F459277

General Info

Members Datasets Scaffolds Average Seq Length
525 291 1050 203

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10180228|Ga0207706_101802283
Length 227
Sequence MGYEVRVEKISAPRALAVVKRRARAAEMPRVVVECCGLVWNALKAAGARDVRVTADPEVVLGAERIVLPGVGAFAACMGALSAIPGMVDALNQRVIGEGAPFLGVCVGMQLMADAGEEFGTTPGLGWIKGVVAKLAPDDPTVRIPHMGWNDVVPVVPHPLIVPGEAYFLHSFAFNVADPKTLAATTDHGGTVTAAVARDNMIGAQFHPEKSQAYGLAFLSRFLDWRP

Samples

Sample ID Description Type Environment
1 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
151 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
155 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
158 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
159 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
160 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
218 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
219 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
220 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
221 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
222 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
236 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
237 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
238 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
239 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
240 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
241 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
242 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
243 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
244 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
245 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
246 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
250 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
251 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
260 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
263 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
264 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
265 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
266 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
267 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
268 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
269 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
270 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
271 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
272 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
275 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
278 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
279 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
280 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
281 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
282 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
283 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
284 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
285 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
286 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
287 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
288 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
289 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
290 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
291 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.86
Nodule 0
Rhizoplane 2.67
Rhizosphere 76.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207706_10180228 3300025933 Bacteria 1855
2 JGI24741J21665_1008145 3300001915 Bacteria 1992
3 JGI24740J21852_10009041 3300001979 Bacteria 3922
4 JGI24740J21852_10069437 3300001979 Bacteria 948
5 JGI24739J22299_10000795 3300001989 Bacteria 11541
6 JGI24739J22299_10009497 3300001989 Bacteria 3624
7 JGI24739J22299_10040739 3300001989 Bacteria 1549
8 JGI24739J22299_10046515 3300001989 Bacteria 1420
9 JGI24737J22298_10017880 3300001990 Bacteria 2279
10 JGI24737J22298_10039805 3300001990 Bacteria 1444
11 JGI24737J22298_10108493 3300001990 Bacteria 822
12 JGI24735J21928_10002210 3300002067 Bacteria 6835
13 JGI24735J21928_10006124 3300002067 Bacteria 3973
14 JGI24738J21930_10000801 3300002075 Bacteria 9027
15 JGI24738J21930_10014543 3300002075 Bacteria 1687
16 JGI24749J21850_1000061 3300002076 Bacteria 20059
17 JGI24751J29686_10006277 3300002459 Bacteria 2422
18 JGI25165J46597_1000534 3300003214 Bacteria 35395
19 rootL2_10130408 3300003322 Bacteria 1833
20 Ga0055542_1007706 3300003762 Bacteria 2162
21 Ga0065707_10082097 3300005295 Bacteria 22143
22 Ga0065707_10125112 3300005295 Bacteria 2030
23 Ga0070658_10000542 3300005327 Bacteria 32750
24 Ga0070658_10001154 3300005327 Bacteria 22529
25 Ga0070658_10005645 3300005327 Bacteria 10146
26 Ga0070658_10052741 3300005327 Bacteria 3299
27 Ga0070676_10000448 3300005328 Bacteria 19663
28 Ga0070670_100000024 3300005331 Bacteria 189811
29 Ga0070670_100003502 3300005331 Bacteria 13049
30 Ga0068869_100002968 3300005334 Bacteria 10304
31 Ga0070666_10012352 3300005335 Bacteria 5384
32 Ga0068868_100000244 3300005338 Bacteria 36872
33 Ga0070660_100001933 3300005339 Bacteria 14280
34 Ga0070660_100002539 3300005339 Bacteria 12506
35 Ga0070660_100112798 3300005339 Bacteria 2164
36 Ga0070661_100019988 3300005344 Bacteria 4773
37 Ga0070668_100000027 3300005347 Bacteria 89913
38 Ga0070669_100000031 3300005353 Bacteria 154042
39 Ga0070669_100161061 3300005353 Bacteria 1744
40 Ga0070671_100000517 3300005355 Bacteria 27085
41 Ga0070671_100189959 3300005355 Bacteria 1741
42 Ga0070674_100011147 3300005356 Bacteria 5460
43 Ga0070673_100000020 3300005364 Bacteria 102632
44 Ga0070659_100027702 3300005366 Bacteria 4368
45 Ga0070659_100054234 3300005366 Bacteria 3157
46 Ga0070659_100174964 3300005366 Bacteria 1760
47 Ga0070659_100318046 3300005366 Bacteria 1301
48 Ga0070659_100331168 3300005366 Bacteria 1274
49 Ga0070667_100000017 3300005367 Bacteria 230531
50 Ga0070667_100001630 3300005367 Bacteria 20097
51 Ga0070663_100001418 3300005455 Bacteria 13103
52 Ga0070663_100016882 3300005455 Bacteria 4751
53 Ga0070663_100154342 3300005455 Bacteria 1763
54 Ga0070662_100021971 3300005457 Bacteria 4361
55 Ga0068867_100000155 3300005459 Bacteria 43934
56 Ga0068853_100004077 3300005539 Bacteria 11251
57 Ga0068853_100024821 3300005539 Bacteria 5028
58 Ga0068853_100078773 3300005539 Bacteria 2880
59 Ga0068853_100165363 3300005539 Bacteria 1999
60 Ga0070672_100008909 3300005543 Bacteria 6893
61 Ga0070672_100477757 3300005543 Bacteria 1076
62 Ga0068855_100002050 3300005563 Bacteria 24977
63 Ga0068855_100093552 3300005563 Bacteria 3466
64 Ga0068855_100151374 3300005563 Bacteria 2638
65 Ga0070664_100027663 3300005564 Bacteria 4713
66 Ga0070664_100129146 3300005564 Bacteria 2219
67 Ga0068857_100044528 3300005577 Bacteria 3937
68 Ga0068857_100061161 3300005577 Bacteria 3346
69 Ga0068857_100177497 3300005577 Bacteria 1938
70 Ga0068854_100002936 3300005578 Bacteria 10575
71 Ga0068854_100020078 3300005578 Bacteria 4512
72 Ga0068854_100071707 3300005578 Bacteria 2535
73 Ga0068854_100097681 3300005578 Bacteria 2196
74 Ga0068854_100103062 3300005578 Bacteria 2142
75 Ga0068856_100009922 3300005614 Bacteria 9251
76 Ga0068852_100000292 3300005616 Bacteria 33544
77 Ga0068852_100166111 3300005616 Bacteria 2065
78 Ga0068852_100300721 3300005616 Bacteria 1553
79 Ga0068859_100011637 3300005617 Bacteria 8843
80 Ga0068859_100030758 3300005617 Bacteria 5388
81 Ga0068859_100088588 3300005617 Bacteria 3144
82 Ga0068859_100348687 3300005617 Bacteria 1575
83 Ga0068864_100000036 3300005618 Bacteria 189811
84 Ga0068861_100088023 3300005719 Bacteria 2445
85 Ga0068861_100148438 3300005719 Bacteria 1921
86 Ga0068851_10100387 3300005834 Bacteria 1535
87 Ga0068863_100002193 3300005841 Bacteria 19382
88 Ga0068858_100000103 3300005842 Bacteria 88754
89 Ga0068858_100001936 3300005842 Bacteria 21104
90 Ga0068860_100000056 3300005843 Bacteria 202751
91 Ga0068860_100002163 3300005843 Bacteria 20702
92 Ga0068862_100000043 3300005844 Bacteria 164356
93 Ga0068862_100000059 3300005844 Bacteria 136840
94 Ga0068862_100000520 3300005844 Bacteria 40702
95 Ga0081540_1099800 3300005983 Bacteria 1253
96 Ga0075368_10001355 3300006042 Bacteria 7790
97 Ga0075367_10001026 3300006178 Bacteria 11507
98 Ga0075366_10041529 3300006195 Bacteria 2724
99 Ga0075366_10140475 3300006195 Bacteria 1460
100 Ga0097621_100003633 3300006237 Bacteria 10660
101 Ga0068871_100041034 3300006358 Bacteria 3709
102 Ga0068865_100000272 3300006881 Bacteria 28389
103 Ga0068865_100664436 3300006881 Bacteria 887
104 Ga0097620_100002528 3300006931 Bacteria 18563
105 Ga0097620_100011637 3300006931 Bacteria 8843
106 Ga0097620_100030758 3300006931 Bacteria 5388
107 Ga0097620_100088586 3300006931 Bacteria 3144
108 Ga0097620_100348671 3300006931 Bacteria 1575
109 Ga0105240_10012649 3300009093 Bacteria 11636
110 Ga0105240_10046356 3300009093 Bacteria 5508
111 Ga0105240_10059335 3300009093 Bacteria 4776
112 Ga0105240_10928490 3300009093 Bacteria 935
113 Ga0105245_10002130 3300009098 Bacteria 17920
114 Ga0105247_10007768 3300009101 Bacteria 6562
115 Ga0105243_10000711 3300009148 Bacteria 32092
116 Ga0105241_10021429 3300009174 Bacteria 4776
117 Ga0105241_10658261 3300009174 Bacteria 952
118 Ga0105242_10000320 3300009176 Bacteria 38566
119 Ga0105248_10000081 3300009177 Bacteria 111105
120 Ga0105248_10005344 3300009177 Bacteria 14135
121 Ga0105248_10014281 3300009177 Bacteria 8743
122 Ga0105248_10023695 3300009177 Bacteria 6821
123 Ga0105248_10027636 3300009177 Bacteria 6319
124 Ga0105237_10012943 3300009545 Bacteria 8762
125 Ga0105237_10139050 3300009545 Bacteria 2423
126 Ga0105237_10156698 3300009545 Bacteria 2274
127 Ga0105238_10010058 3300009551 Bacteria 9490
128 Ga0105238_10063370 3300009551 Bacteria 3697
129 Ga0105238_10264269 3300009551 Bacteria 1701
130 Ga0105238_10807319 3300009551 Bacteria 954
131 Ga0105249_10272362 3300009553 Bacteria 1687
132 Ga0105249_10458402 3300009553 Bacteria 1314
133 Ga0105239_10000461 3300010375 Bacteria 59449
134 Ga0105239_10029899 3300010375 Bacteria 5992
135 Ga0105239_10111489 3300010375 Bacteria 3033
136 Ga0105239_10171907 3300010375 Bacteria 2423
137 Ga0105239_11028904 3300010375 Bacteria 947
138 Ga0105246_10006018 3300011119 Bacteria 7408
139 Ga0157326_1000067 3300012513 Bacteria 10095
140 Ga0157373_10012069 3300013100 Bacteria 6350
141 Ga0157373_10156917 3300013100 Bacteria 1601
142 Ga0157373_10225792 3300013100 Bacteria 1322
143 Ga0157371_10000138 3300013102 Bacteria 105621
144 Ga0157370_10000145 3300013104 Bacteria 86693
145 Ga0157370_10335653 3300013104 Bacteria 1393
146 Ga0157369_10057764 3300013105 Bacteria 4185
147 Ga0157369_10217868 3300013105 Bacteria 1999
148 Ga0157369_11057058 3300013105 Bacteria 830
149 Ga0157374_10004963 3300013296 Bacteria 11167
150 Ga0157374_10008567 3300013296 Bacteria 8745
151 Ga0157378_10008884 3300013297 Bacteria 8745
152 Ga0163162_10213788 3300013306 Bacteria 2058
153 Ga0157372_10044744 3300013307 Bacteria 4906
154 Ga0157372_10044829 3300013307 Bacteria 4902
155 Ga0157372_10184125 3300013307 Bacteria 2418
156 Ga0157372_10250528 3300013307 Bacteria 2056
157 Ga0157375_10018106 3300013308 Bacteria 6382
158 Ga0163163_10086929 3300014325 Bacteria 3136
159 Ga0163163_10840561 3300014325 Bacteria 981
160 Ga0157380_10000193 3300014326 Bacteria 35569
161 Ga0157380_10000245 3300014326 Bacteria 32686
162 Ga0157376_10000395 3300014969 Bacteria 28347
163 Ga0163161_10115706 3300017792 Bacteria 2010
164 Ga0163161_10396752 3300017792 Bacteria 1105
165 Ga0207427_100878 3300025231 Bacteria 13165
166 Ga0209026_1002366 3300025250 Bacteria 7135
167 Ga0209148_1000318 3300025254 Bacteria 67692
168 Ga0209148_1001661 3300025254 Bacteria 10032
169 Ga0209233_1000181 3300025261 Bacteria 138699
170 Ga0209455_1000942 3300025272 Bacteria 14894
171 Ga0209455_1009659 3300025272 Bacteria 2513
172 Ga0207656_10066703 3300025321 Bacteria 1591
173 Ga0207656_10128983 3300025321 Bacteria 1183
174 Ga0207656_10255721 3300025321 Bacteria 859
175 Ga0207710_10008555 3300025900 Bacteria 4314
176 Ga0207680_10455814 3300025903 Bacteria 908
177 Ga0207647_10000611 3300025904 Bacteria 27863
178 Ga0207647_10023561 3300025904 Bacteria 4070
179 Ga0207647_10092112 3300025904 Bacteria 1807
180 Ga0207647_10114001 3300025904 Bacteria 1597
181 Ga0207645_10000739 3300025907 Bacteria 27245
182 Ga0207705_10000120 3300025909 Bacteria 87080
183 Ga0207705_10000520 3300025909 Bacteria 32771
184 Ga0207705_10001161 3300025909 Bacteria 21450
185 Ga0207705_10004035 3300025909 Bacteria 11165
186 Ga0207654_10030878 3300025911 Bacteria 2946
187 Ga0207695_10011414 3300025913 Bacteria 10767
188 Ga0207695_10038860 3300025913 Bacteria 5119
189 Ga0207695_10087919 3300025913 Bacteria 3129
190 Ga0207695_10109585 3300025913 Bacteria 2743
191 Ga0207695_10856999 3300025913 Bacteria 788
192 Ga0207671_10001752 3300025914 Bacteria 24394
193 Ga0207671_10003642 3300025914 Bacteria 15216
194 Ga0207657_10002758 3300025919 Bacteria 18916
195 Ga0207657_10003468 3300025919 Bacteria 16829
196 Ga0207657_10015483 3300025919 Bacteria 7387
197 Ga0207657_10140340 3300025919 Bacteria 1975
198 Ga0207649_10000322 3300025920 Bacteria 36428
199 Ga0207681_10000014 3300025923 Bacteria 353422
200 Ga0207681_10008972 3300025923 Bacteria 6107
201 Ga0207694_10005428 3300025924 Bacteria 9807
202 Ga0207694_10010173 3300025924 Bacteria 7089
203 Ga0207694_10139311 3300025924 Bacteria 1950
204 Ga0207694_10359033 3300025924 Bacteria 1207
205 Ga0207650_10000015 3300025925 Bacteria 369173
206 Ga0207650_10003369 3300025925 Bacteria 10999
207 Ga0207687_10001173 3300025927 Bacteria 17895
208 Ga0207644_10000066 3300025931 Bacteria 76450
209 Ga0207644_10030102 3300025931 Bacteria 3771
210 Ga0207690_10051525 3300025932 Bacteria 2753
211 Ga0207690_10304976 3300025932 Bacteria 1247
212 Ga0207706_10003886 3300025933 Bacteria 14187
213 Ga0207706_10007729 3300025933 Bacteria 9925
214 Ga0207706_10023219 3300025933 Bacteria 5570
215 Ga0207686_10000181 3300025934 Bacteria 48566
216 Ga0207709_10001206 3300025935 Bacteria 18580
217 Ga0207669_10025542 3300025937 Bacteria 3195
218 Ga0207704_10000048 3300025938 Bacteria 83529
219 Ga0207691_10027970 3300025940 Bacteria 5282
220 Ga0207711_10003161 3300025941 Bacteria 14354
221 Ga0207711_10003444 3300025941 Bacteria 13689
222 Ga0207711_10008194 3300025941 Bacteria 8748
223 Ga0207711_10008830 3300025941 Bacteria 8426
224 Ga0207711_10016828 3300025941 Bacteria 6071
225 Ga0207689_10000378 3300025942 Bacteria 41915
226 Ga0207689_10446872 3300025942 Bacteria 1080
227 Ga0207679_10094602 3300025945 Bacteria 2320
228 Ga0207667_10000002 3300025949 Bacteria 895662
229 Ga0207667_10001267 3300025949 Bacteria 31686
230 Ga0207667_10038629 3300025949 Bacteria 5096
231 Ga0207651_10000001 3300025960 Bacteria 516823
232 Ga0207712_10042535 3300025961 Bacteria 3129
233 Ga0207668_10000012 3300025972 Bacteria 182541
234 Ga0207668_10185313 3300025972 Bacteria 1645
235 Ga0207640_10000167 3300025981 Bacteria 47729
236 Ga0207640_10014263 3300025981 Bacteria 4571
237 Ga0207640_10097636 3300025981 Bacteria 2051
238 Ga0207640_10109741 3300025981 Bacteria 1953
239 Ga0207640_10198764 3300025981 Bacteria 1517
240 Ga0207658_10000011 3300025986 Bacteria 239620
241 Ga0207658_10003181 3300025986 Bacteria 11711
242 Ga0207658_10356566 3300025986 Bacteria 1275
243 Ga0207677_10000125 3300026023 Bacteria 63161
244 Ga0207703_10000538 3300026035 Bacteria 38989
245 Ga0207703_10003240 3300026035 Bacteria 13683
246 Ga0207639_10009735 3300026041 Bacteria 6637
247 Ga0207639_10015468 3300026041 Bacteria 5385
248 Ga0207639_10254985 3300026041 Bacteria 1531
249 Ga0207639_10395829 3300026041 Bacteria 1244
250 Ga0207678_10004698 3300026067 Bacteria 12253
251 Ga0207678_10042513 3300026067 Bacteria 3936
252 Ga0207678_10158031 3300026067 Bacteria 1936
253 Ga0207702_10005960 3300026078 Bacteria 10587
254 Ga0207702_10008473 3300026078 Bacteria 8671
255 Ga0207641_10000228 3300026088 Bacteria 72357
256 Ga0207641_10012867 3300026088 Bacteria 6862
257 Ga0207648_10000494 3300026089 Bacteria 43933
258 Ga0207676_10000021 3300026095 Bacteria 296572
259 Ga0207676_10001553 3300026095 Bacteria 16924
260 Ga0207674_10001946 3300026116 Bacteria 26210
261 Ga0207674_10058578 3300026116 Bacteria 3901
262 Ga0207674_10075319 3300026116 Bacteria 3385
263 Ga0207674_10183758 3300026116 Bacteria 2041
264 Ga0207675_100000657 3300026118 Bacteria 34026
265 Ga0207675_100082013 3300026118 Bacteria 3024
266 Ga0207675_100207036 3300026118 Bacteria 1885
267 Ga0207683_10039037 3300026121 Bacteria 4141
268 Ga0207698_10000615 3300026142 Bacteria 20745
269 Ga0207698_10005202 3300026142 Bacteria 8002
270 Ga0207698_10063954 3300026142 Bacteria 2882
271 Ga0207698_10264583 3300026142 Bacteria 1582
272 Ga0209813_10000036 3300027866 Bacteria 58545
273 Ga0268266_10314180 3300028379 Bacteria 1465
274 Ga0268265_10000013 3300028380 Bacteria 341536
275 Ga0268265_10000114 3300028380 Bacteria 101337
276 Ga0268265_10002075 3300028380 Bacteria 15633
277 Ga0268264_10000089 3300028381 Bacteria 234760
278 Ga0268264_10000539 3300028381 Bacteria 47920
279 Ga0307513_10029400 3300031456 Bacteria 6266
280 Ga0307408_100159484 3300031548 Bacteria 1790
281 Ga0307408_100274269 3300031548 Bacteria 1402
282 Ga0307405_10090609 3300031731 Bacteria 2023
283 Ga0307405_10830214 3300031731 Bacteria 776
284 Ga0307413_10189720 3300031824 Bacteria 1474
285 Ga0307406_10158130 3300031901 Bacteria 1626
286 Ga0307406_10284287 3300031901 Bacteria 1263
287 Ga0307412_10020421 3300031911 Bacteria 4030
288 Ga0307412_10026191 3300031911 Bacteria 3622
289 Ga0307412_10051078 3300031911 Bacteria 2731
290 Ga0307412_10143725 3300031911 Bacteria 1751
291 Ga0307412_10240251 3300031911 Bacteria 1400
292 Ga0307416_100073570 3300032002 Bacteria 2850
293 Ga0307510_10004202 3300033180 Bacteria 16921
294 Ga0373932_0017851 3300035112 Bacteria 1827
295 Ga0395899_0003133 3300037312 Bacteria 13164
296 Ga0395900_0027518 3300037418 Bacteria 5825
297 Ga0395900_0280617 3300037418 Bacteria 1658
298 Ga0395900_0526681 3300037418 Bacteria 1129
299 Ga0395898_0333371 3300037466 Bacteria 1447
300 Ga0395905_0023850 3300037471 Bacteria 5776
301 Ga0395905_0299651 3300037471 Bacteria 1495
302 Ga0395905_0326666 3300037471 Bacteria 1424
303 Ga0395905_0341799 3300037471 Bacteria 1388
304 Ga0395901_0261568 3300038443 Bacteria 1801
305 Ga0395901_0270018 3300038443 Bacteria 1769
306 Ga0439461_0000062 3300041410 Bacteria 13562
307 Ga0439465_0002490 3300041413 Bacteria 6015
308 Ga0451793_1911876 3300041452 Bacteria 2152
309 Ga0451802_0359512 3300041460 Bacteria 3349
310 Ga0451807_2046558 3300041486 Bacteria 2437
311 Ga0451853_1935278 3300041512 Bacteria 1039
312 Ga0439442_002902 3300042002 Bacteria 3377
313 Ga0439445_0015018 3300042004 Bacteria 1893
314 Ga0439448_0001897 3300042005 Bacteria 5566
315 Ga0439448_0032035 3300042005 Bacteria 1671
316 Ga0439432_001352 3300042006 Bacteria 9275
317 Ga0439455_0000192 3300042012 Bacteria 7056
318 Ga0439455_0012578 3300042012 Bacteria 1903
319 Ga0439455_0014878 3300042012 Bacteria 1782
320 Ga0439462_0000410 3300042015 Bacteria 8305
321 Ga0439458_0000340 3300042157 Bacteria 11711
322 Ga0439458_0003362 3300042157 Bacteria 3757
323 Ga0439434_0000698 3300042435 Bacteria 9679
324 Ga0466972_0027895 3300044658 Bacteria 2790
325 Ga0466972_0126019 3300044658 Bacteria 1207
326 Ga0466966_0015615 3300044684 Bacteria 5020
327 Ga0466961_0003101 3300044693 Bacteria 10340
328 Ga0466963_0019061 3300044694 Bacteria 4296
329 Ga0466963_0340828 3300044694 Bacteria 1055
330 Ga0466964_0018153 3300044706 Bacteria 2697
331 Ga0466964_0250261 3300044706 Bacteria 873
332 Ga0466971_0005361 3300044719 Bacteria 5558
333 Ga0466968_0013715 3300044735 Bacteria 3190
334 Ga0466968_0021167 3300044735 Bacteria 2631
335 Ga0466968_0090866 3300044735 Bacteria 1352
336 Ga0466970_0013772 3300044765 Bacteria 4148
337 Ga0466957_0275228 3300044842 Bacteria 1125
338 Ga0466960_0003830 3300044901 Bacteria 5832
339 Ga0466959_0001956 3300045049 Bacteria 12984
340 Ga0466958_0006518 3300045836 Bacteria 6362
341 Ga0466967_0110306 3300045976 Bacteria 2527
342 Ga0466967_0299315 3300045976 Bacteria 1547
343 Ga0495638_0037216 3300046460 Bacteria 3096
344 Ga0495583_0000138 3300046506 Bacteria 123486
345 Ga0495583_0193276 3300046506 Bacteria 829
346 Ga0495606_0001967 3300046507 Bacteria 25353
347 Ga0495606_0287673 3300046507 Bacteria 896
348 Ga0495637_0045841 3300046520 Bacteria 1852
349 Ga0495643_0028128 3300046522 Bacteria 3155
350 Ga0495643_0069946 3300046522 Bacteria 1844
351 Ga0495643_0233585 3300046522 Bacteria 866
352 Ga0495648_0083530 3300046524 Bacteria 1809
353 Ga0495663_0036701 3300046525 Bacteria 1476
354 Ga0495642_0165827 3300046528 Bacteria 959
355 Ga0495654_0003137 3300046530 Bacteria 10255
356 Ga0495654_0075928 3300046530 Bacteria 1584
357 Ga0495597_0004007 3300046542 Bacteria 8271
358 Ga0495622_0010228 3300046557 Bacteria 4336
359 Ga0495633_0055852 3300046558 Bacteria 1856
360 Ga0495668_0001262 3300046616 Bacteria 25193
361 Ga0495668_0021519 3300046616 Bacteria 3697
362 Ga0495625_0031106 3300046660 Bacteria 3973
363 Ga0495625_0179895 3300046660 Bacteria 1407
364 Ga0495661_0303961 3300046665 Bacteria 797
365 Ga0495670_0029857 3300046691 Bacteria 2708
366 Ga0495671_0009326 3300046692 Bacteria 5483
367 Ga0495671_0171634 3300046692 Bacteria 1054
368 Ga0495589_0052097 3300046794 Bacteria 2022
369 Ga0495683_0049609 3300047323 Bacteria 2102
370 Ga0495687_000658 3300047443 Bacteria 39620
371 Ga0495677_0022923 3300047445 Bacteria 2266
372 Ga0495673_0015274 3300047469 Bacteria 3959
373 Ga0495681_0000077 3300047470 Bacteria 87471
374 Ga0495681_0010055 3300047470 Bacteria 5760
375 Ga0495686_0000280 3300047472 Bacteria 90032
376 Ga0495686_0000366 3300047472 Bacteria 73243
377 Ga0495686_0005505 3300047472 Bacteria 9966
378 Ga0495686_0006742 3300047472 Bacteria 8731
379 Ga0495686_0050079 3300047472 Bacteria 2625
380 Ga0496102_0000117 3300048905 Bacteria 114037
381 Ga0496102_0000213 3300048905 Bacteria 76751
382 Ga0496103_0000076 3300048906 Bacteria 113209
383 Ga0496103_0000698 3300048906 Bacteria 24920
384 Ga0496104_0033918 3300048907 Bacteria 4758
385 Ga0496105_0007755 3300048908 Bacteria 8329
386 Ga0496105_0094727 3300048908 Bacteria 2466
387 Ga0496111_0012434 3300048914 Bacteria 5763
388 Ga0496114_0042337 3300048917 Bacteria 3775
389 Ga0496115_0000499 3300048918 Bacteria 30774
390 Ga0496116_0000888 3300048919 Bacteria 37285
391 Ga0496116_0005293 3300048919 Bacteria 12035
392 Ga0496117_0000179 3300048920 Bacteria 130966
393 Ga0496117_0000201 3300048920 Bacteria 117679
394 Ga0496117_0069319 3300048920 Bacteria 2375
395 Ga0496117_0178443 3300048920 Bacteria 1224
396 Ga0496117_0218008 3300048920 Bacteria 1064
397 Ga0496117_0374486 3300048920 Bacteria 727
398 Ga0496118_0000097 3300048921 Bacteria 160837
399 Ga0496118_0000207 3300048921 Bacteria 102753
400 Ga0496118_0014422 3300048921 Bacteria 7403
401 Ga0496118_0160784 3300048921 Bacteria 1389
402 Ga0496119_0038521 3300048922 Bacteria 3087
403 Ga0496119_0051921 3300048922 Bacteria 2515
404 Ga0496119_0062579 3300048922 Bacteria 2217
405 Ga0496119_0098832 3300048922 Bacteria 1643
406 Ga0496119_0118653 3300048922 Bacteria 1457
407 Ga0496119_0275849 3300048922 Bacteria 838
408 Ga0496120_0085652 3300048923 Bacteria 1695
409 Ga0496121_0001671 3300048924 Bacteria 36600
410 Ga0496121_0002436 3300048924 Bacteria 28453
411 Ga0496121_0004926 3300048924 Bacteria 17520
412 Ga0496121_0017523 3300048924 Bacteria 7308
413 Ga0496121_0196818 3300048924 Bacteria 1440
414 Ga0496121_0290620 3300048924 Bacteria 1114
415 Ga0496122_0000579 3300048925 Bacteria 75073
416 Ga0496122_0003599 3300048925 Bacteria 20191
417 Ga0496122_0007148 3300048925 Bacteria 12516
418 Ga0496122_0359418 3300048925 Bacteria 756
419 Ga0496123_0001402 3300048926 Bacteria 33737
420 Ga0496123_0001626 3300048926 Bacteria 30247
421 Ga0496124_0000202 3300048927 Bacteria 117650
422 Ga0496124_0001031 3300048927 Bacteria 44122
423 Ga0496124_0006637 3300048927 Bacteria 12555
424 Ga0496124_0077333 3300048927 Bacteria 2745
425 Ga0496124_0082344 3300048927 Bacteria 2642
426 Ga0496125_0029226 3300048928 Bacteria 4957
427 Ga0496125_0495715 3300048928 Bacteria 689
428 Ga0496126_0001995 3300048929 Bacteria 28919
429 Ga0496126_0007208 3300048929 Bacteria 12230
430 Ga0496126_0058254 3300048929 Bacteria 3483
431 Ga0496126_0100078 3300048929 Bacteria 2538
432 Ga0496126_0156623 3300048929 Bacteria 1949
433 Ga0501290_000041 3300049513 Bacteria 16680
434 Ga0501292_000038 3300049515 Bacteria 31848
435 Ga0501293_015789 3300049516 Bacteria 698
436 Ga0501294_001180 3300049517 Bacteria 2708
437 Ga0501300_006715 3300049523 Bacteria 1691
438 Ga0501301_002016 3300049524 Bacteria 1319
439 Ga0501033_0163681 3300049570 Bacteria 1600
440 Ga0501034_0007473 3300049571 Bacteria 11630
441 Ga0501042_0182080 3300049578 Bacteria 1516
442 Ga0501043_0011336 3300049579 Bacteria 6977
443 Ga0501043_0087041 3300049579 Bacteria 2455
444 Ga0501046_0416317 3300049580 Bacteria 969
445 Ga0501047_0000644 3300049581 Bacteria 36698
446 Ga0501048_0055289 3300049582 Bacteria 2818
447 Ga0501067_0016053 3300049583 Bacteria 4142
448 Ga0501070_0059410 3300049586 Bacteria 3170
449 Ga0501072_0005462 3300049588 Bacteria 9683
450 Ga0501073_0070427 3300049589 Bacteria 2436
451 Ga0501074_0021279 3300049590 Bacteria 4710
452 Ga0501206_001688 3300049653 Bacteria 2765
453 Ga0501222_000313 3300049662 Bacteria 7692
454 Ga0501223_000211 3300049663 Bacteria 14909
455 Ga0501223_000942 3300049663 Bacteria 6871
456 Ga0501224_000008 3300049664 Bacteria 111708
457 Ga0501224_001246 3300049664 Bacteria 3353
458 Ga0501227_006729 3300049665 Bacteria 2465
459 Ga0501233_002386 3300049668 Bacteria 3303
460 Ga0501235_005872 3300049669 Bacteria 2672
461 Ga0501249_000105 3300049679 Bacteria 26462
462 Ga0501257_028140 3300049686 Bacteria 1347
463 Ga0501261_000037 3300049690 Bacteria 27038
464 Ga0501225_0000073 3300049705 Bacteria 33154
465 Ga0501245_004759 3300049708 Bacteria 1868
466 Ga0501080_0037836 3300049742 Bacteria 4505
467 Ga0501083_0007999 3300049744 Bacteria 7487
468 Ga0501279_000016 3300049775 Bacteria 64067
469 Ga0501280_000059 3300049776 Bacteria 31802
470 Ga0501283_002621 3300049779 Bacteria 2341
471 Ga0501044_0137926 3300049823 Bacteria 2429
472 Ga0501226_000042 3300049853 Bacteria 59224
473 nmdc:mga0k408_73122_c1 3300050493 Bacteria 2002
474 nmdc:mga0k408_90074_c1 3300050493 Bacteria 1801
475 nmdc:mga06z11_111_c1 3300050494 Bacteria 33603
476 nmdc:mga04h51_792_c1 3300050495 Bacteria 7342
477 nmdc:mga07m45_114253_c1 3300050496 Bacteria 1556
478 nmdc:mga0sz30_72838_c1 3300050516 Bacteria 1480
479 Ga0500643_000121 3300053087 Bacteria 81461
480 Ga0500643_000372 3300053087 Bacteria 35225
481 Ga0500643_002149 3300053087 Bacteria 10433
482 Ga0500643_009873 3300053087 Bacteria 3606
483 Ga0500643_018086 3300053087 Bacteria 2346
484 Ga0500644_0039498 3300053088 Bacteria 1556
485 Ga0500651_0041069 3300053093 Bacteria 2915
486 Ga0500566_0091221 3300053094 Bacteria 1684
487 Ga0500566_0158520 3300053094 Bacteria 1182
488 Ga0500566_0163786 3300053094 Bacteria 1156
489 Ga0500641_0029201 3300053096 Bacteria 2159
490 Ga0500641_0094809 3300053096 Bacteria 1276
491 Ga0500555_000558 3300053103 Bacteria 14807
492 Ga0500592_000147 3300053116 Bacteria 14453
493 Ga0500594_0002367 3300053118 Bacteria 4098
494 Ga0500594_0045338 3300053118 Bacteria 1219
495 Ga0500608_017594 3300053122 Bacteria 3249
496 Ga0500618_013727 3300053125 Bacteria 2086
497 Ga0500642_0001507 3300053130 Bacteria 6718
498 Ga0500652_022217 3300053131 Bacteria 2399
499 Ga0500655_000107 3300053133 Bacteria 21512
500 Ga0500559_0135088 3300053136 Bacteria 1153
501 Ga0500559_0179024 3300053136 Bacteria 998
502 Ga0500568_0131209 3300053139 Bacteria 931
503 Ga0500568_0153660 3300053139 Bacteria 851
504 Ga0500590_000655 3300053148 Bacteria 12380
505 Ga0500604_0014637 3300053151 Bacteria 2138
506 Ga0500604_0020253 3300053151 Bacteria 1870
507 Ga0500616_0042243 3300053153 Bacteria 2442
508 Ga0500622_0002989 3300053156 Bacteria 11721
509 Ga0500624_000125 3300053157 Bacteria 34426
510 Ga0500627_0000210 3300053158 Bacteria 16867
511 Ga0500627_0005065 3300053158 Bacteria 4324
512 Ga0500627_0252314 3300053158 Bacteria 780
513 Ga0500636_0128333 3300053177 Bacteria 1415
514 Ga0500636_0201952 3300053177 Bacteria 1051
515 Ga0500570_004740 3300053724 Bacteria 7192
516 Ga0500645_105617 3300053730 Bacteria 792
517 Ga0466962_0001351 3300061719 Bacteria 11344
518 2512644053 2512564014 Bacteria 4639632
519 2585261447 2582581305 Bacteria 4895574
520 2600201781 2599185354 Bacteria 4398675
521 2643730704 2643221541 Bacteria 5498788
522 2644040840 2643221605 Bacteria 4772303
523 2644044642 2643221606 Bacteria 5588032
524 2644391433 2643221671 Bacteria 5496681
525 2753767844 2751185897 Bacteria 5322941
526 Ga0207706_10180228
527 JGI24741J21665_1008145
528 JGI24740J21852_10009041
529 JGI24740J21852_10069437
530 JGI24739J22299_10000795
531 JGI24739J22299_10009497
532 JGI24739J22299_10040739
533 JGI24739J22299_10046515
534 JGI24737J22298_10017880
535 JGI24737J22298_10039805
536 JGI24737J22298_10108493
537 JGI24735J21928_10002210
538 JGI24735J21928_10006124
539 JGI24738J21930_10000801
540 JGI24738J21930_10014543
541 JGI24749J21850_1000061
542 JGI24751J29686_10006277
543 JGI25165J46597_1000534
544 rootL2_10130408
545 Ga0055542_1007706
546 Ga0065707_10082097
547 Ga0065707_10125112
548 Ga0070658_10000542
549 Ga0070658_10001154
550 Ga0070658_10005645
551 Ga0070658_10052741
552 Ga0070676_10000448
553 Ga0070670_100000024
554 Ga0070670_100003502
555 Ga0068869_100002968
556 Ga0070666_10012352
557 Ga0068868_100000244
558 Ga0070660_100001933
559 Ga0070660_100002539
560 Ga0070660_100112798
561 Ga0070661_100019988
562 Ga0070668_100000027
563 Ga0070669_100000031
564 Ga0070669_100161061
565 Ga0070671_100000517
566 Ga0070671_100189959
567 Ga0070674_100011147
568 Ga0070673_100000020
569 Ga0070659_100027702
570 Ga0070659_100054234
571 Ga0070659_100174964
572 Ga0070659_100318046
573 Ga0070659_100331168
574 Ga0070667_100000017
575 Ga0070667_100001630
576 Ga0070663_100001418
577 Ga0070663_100016882
578 Ga0070663_100154342
579 Ga0070662_100021971
580 Ga0068867_100000155
581 Ga0068853_100004077
582 Ga0068853_100024821
583 Ga0068853_100078773
584 Ga0068853_100165363
585 Ga0070672_100008909
586 Ga0070672_100477757
587 Ga0068855_100002050
588 Ga0068855_100093552
589 Ga0068855_100151374
590 Ga0070664_100027663
591 Ga0070664_100129146
592 Ga0068857_100044528
593 Ga0068857_100061161
594 Ga0068857_100177497
595 Ga0068854_100002936
596 Ga0068854_100020078
597 Ga0068854_100071707
598 Ga0068854_100097681
599 Ga0068854_100103062
600 Ga0068856_100009922
601 Ga0068852_100000292
602 Ga0068852_100166111
603 Ga0068852_100300721
604 Ga0068859_100011637
605 Ga0068859_100030758
606 Ga0068859_100088588
607 Ga0068859_100348687
608 Ga0068864_100000036
609 Ga0068861_100088023
610 Ga0068861_100148438
611 Ga0068851_10100387
612 Ga0068863_100002193
613 Ga0068858_100000103
614 Ga0068858_100001936
615 Ga0068860_100000056
616 Ga0068860_100002163
617 Ga0068862_100000043
618 Ga0068862_100000059
619 Ga0068862_100000520
620 Ga0081540_1099800
621 Ga0075368_10001355
622 Ga0075367_10001026
623 Ga0075366_10041529
624 Ga0075366_10140475
625 Ga0097621_100003633
626 Ga0068871_100041034
627 Ga0068865_100000272
628 Ga0068865_100664436
629 Ga0097620_100002528
630 Ga0097620_100011637
631 Ga0097620_100030758
632 Ga0097620_100088586
633 Ga0097620_100348671
634 Ga0105240_10012649
635 Ga0105240_10046356
636 Ga0105240_10059335
637 Ga0105240_10928490
638 Ga0105245_10002130
639 Ga0105247_10007768
640 Ga0105243_10000711
641 Ga0105241_10021429
642 Ga0105241_10658261
643 Ga0105242_10000320
644 Ga0105248_10000081
645 Ga0105248_10005344
646 Ga0105248_10014281
647 Ga0105248_10023695
648 Ga0105248_10027636
649 Ga0105237_10012943
650 Ga0105237_10139050
651 Ga0105237_10156698
652 Ga0105238_10010058
653 Ga0105238_10063370
654 Ga0105238_10264269
655 Ga0105238_10807319
656 Ga0105249_10272362
657 Ga0105249_10458402
658 Ga0105239_10000461
659 Ga0105239_10029899
660 Ga0105239_10111489
661 Ga0105239_10171907
662 Ga0105239_11028904
663 Ga0105246_10006018
664 Ga0157326_1000067
665 Ga0157373_10012069
666 Ga0157373_10156917
667 Ga0157373_10225792
668 Ga0157371_10000138
669 Ga0157370_10000145
670 Ga0157370_10335653
671 Ga0157369_10057764
672 Ga0157369_10217868
673 Ga0157369_11057058
674 Ga0157374_10004963
675 Ga0157374_10008567
676 Ga0157378_10008884
677 Ga0163162_10213788
678 Ga0157372_10044744
679 Ga0157372_10044829
680 Ga0157372_10184125
681 Ga0157372_10250528
682 Ga0157375_10018106
683 Ga0163163_10086929
684 Ga0163163_10840561
685 Ga0157380_10000193
686 Ga0157380_10000245
687 Ga0157376_10000395
688 Ga0163161_10115706
689 Ga0163161_10396752
690 Ga0207427_100878
691 Ga0209026_1002366
692 Ga0209148_1000318
693 Ga0209148_1001661
694 Ga0209233_1000181
695 Ga0209455_1000942
696 Ga0209455_1009659
697 Ga0207656_10066703
698 Ga0207656_10128983
699 Ga0207656_10255721
700 Ga0207710_10008555
701 Ga0207680_10455814
702 Ga0207647_10000611
703 Ga0207647_10023561
704 Ga0207647_10092112
705 Ga0207647_10114001
706 Ga0207645_10000739
707 Ga0207705_10000120
708 Ga0207705_10000520
709 Ga0207705_10001161
710 Ga0207705_10004035
711 Ga0207654_10030878
712 Ga0207695_10011414
713 Ga0207695_10038860
714 Ga0207695_10087919
715 Ga0207695_10109585
716 Ga0207695_10856999
717 Ga0207671_10001752
718 Ga0207671_10003642
719 Ga0207657_10002758
720 Ga0207657_10003468
721 Ga0207657_10015483
722 Ga0207657_10140340
723 Ga0207649_10000322
724 Ga0207681_10000014
725 Ga0207681_10008972
726 Ga0207694_10005428
727 Ga0207694_10010173
728 Ga0207694_10139311
729 Ga0207694_10359033
730 Ga0207650_10000015
731 Ga0207650_10003369
732 Ga0207687_10001173
733 Ga0207644_10000066
734 Ga0207644_10030102
735 Ga0207690_10051525
736 Ga0207690_10304976
737 Ga0207706_10003886
738 Ga0207706_10007729
739 Ga0207706_10023219
740 Ga0207686_10000181
741 Ga0207709_10001206
742 Ga0207669_10025542
743 Ga0207704_10000048
744 Ga0207691_10027970
745 Ga0207711_10003161
746 Ga0207711_10003444
747 Ga0207711_10008194
748 Ga0207711_10008830
749 Ga0207711_10016828
750 Ga0207689_10000378
751 Ga0207689_10446872
752 Ga0207679_10094602
753 Ga0207667_10000002
754 Ga0207667_10001267
755 Ga0207667_10038629
756 Ga0207651_10000001
757 Ga0207712_10042535
758 Ga0207668_10000012
759 Ga0207668_10185313
760 Ga0207640_10000167
761 Ga0207640_10014263
762 Ga0207640_10097636
763 Ga0207640_10109741
764 Ga0207640_10198764
765 Ga0207658_10000011
766 Ga0207658_10003181
767 Ga0207658_10356566
768 Ga0207677_10000125
769 Ga0207703_10000538
770 Ga0207703_10003240
771 Ga0207639_10009735
772 Ga0207639_10015468
773 Ga0207639_10254985
774 Ga0207639_10395829
775 Ga0207678_10004698
776 Ga0207678_10042513
777 Ga0207678_10158031
778 Ga0207702_10005960
779 Ga0207702_10008473
780 Ga0207641_10000228
781 Ga0207641_10012867
782 Ga0207648_10000494
783 Ga0207676_10000021
784 Ga0207676_10001553
785 Ga0207674_10001946
786 Ga0207674_10058578
787 Ga0207674_10075319
788 Ga0207674_10183758
789 Ga0207675_100000657
790 Ga0207675_100082013
791 Ga0207675_100207036
792 Ga0207683_10039037
793 Ga0207698_10000615
794 Ga0207698_10005202
795 Ga0207698_10063954
796 Ga0207698_10264583
797 Ga0209813_10000036
798 Ga0268266_10314180
799 Ga0268265_10000013
800 Ga0268265_10000114
801 Ga0268265_10002075
802 Ga0268264_10000089
803 Ga0268264_10000539
804 Ga0307513_10029400
805 Ga0307408_100159484
806 Ga0307408_100274269
807 Ga0307405_10090609
808 Ga0307405_10830214
809 Ga0307413_10189720
810 Ga0307406_10158130
811 Ga0307406_10284287
812 Ga0307412_10020421
813 Ga0307412_10026191
814 Ga0307412_10051078
815 Ga0307412_10143725
816 Ga0307412_10240251
817 Ga0307416_100073570
818 Ga0307510_10004202
819 Ga0373932_0017851
820 Ga0395899_0003133
821 Ga0395900_0027518
822 Ga0395900_0280617
823 Ga0395900_0526681
824 Ga0395898_0333371
825 Ga0395905_0023850
826 Ga0395905_0299651
827 Ga0395905_0326666
828 Ga0395905_0341799
829 Ga0395901_0261568
830 Ga0395901_0270018
831 Ga0439461_0000062
832 Ga0439465_0002490
833 Ga0451793_1911876
834 Ga0451802_0359512
835 Ga0451807_2046558
836 Ga0451853_1935278
837 Ga0439442_002902
838 Ga0439445_0015018
839 Ga0439448_0001897
840 Ga0439448_0032035
841 Ga0439432_001352
842 Ga0439455_0000192
843 Ga0439455_0012578
844 Ga0439455_0014878
845 Ga0439462_0000410
846 Ga0439458_0000340
847 Ga0439458_0003362
848 Ga0439434_0000698
849 Ga0466972_0027895
850 Ga0466972_0126019
851 Ga0466966_0015615
852 Ga0466961_0003101
853 Ga0466963_0019061
854 Ga0466963_0340828
855 Ga0466964_0018153
856 Ga0466964_0250261
857 Ga0466971_0005361
858 Ga0466968_0013715
859 Ga0466968_0021167
860 Ga0466968_0090866
861 Ga0466970_0013772
862 Ga0466957_0275228
863 Ga0466960_0003830
864 Ga0466959_0001956
865 Ga0466958_0006518
866 Ga0466967_0110306
867 Ga0466967_0299315
868 Ga0495638_0037216
869 Ga0495583_0000138
870 Ga0495583_0193276
871 Ga0495606_0001967
872 Ga0495606_0287673
873 Ga0495637_0045841
874 Ga0495643_0028128
875 Ga0495643_0069946
876 Ga0495643_0233585
877 Ga0495648_0083530
878 Ga0495663_0036701
879 Ga0495642_0165827
880 Ga0495654_0003137
881 Ga0495654_0075928
882 Ga0495597_0004007
883 Ga0495622_0010228
884 Ga0495633_0055852
885 Ga0495668_0001262
886 Ga0495668_0021519
887 Ga0495625_0031106
888 Ga0495625_0179895
889 Ga0495661_0303961
890 Ga0495670_0029857
891 Ga0495671_0009326
892 Ga0495671_0171634
893 Ga0495589_0052097
894 Ga0495683_0049609
895 Ga0495687_000658
896 Ga0495677_0022923
897 Ga0495673_0015274
898 Ga0495681_0000077
899 Ga0495681_0010055
900 Ga0495686_0000280
901 Ga0495686_0000366
902 Ga0495686_0005505
903 Ga0495686_0006742
904 Ga0495686_0050079
905 Ga0496102_0000117
906 Ga0496102_0000213
907 Ga0496103_0000076
908 Ga0496103_0000698
909 Ga0496104_0033918
910 Ga0496105_0007755
911 Ga0496105_0094727
912 Ga0496111_0012434
913 Ga0496114_0042337
914 Ga0496115_0000499
915 Ga0496116_0000888
916 Ga0496116_0005293
917 Ga0496117_0000179
918 Ga0496117_0000201
919 Ga0496117_0069319
920 Ga0496117_0178443
921 Ga0496117_0218008
922 Ga0496117_0374486
923 Ga0496118_0000097
924 Ga0496118_0000207
925 Ga0496118_0014422
926 Ga0496118_0160784
927 Ga0496119_0038521
928 Ga0496119_0051921
929 Ga0496119_0062579
930 Ga0496119_0098832
931 Ga0496119_0118653
932 Ga0496119_0275849
933 Ga0496120_0085652
934 Ga0496121_0001671
935 Ga0496121_0002436
936 Ga0496121_0004926
937 Ga0496121_0017523
938 Ga0496121_0196818
939 Ga0496121_0290620
940 Ga0496122_0000579
941 Ga0496122_0003599
942 Ga0496122_0007148
943 Ga0496122_0359418
944 Ga0496123_0001402
945 Ga0496123_0001626
946 Ga0496124_0000202
947 Ga0496124_0001031
948 Ga0496124_0006637
949 Ga0496124_0077333
950 Ga0496124_0082344
951 Ga0496125_0029226
952 Ga0496125_0495715
953 Ga0496126_0001995
954 Ga0496126_0007208
955 Ga0496126_0058254
956 Ga0496126_0100078
957 Ga0496126_0156623
958 Ga0501290_000041
959 Ga0501292_000038
960 Ga0501293_015789
961 Ga0501294_001180
962 Ga0501300_006715
963 Ga0501301_002016
964 Ga0501033_0163681
965 Ga0501034_0007473
966 Ga0501042_0182080
967 Ga0501043_0011336
968 Ga0501043_0087041
969 Ga0501046_0416317
970 Ga0501047_0000644
971 Ga0501048_0055289
972 Ga0501067_0016053
973 Ga0501070_0059410
974 Ga0501072_0005462
975 Ga0501073_0070427
976 Ga0501074_0021279
977 Ga0501206_001688
978 Ga0501222_000313
979 Ga0501223_000211
980 Ga0501223_000942
981 Ga0501224_000008
982 Ga0501224_001246
983 Ga0501227_006729
984 Ga0501233_002386
985 Ga0501235_005872
986 Ga0501249_000105
987 Ga0501257_028140
988 Ga0501261_000037
989 Ga0501225_0000073
990 Ga0501245_004759
991 Ga0501080_0037836
992 Ga0501083_0007999
993 Ga0501279_000016
994 Ga0501280_000059
995 Ga0501283_002621
996 Ga0501044_0137926
997 Ga0501226_000042
998 nmdc:mga0k408_73122_c1
999 nmdc:mga0k408_90074_c1
1000 nmdc:mga06z11_111_c1
1001 nmdc:mga04h51_792_c1
1002 nmdc:mga07m45_114253_c1
1003 nmdc:mga0sz30_72838_c1
1004 Ga0500643_000121
1005 Ga0500643_000372
1006 Ga0500643_002149
1007 Ga0500643_009873
1008 Ga0500643_018086
1009 Ga0500644_0039498
1010 Ga0500651_0041069
1011 Ga0500566_0091221
1012 Ga0500566_0158520
1013 Ga0500566_0163786
1014 Ga0500641_0029201
1015 Ga0500641_0094809
1016 Ga0500555_000558
1017 Ga0500592_000147
1018 Ga0500594_0002367
1019 Ga0500594_0045338
1020 Ga0500608_017594
1021 Ga0500618_013727
1022 Ga0500642_0001507
1023 Ga0500652_022217
1024 Ga0500655_000107
1025 Ga0500559_0135088
1026 Ga0500559_0179024
1027 Ga0500568_0131209
1028 Ga0500568_0153660
1029 Ga0500590_000655
1030 Ga0500604_0014637
1031 Ga0500604_0020253
1032 Ga0500616_0042243
1033 Ga0500622_0002989
1034 Ga0500624_000125
1035 Ga0500627_0000210
1036 Ga0500627_0005065
1037 Ga0500627_0252314
1038 Ga0500636_0128333
1039 Ga0500636_0201952
1040 Ga0500570_004740
1041 Ga0500645_105617
1042 Ga0466962_0001351
1043 2512644053
1044 2585261447
1045 2600201781
1046 2643730704
1047 2644040840
1048 2644044642
1049 2644391433
1050 2753767844

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

33

224

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wjz-assembly3.cif.gz_D crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.9163 5 203
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.915 5 200
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9105 3 203
7ac8-assembly3.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9075 5 203
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9065 4 204
ID Description Score Start End Superfamily
af_Q2FUU1_1_190_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9335 5 195 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9311 5 204 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9219 5 204 3.40.50.880
1ka9H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.915 5 200 3.40.50.880
4gudA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9049 4 204 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7C2JHR7-F1-model_v4 deleted 0.9885 5 91
AF-A0A1W9H2H3-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9874 4 206 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A2Z5U800-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9837 5 206 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A3D0WL32-F1-model_v4 deleted 0.9823 31 206
AF-A0A4Q4CQ49-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH 0.9812 5 112 GO:0000105
GO:0000107
GO:0004359
GO:0006541
GO:0016829

Map