000392192 173
220 3300005438 Ga0070701_10108632 Ga0070701_101086322 173
221 3300005455 Ga0070663_100374382 Ga0070663_1003743821 173
222 3300005457 Ga0070662_100000230 Ga0070662_10000023010 173
223 3300005458 Ga0070681_10038415 Ga0070681_100384155 173
224 3300005458 Ga0070681_10102974 Ga0070681_101029742 173
225 3300005459 Ga0068867_100010095 Ga0068867_1000100957 173
226 3300005530 Ga0070679_100032785 Ga0070679_1000327853 173
227 3300005539 Ga0068853_100566497 Ga0068853_1005664972 173
228 3300005543 Ga0070672_100002028 Ga0070672_1000020288 173
229 3300005549 Ga0070704_100097113 Ga0070704_1000971132 173
230 3300005564 Ga0070664_100021419 Ga0070664_1000214195 173
231 3300005564 Ga0070664_100031253 Ga0070664_1000312536 173
232 3300005577 Ga0068857_100226359 Ga0068857_1002263592 173
233 3300005578 Ga0068854_100058992 Ga0068854_1000589922 173
234 3300005617 Ga0068859_100016407 Ga0068859_1000164074 173
235 3300005618 Ga0068864_100024183 Ga0068864_1000241836 173
236 3300005840 Ga0068870_10067179 Ga0068870_100671792 173
237 3300005843 Ga0068860_100071380 Ga0068860_1000713802 173
238 3300005844 Ga0068862_100020853 Ga0068862_1000208536 173
239 3300006931 Ga0097620_100016407 Ga0097620_1000164074 173
240 3300009094 Ga0111539_10028693 Ga0111539_100286933 173
241 3300009553 Ga0105249_10010976 Ga0105249_100109766 173
242 3300014326 Ga0157380_10002497 Ga0157380_1000249710 173
243 3300017792 Ga0163161_10005788 Ga0163161_100057883 173
244 3300025315 Ga0207697_10001412 Ga0207697_1000141210 173
245 3300025893 Ga0207682_10000869 Ga0207682_100008699 173
246 3300025901 Ga0207688_10007823 Ga0207688_100078232 173
247 3300025907 Ga0207645_10064192 Ga0207645_100641923 173
248 3300025908 Ga0207643_10058843 Ga0207643_100588432 173
249 3300025909 Ga0207705_10437192 Ga0207705_104371922 173
250 3300025912 Ga0207707_10199167 Ga0207707_101991672 173
251 3300025917 Ga0207660_10261431 Ga0207660_102614312 173
252 3300025920 Ga0207649_10036061 Ga0207649_100360612 173
253 3300025921 Ga0207652_10849844 Ga0207652_108498441 173
254 3300025923 Ga0207681_10000376 Ga0207681_1000037629 173
255 3300025925 Ga0207650_10003665 Ga0207650_1000366510 173
256 3300025926 Ga0207659_10000215 Ga0207659_1000021529 173
257 3300025931 Ga0207644_10002558 Ga0207644_100025582 173
258 3300025932 Ga0207690_10137727 Ga0207690_101377272 173
259 3300025932 Ga0207690_10724160 Ga0207690_107241601 173
260 3300025933 Ga0207706_10000378 Ga0207706_1000037836 173
261 3300025933 Ga0207706_10000557 Ga0207706_1000055710 173
262 3300025937 Ga0207669_10003525 Ga0207669_100035255 173
263 3300025940 Ga0207691_10001956 Ga0207691_100019568 173
264 3300025945 Ga0207679_10007501 Ga0207679_100075014 173
265 3300025945 Ga0207679_10117907 Ga0207679_101179072 173
266 3300025961 Ga0207712_10017790 Ga0207712_100177902 173
267 3300025972 Ga0207668_10000233 Ga0207668_100002338 173
268 3300025981 Ga0207640_10112017 Ga0207640_101120172 173
269 3300026067 Ga0207678_10039635 Ga0207678_100396353 173
270 3300026067 Ga0207678_10271437 Ga0207678_102714372 173
271 3300026067 Ga0207678_10325698 Ga0207678_103256982 173
272 3300026075 Ga0207708_10244654 Ga0207708_102446542 173
273 3300026089 Ga0207648_10005688 Ga0207648_100056882 173
274 3300026095 Ga0207676_10021148 Ga0207676_100211482 173
275 3300026116 Ga0207674_10248078 Ga0207674_102480782 173
276 3300026121 Ga0207683_10694825 Ga0207683_106948251 173
277 3300027907 Ga0207428_10123455 Ga0207428_101234552 173
278 3300028380 Ga0268265_10231729 Ga0268265_102317292 173
279 3300031824 Ga0307413_10761154 Ga0307413_107611542 173
280 3300031852 Ga0307410_10094638 Ga0307410_100946382 173
281 3300031901 Ga0307406_10081414 Ga0307406_100814142 173
282 3300031903 Ga0307407_10062993 Ga0307407_100629933 173
283 3300031911 Ga0307412_10731322 Ga0307412_107313221 173
284 3300032002 Ga0307416_100900926 Ga0307416_1009009262 173
285 3300032004 Ga0307414_10407679 Ga0307414_104076792 173
286 3300032004 Ga0307414_10491216 Ga0307414_104912162 173
287 3300032005 Ga0307411_10001278 Ga0307411_100012782 173
288 3300032005 Ga0307411_10024976 Ga0307411_100249762 173
289 3300032126 Ga0307415_100778041 Ga0307415_1007780411 173
290 3300037312 Ga0395899_0070990 Ga0395899_0070990_1143_1775 173
291 3300037418 Ga0395900_0026202 Ga0395900_0026202_1288_1989 173
292 3300037466 Ga0395898_0014896 Ga0395898_0014896_4702_5334 173
293 3300037471 Ga0395905_0059243 Ga0395905_0059243_1315_1947 173
294 3300037471 Ga0395905_0313866 Ga0395905_0313866_292_993 173
295 3300038443 Ga0395901_0084384 Ga0395901_0084384_1128_1829 173
296 3300050511 nmdc:mga08y16_232229_c1 nmdc:mga08y16_232229_c1_605_1252 173
297 3300001989 JGI24739J22299_10042427 JGI24739J22299_100424272 174
298 3300002077 JGI24744J21845_10000079 JGI24744J21845_1000007910 174
299 3300005333 Ga0070677_10170815 Ga0070677_101708152 174
300 3300005334 Ga0068869_100125270 Ga0068869_1001252702 174
301 3300005335 Ga0070666_10803536 Ga0070666_108035361 174
302 3300005338 Ga0068868_100142705 Ga0068868_1001427052 174
303 3300005339 Ga0070660_100064232 Ga0070660_1000642322 174
304 3300005364 Ga0070673_100131244 Ga0070673_1001312442 174
305 3300005366 Ga0070659_100078966 Ga0070659_1000789662 174
306 3300005455 Ga0070663_100054421 Ga0070663_1000544213 174
307 3300005457 Ga0070662_100064386 Ga0070662_1000643862 174
308 3300005458 Ga0070681_10219383 Ga0070681_102193832 174
309 3300005543 Ga0070672_100054735 Ga0070672_1000547353 174
310 3300005578 Ga0068854_100032155 Ga0068854_1000321552 174
311 3300005616 Ga0068852_100482772 Ga0068852_1004827722 174
312 3300005718 Ga0068866_10023584 Ga0068866_100235843 174
313 3300006881 Ga0068865_100035287 Ga0068865_1000352871 174
314 3300013100 Ga0157373_10187908 Ga0157373_101879082 174
315 3300013297 Ga0157378_10036975 Ga0157378_100369757 174
316 3300013308 Ga0157375_10844328 Ga0157375_108443282 174
317 3300025893 Ga0207682_10013481 Ga0207682_100134815 174
318 3300025899 Ga0207642_10007534 Ga0207642_100075342 174
319 3300025901 Ga0207688_10043506 Ga0207688_100435062 174
320 3300025903 Ga0207680_10521686 Ga0207680_105216862 174
321 3300025907 Ga0207645_10066220 Ga0207645_100662202 174
322 3300025918 Ga0207662_10204551 Ga0207662_102045511 174
323 3300025919 Ga0207657_10078612 Ga0207657_100786122 174
324 3300025932 Ga0207690_10033129 Ga0207690_100331292 174
325 3300025933 Ga0207706_10116711 Ga0207706_101167112 174
326 3300025938 Ga0207704_10014668 Ga0207704_100146682 174
327 3300025942 Ga0207689_10011938 Ga0207689_100119385 174
328 3300025960 Ga0207651_10016944 Ga0207651_100169442 174
329 3300025981 Ga0207640_10032594 Ga0207640_100325944 174
330 3300026023 Ga0207677_10061429 Ga0207677_100614292 174
331 3300026067 Ga0207678_10053088 Ga0207678_100530882 174
332 3300026089 Ga0207648_10002819 Ga0207648_100028192 174
333 3300026142 Ga0207698_10384933 Ga0207698_103849332 174
334 3300037418 Ga0395900_0015800 Ga0395900_0015800_2320_2949 174
335 3300044684 Ga0466966_0307482 Ga0466966_0307482_286_915 174
336 3300044719 Ga0466971_0047890 Ga0466971_0047890_82_714 174
337 3300044765 Ga0466970_0139931 Ga0466970_0139931_445_1077 174
338 3300045836 Ga0466958_0160675 Ga0466958_0160675_562_1194 174
339 3300048905 Ga0496102_0155023 Ga0496102_0155023_568_1200 174
340 3300048906 Ga0496103_0038726 Ga0496103_0038726_1109_1741 174
341 3300061719 Ga0466962_0046673 Ga0466962_0046673_518_1147 174
342 3300031852 Ga0307410_10318413 Ga0307410_103184131 175
343 3300031901 Ga0307406_10163711 Ga0307406_101637112 175
344 3300031995 Ga0307409_100037278 Ga0307409_1000372783 175
345 3300032002 Ga0307416_100327123 Ga0307416_1003271232 175
346 3300032004 Ga0307414_10193376 Ga0307414_101933762 175
347 3300032004 Ga0307414_10325717 Ga0307414_103257172 175
348 3300032005 Ga0307411_10068245 Ga0307411_100682453 175
349 3300044842 Ga0466957_0155147 Ga0466957_0155147_837_1469 175
350 3300045976 Ga0466967_0082319 Ga0466967_0082319_229_861 175
351 3300005329 Ga0070683_100552509 Ga0070683_1005525092 176
352 3300005339 Ga0070660_100076986 Ga0070660_1000769862 176
353 3300005366 Ga0070659_100089122 Ga0070659_1000891222 176
354 3300005436 Ga0070713_100056673 Ga0070713_1000566734 176
355 3300005457 Ga0070662_100007321 Ga0070662_1000073213 176
356 3300005458 Ga0070681_10010885 Ga0070681_100108853 176
357 3300005530 Ga0070679_100059664 Ga0070679_1000596643 176
358 3300005539 Ga0068853_100103225 Ga0068853_1001032253 176
359 3300005618 Ga0068864_100965957 Ga0068864_1009659572 176
360 3300013100 Ga0157373_10057275 Ga0157373_100572753 176
361 3300013105 Ga0157369_10521906 Ga0157369_105219062 176
362 3300025909 Ga0207705_10104914 Ga0207705_101049142 176
363 3300025912 Ga0207707_10009893 Ga0207707_100098933 176
364 3300025919 Ga0207657_10002445 Ga0207657_100024453 176
365 3300025921 Ga0207652_10663514 Ga0207652_106635141 176
366 3300025925 Ga0207650_10055903 Ga0207650_100559033 176
367 3300025929 Ga0207664_10216916 Ga0207664_102169162 176
368 3300025944 Ga0207661_10441819 Ga0207661_104418191 176
369 3300026041 Ga0207639_10087102 Ga0207639_100871023 176
370 3300031731 Ga0307405_10219263 Ga0307405_102192632 176
371 3300031824 Ga0307413_10035286 Ga0307413_100352862 176
372 3300031852 Ga0307410_10139382 Ga0307410_101393821 176
373 3300031901 Ga0307406_10013782 Ga0307406_100137822 176
374 3300031911 Ga0307412_10537320 Ga0307412_105373202 176
375 3300031995 Ga0307409_100327553 Ga0307409_1003275532 176
376 3300032002 Ga0307416_100498477 Ga0307416_1004984772 176
377 3300032004 Ga0307414_10114544 Ga0307414_101145442 176
378 3300032005 Ga0307411_10068649 Ga0307411_100686491 176
379 3300032126 Ga0307415_100014963 Ga0307415_1000149632 176
380 3300037312 Ga0395899_0067467 Ga0395899_0067467_1214_1837 176
381 3300037418 Ga0395900_0200948 Ga0395900_0200948_925_1548 176
382 3300037418 Ga0395900_0389216 Ga0395900_0389216_715_1338 176
383 3300038443 Ga0395901_0120545 Ga0395901_0120545_694_1317 176
384 3300044684 Ga0466966_0088625 Ga0466966_0088625_263_883 176
385 3300044693 Ga0466961_0071958 Ga0466961_0071958_230_850 176
386 3300044719 Ga0466971_0013690 Ga0466971_0013690_482_1102 176
387 3300045049 Ga0466959_0606074 Ga0466959_0606074_67_687 176
388 3300045836 Ga0466958_0039140 Ga0466958_0039140_2074_2694 176
389 3300005327 Ga0070658_10158355 Ga0070658_101583552 177
390 3300005327 Ga0070658_10520258 Ga0070658_105202582 177
391 3300005339 Ga0070660_100118743 Ga0070660_1001187432 177
392 3300005344 Ga0070661_100082063 Ga0070661_1000820632 177
393 3300005355 Ga0070671_100002716 Ga0070671_10000271611 177
394 3300005364 Ga0070673_100109852 Ga0070673_1001098522 177
395 3300005366 Ga0070659_100384134 Ga0070659_1003841342 177
396 3300005367 Ga0070667_100195072 Ga0070667_1001950722 177
397 3300005564 Ga0070664_100019027 Ga0070664_1000190273 177
398 3300005616 Ga0068852_100072470 Ga0068852_1000724702 177
399 3300005618 Ga0068864_100051540 Ga0068864_1000515403 177
400 3300005841 Ga0068863_100106630 Ga0068863_1001066302 177
401 3300006237 Ga0097621_100440632 Ga0097621_1004406322 177
402 3300009177 Ga0105248_10002873 Ga0105248_1000287317 177
403 3300025909 Ga0207705_10205406 Ga0207705_102054062 177
404 3300025919 Ga0207657_10121060 Ga0207657_101210602 177
405 3300025931 Ga0207644_10001983 Ga0207644_100019839 177
406 3300025932 Ga0207690_10332530 Ga0207690_103325302 177
407 3300025933 Ga0207706_10677029 Ga0207706_106770291 177
408 3300025941 Ga0207711_10000055 Ga0207711_1000005521 177
409 3300025945 Ga0207679_10054548 Ga0207679_100545481 177
410 3300025960 Ga0207651_10029479 Ga0207651_100294793 177
411 3300025986 Ga0207658_10165145 Ga0207658_101651452 177
412 3300026088 Ga0207641_10099229 Ga0207641_100992292 177
413 3300026095 Ga0207676_10117544 Ga0207676_101175442 177
414 3300031903 Ga0307407_10053800 Ga0307407_100538002 177
415 3300045976 Ga0466967_0251154 Ga0466967_0251154_494_1123 177
416 3300046525 Ga0495663_0063743 Ga0495663_0063743_130_759 177
417 3300046528 Ga0495642_0032759 Ga0495642_0032759_675_1304 177
418 3300048904 Ga0496101_0008073 Ga0496101_0008073_4537_5166 177
419 3300048909 Ga0496106_0008395 Ga0496106_0008395_5427_6056 177
420 3300048910 Ga0496107_0001705 Ga0496107_0001705_4047_4676 177
421 3300048911 Ga0496108_0048801 Ga0496108_0048801_1010_1639 177
422 3300048912 Ga0496109_0046592 Ga0496109_0046592_311_940 177
423 3300048913 Ga0496110_0009252 Ga0496110_0009252_1308_1937 177
424 3300048914 Ga0496111_0001851 Ga0496111_0001851_2253_2882 177
425 3300048915 Ga0496112_0009799 Ga0496112_0009799_431_1060 177
426 3300002075 JGI24738J21930_10016704 JGI24738J21930_100167042 178
427 3300005331 Ga0070670_100043409 Ga0070670_1000434092 178
428 3300005339 Ga0070660_100285329 Ga0070660_1002853292 178
429 3300005344 Ga0070661_100032148 Ga0070661_1000321485 178
430 3300005355 Ga0070671_100073336 Ga0070671_1000733362 178
431 3300005355 Ga0070671_100123093 Ga0070671_1001230932 178
432 3300005356 Ga0070674_100024054 Ga0070674_1000240547 178
433 3300005364 Ga0070673_100132789 Ga0070673_1001327892 178
434 3300005435 Ga0070714_100106078 Ga0070714_1001060782 178
435 3300005456 Ga0070678_100008631 Ga0070678_1000086318 178
436 3300005456 Ga0070678_100505515 Ga0070678_1005055152 178
437 3300005457 Ga0070662_100033130 Ga0070662_1000331303 178
438 3300005457 Ga0070662_100033215 Ga0070662_1000332152 178
439 3300005457 Ga0070662_100072267 Ga0070662_1000722672 178
440 3300005459 Ga0068867_100050293 Ga0068867_1000502931 178
441 3300005543 Ga0070672_100020660 Ga0070672_1000206602 178
442 3300005543 Ga0070672_100416203 Ga0070672_1004162032 178
443 3300005564 Ga0070664_100273653 Ga0070664_1002736532 178
444 3300005718 Ga0068866_10242788 Ga0068866_102427882 178
445 3300005842 Ga0068858_100799760 Ga0068858_1007997602 178
446 3300009177 Ga0105248_10230880 Ga0105248_102308802 178
447 3300013100 Ga0157373_10057023 Ga0157373_100570232 178
448 3300017792 Ga0163161_10010334 Ga0163161_100103343 178
449 3300025315 Ga0207697_10168778 Ga0207697_101687782 178
450 3300025901 Ga0207688_10059031 Ga0207688_100590312 178
451 3300025904 Ga0207647_10044274 Ga0207647_100442742 178
452 3300025907 Ga0207645_10062732 Ga0207645_100627322 178
453 3300025919 Ga0207657_10059384 Ga0207657_100593842 178
454 3300025920 Ga0207649_10020613 Ga0207649_100206133 178
455 3300025931 Ga0207644_10015737 Ga0207644_100157373 178
456 3300025931 Ga0207644_10142042 Ga0207644_101420422 178
457 3300025932 Ga0207690_10149230 Ga0207690_101492302 178
458 3300025933 Ga0207706_10011585 Ga0207706_100115854 178
459 3300025933 Ga0207706_10124000 Ga0207706_101240002 178
460 3300025933 Ga0207706_10178493 Ga0207706_101784932 178
461 3300025937 Ga0207669_10311252 Ga0207669_103112522 178
462 3300025940 Ga0207691_10085412 Ga0207691_100854123 178
463 3300025940 Ga0207691_10123293 Ga0207691_101232932 178
464 3300025940 Ga0207691_10318130 Ga0207691_103181302 178
465 3300025942 Ga0207689_10109530 Ga0207689_101095302 178
466 3300025945 Ga0207679_10059284 Ga0207679_100592843 178
467 3300025960 Ga0207651_10120528 Ga0207651_101205282 178
468 3300026023 Ga0207677_10189787 Ga0207677_101897872 178
469 3300026088 Ga0207641_10666141 Ga0207641_106661411 178
470 3300026089 Ga0207648_10193143 Ga0207648_101931431 178
471 3300026116 Ga0207674_10222297 Ga0207674_102222972 178
472 3300026121 Ga0207683_10063894 Ga0207683_100638944 178
473 3300026121 Ga0207683_10125289 Ga0207683_101252892 178
474 3300026121 Ga0207683_10157029 Ga0207683_101570292 178
475 3300026121 Ga0207683_10297113 Ga0207683_102971132 178
476 3300031548 Ga0307408_100167680 Ga0307408_1001676802 178
477 3300031824 Ga0307413_10004882 Ga0307413_100048821 178
478 3300031995 Ga0307409_100089144 Ga0307409_1000891442 178
479 3300032004 Ga0307414_10092131 Ga0307414_100921312 178
480 3300032004 Ga0307414_10233205 Ga0307414_102332052 178
481 3300032126 Ga0307415_100003694 Ga0307415_10000369410 178
482 3300037418 Ga0395900_0033072 Ga0395900_0033072_4208_4963 178
483 3300037418 Ga0395900_0229637 Ga0395900_0229637_1171_1803 178
484 3300037471 Ga0395905_0075778 Ga0395905_0075778_446_1081 178
485 3300037471 Ga0395905_0118888 Ga0395905_0118888_1292_1924 178
486 3300037471 Ga0395905_0128299 Ga0395905_0128299_81_713 178
487 3300044694 Ga0466963_0028781 Ga0466963_0028781_1279_1914 178
488 3300046525 Ga0495663_0003858 Ga0495663_0003858_3013_3645 178
489 3300046684 Ga0495669_0038784 Ga0495669_0038784_94_726 178
490 3300031824 Ga0307413_10517655 Ga0307413_105176552 179
491 3300005458 Ga0070681_10567366 Ga0070681_105673662 180
492 3300005530 Ga0070679_100074065 Ga0070679_1000740652 180
493 3300025912 Ga0207707_10217198 Ga0207707_102171982 180
494 3300025921 Ga0207652_10018851 Ga0207652_100188515 180
495 3300031548 Ga0307408_100156468 Ga0307408_1001564682 180
496 3300031731 Ga0307405_10008327 Ga0307405_100083274 180
497 3300031824 Ga0307413_10027756 Ga0307413_100277562 180
498 3300031852 Ga0307410_10024277 Ga0307410_100242773 180
499 3300032004 Ga0307414_10061711 Ga0307414_100617112 180
500 3300032126 Ga0307415_100058293 Ga0307415_1000582932 180
501 3300031911 Ga0307412_10211736 Ga0307412_102117362 181
502 3300032002 Ga0307416_100205742 Ga0307416_1002057422 181
503 3300032004 Ga0307414_10211781 Ga0307414_102117811 181
504 3300032005 Ga0307411_10472198 Ga0307411_104721982 181
505 3300032126 Ga0307415_100355261 Ga0307415_1003552612 181
506 3300046539 Ga0495621_0000466 Ga0495621_0000466_4697_5347 181
507 3300046691 Ga0495670_0048319 Ga0495670_0048319_1393_2043 181
508 3300031824 Ga0307413_10277311 Ga0307413_102773111 182
509 3300031852 Ga0307410_10060091 Ga0307410_100600912 182
510 3300031903 Ga0307407_10225696 Ga0307407_102256962 182
511 3300031995 Ga0307409_100257620 Ga0307409_1002576202 182
512 3300032005 Ga0307411_10091724 Ga0307411_100917242 182
513 3300031824 Ga0307413_10154148 Ga0307413_101541482 183
514 3300031852 Ga0307410_10368924 Ga0307410_103689242 183
515 3300031903 Ga0307407_10064437 Ga0307407_100644372 183
516 3300032004 Ga0307414_10087210 Ga0307414_100872102 183
517 3300046691 Ga0495670_0025124 Ga0495670_0025124_495_1145 183
518 3300030744 Ga0316181_1064600 Ga0316181_10646002 184
519 3300030745 Ga0316182_1074158 Ga0316182_10741584 184
520 3300031901 Ga0307406_10023951 Ga0307406_100239512 184
521 3300031911 Ga0307412_10052406 Ga0307412_100524064 184
522 3300032002 Ga0307416_100315935 Ga0307416_1003159352 184
523 3300032126 Ga0307415_100449937 Ga0307415_1004499371 184
524 2162886012 MBSR1b_contig_2933200 MBSR1b_0742.00004920 193
525 3300005293 Ga0065715_10122837 Ga0065715_101228373 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

61

131

0.96

Feature Viewer

pLDDT pTM Quality
71.4 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map