F458902

General Info

Members Datasets Scaffolds Average Seq Length
522 295 1044 325

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0003416|Ga0501032_0003416_7196_8383
Length 379
Sequence MFAPSIGIKCHLAPNNPDSAPVIKERGSFKPLRSGTTGEHAIMIEITRLEAPTSLARTEPSTRTPLRVGVVQHRWHADEAVLRAELNEGIERAAKLGAAVVFLPELTLSRYPADTRPANNPAAGVRPSDIAEDLLTGPTFTFAAEAARKFGVSVHASLYQRAENPDGTDDGLGLNTAILVSPAGELVARTHKLHIPVTAGYYEDKFFRKGPDADDAYAVHAPAELGGARLGMPTCWDEWFPELARLYSLGGAEILVYPTAIGSEPDHPDFDTQPLWQQVIVGNGIANGLFMVAPNRHGSEGTLNFYGSSFISDPYGRILVQAPRDESAVLVADLDLDQRKDWLTLFPFLTTRRPETYGRLTEPVNHDAPLGAQPQAVPA

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
137 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
138 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
139 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
142 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
257 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
260 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
264 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
265 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
266 2643221616 Leifsonia sp. Root227 Isolate Unclassified
267 2643221617 Nocardioides sp. Root79 Isolate Unclassified
268 2643221620 Nocardioides sp. Root240 Isolate Unclassified
269 2643221711 Terrabacter sp. Root85 Isolate Unclassified
270 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
271 2738541305 Nocardioides sp. CF167 Isolate Unclassified
272 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
273 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
274 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
275 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
276 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
277 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
278 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
279 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
280 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
281 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
282 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
283 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
284 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
285 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
286 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
287 2922554459 Rhodococcus sp. 66b Isolate Unclassified
288 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
289 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
290 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
291 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
292 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
293 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
294 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
295 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.68
Metatranscriptomes 0
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.45
Nodule 0
Rhizoplane 13.41
Rhizosphere 76.05
Stem 0
Stem Tuber 0.19
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0003416 3300049569 Bacteria 12159
2 JGI25162J39368_1010273 3300002737 Bacteria 1193
3 JGI25164J39214_1001102 3300002772 Bacteria 7765
4 JGI25165J46597_1000014 3300003214 Bacteria 390383
5 rootH2_10085513 3300003320 Bacteria 2394
6 Ga0070683_100155886 3300005329 Bacteria 2165
7 Ga0070670_100138735 3300005331 Bacteria 2102
8 Ga0070666_10038337 3300005335 Bacteria 3188
9 Ga0070666_10180959 3300005335 Bacteria 1478
10 Ga0070689_100231213 3300005340 Bacteria 1520
11 Ga0070668_100244320 3300005347 Bacteria 1488
12 Ga0070669_100008474 3300005353 Bacteria 7341
13 Ga0070669_100010580 3300005353 Bacteria 6550
14 Ga0070675_100004238 3300005354 Bacteria 10909
15 Ga0070671_100017642 3300005355 Bacteria 5784
16 Ga0070674_100127830 3300005356 Bacteria 1890
17 Ga0070673_100279268 3300005364 Bacteria 1464
18 Ga0070688_100005702 3300005365 Bacteria 6582
19 Ga0070688_100005975 3300005365 Bacteria 6452
20 Ga0070667_100128201 3300005367 Bacteria 2213
21 Ga0070667_100139945 3300005367 Bacteria 2118
22 Ga0070714_100037632 3300005435 Bacteria 4066
23 Ga0070714_100078053 3300005435 Bacteria 2877
24 Ga0070714_100118612 3300005435 Bacteria 2351
25 Ga0070713_100001904 3300005436 Bacteria 13443
26 Ga0070713_100050180 3300005436 Bacteria 3445
27 Ga0070713_100140360 3300005436 Bacteria 2140
28 Ga0070708_100283441 3300005445 Bacteria 1559
29 Ga0070663_100000859 3300005455 Bacteria 16482
30 Ga0070678_100012734 3300005456 Bacteria 5243
31 Ga0070685_10000018 3300005466 Bacteria 110132
32 Ga0070685_10001560 3300005466 Bacteria 12073
33 Ga0070706_100099689 3300005467 Bacteria 2699
34 Ga0070707_100158946 3300005468 Bacteria 2201
35 Ga0070698_100014435 3300005471 Bacteria 8342
36 Ga0070698_100128061 3300005471 Bacteria 2495
37 Ga0070699_100031996 3300005518 Bacteria 4542
38 Ga0070679_100037721 3300005530 Bacteria 4802
39 Ga0070684_100049369 3300005535 Bacteria 3652
40 Ga0070672_100000004 3300005543 Bacteria 129970
41 Ga0070672_100108289 3300005543 Bacteria 2262
42 Ga0070665_100051052 3300005548 Bacteria 4149
43 Ga0070665_100090558 3300005548 Bacteria 3064
44 Ga0068855_100009285 3300005563 Bacteria 11879
45 Ga0068857_100089264 3300005577 Bacteria 2758
46 Ga0068856_100149750 3300005614 Bacteria 2342
47 Ga0068852_100039173 3300005616 Bacteria 3989
48 Ga0068863_100063307 3300005841 Bacteria 3498
49 Ga0068863_100468378 3300005841 Bacteria 1238
50 Ga0081540_1000129 3300005983 Bacteria 80446
51 Ga0070717_10038018 3300006028 Bacteria 3910
52 Ga0070717_10083773 3300006028 Bacteria 2682
53 Ga0075365_10050547 3300006038 Bacteria 2742
54 Ga0075365_10242647 3300006038 Bacteria 1265
55 Ga0075363_100055329 3300006048 Bacteria 2125
56 Ga0075364_10093978 3300006051 Bacteria 1992
57 Ga0075432_10000095 3300006058 Bacteria 18569
58 Ga0075428_100302719 3300006844 Bacteria 1719
59 Ga0075433_10010907 3300006852 Bacteria 7311
60 Ga0075434_100021060 3300006871 Bacteria 6334
61 Ga0075429_100006435 3300006880 Bacteria 10172
62 Ga0075436_100059614 3300006914 Bacteria 2636
63 Ga0105251_10014085 3300009011 Bacteria 4441
64 Ga0105244_10004517 3300009036 Bacteria 9549
65 Ga0105244_10086106 3300009036 Bacteria 1550
66 Ga0105240_10494751 3300009093 Bacteria 1361
67 Ga0111539_10047017 3300009094 Bacteria 5159
68 Ga0105245_10000283 3300009098 Bacteria 48302
69 Ga0105245_10011020 3300009098 Bacteria 7868
70 Ga0105245_10127864 3300009098 Bacteria 2380
71 Ga0105245_10331354 3300009098 Bacteria 1502
72 Ga0105247_10000649 3300009101 Bacteria 27562
73 Ga0114129_10429267 3300009147 Bacteria 1736
74 Ga0105243_10026965 3300009148 Bacteria 4400
75 Ga0105243_10064123 3300009148 Bacteria 2947
76 Ga0105241_10028290 3300009174 Bacteria 4177
77 Ga0105248_10002486 3300009177 Bacteria 20480
78 Ga0105248_10051753 3300009177 Bacteria 4608
79 Ga0105237_10087995 3300009545 Bacteria 3095
80 Ga0105238_10242197 3300009551 Bacteria 1781
81 Ga0105246_10013664 3300011119 Bacteria 5095
82 Ga0157369_10011880 3300013105 Bacteria 9891
83 Ga0157369_10128563 3300013105 Bacteria 2685
84 Ga0163162_10087353 3300013306 Bacteria 3197
85 Ga0163162_10166688 3300013306 Bacteria 2327
86 Ga0163162_10196397 3300013306 Bacteria 2147
87 Ga0157375_10051386 3300013308 Bacteria 4047
88 Ga0157375_10225014 3300013308 Bacteria 2035
89 Ga0163163_10029162 3300014325 Bacteria 5307
90 Ga0157380_10001287 3300014326 Bacteria 16323
91 Ga0182008_10081392 3300014497 Bacteria 1594
92 Ga0157377_10105179 3300014745 Bacteria 1689
93 Ga0157379_10063437 3300014968 Bacteria 3303
94 Ga0157379_10084390 3300014968 Bacteria 2846
95 Ga0157376_10072535 3300014969 Bacteria 2929
96 Ga0163161_10098728 3300017792 Bacteria 2171
97 Ga0207427_100121 3300025231 Bacteria 99954
98 Ga0209437_100398 3300025233 Bacteria 40556
99 Ga0209233_1000014 3300025261 Bacteria 996641
100 Ga0209051_1014337 3300025303 Bacteria 3705
101 Ga0207697_10000412 3300025315 Bacteria 24182
102 Ga0207697_10000805 3300025315 Bacteria 17773
103 Ga0207655_1001561 3300025728 Bacteria 20650
104 Ga0207655_1015236 3300025728 Bacteria 4286
105 Ga0207655_1072177 3300025728 Bacteria 1278
106 Ga0207713_1035501 3300025735 Bacteria 2151
107 Ga0207682_10009340 3300025893 Bacteria 3875
108 Ga0207692_10019244 3300025898 Bacteria 3082
109 Ga0207692_10046702 3300025898 Bacteria 2172
110 Ga0207710_10000426 3300025900 Bacteria 27570
111 Ga0207680_10005659 3300025903 Bacteria 5980
112 Ga0207680_10015104 3300025903 Bacteria 4021
113 Ga0207645_10011034 3300025907 Bacteria 6182
114 Ga0207684_10053071 3300025910 Bacteria 3441
115 Ga0207671_10015734 3300025914 Bacteria 5909
116 Ga0207652_10000307 3300025921 Bacteria 50351
117 Ga0207681_10006222 3300025923 Bacteria 7321
118 Ga0207650_10017213 3300025925 Bacteria 5059
119 Ga0207687_10000007 3300025927 Bacteria 604185
120 Ga0207687_10006313 3300025927 Bacteria 7836
121 Ga0207687_10096326 3300025927 Bacteria 2168
122 Ga0207687_10183817 3300025927 Bacteria 1621
123 Ga0207700_10068410 3300025928 Bacteria 2722
124 Ga0207700_10078482 3300025928 Bacteria 2569
125 Ga0207700_10086654 3300025928 Bacteria 2461
126 Ga0207664_10070326 3300025929 Bacteria 2816
127 Ga0207664_10071978 3300025929 Bacteria 2786
128 Ga0207664_10099587 3300025929 Bacteria 2399
129 Ga0207690_10140296 3300025932 Bacteria 1780
130 Ga0207709_10012655 3300025935 Bacteria 4650
131 Ga0207709_10091230 3300025935 Bacteria 1992
132 Ga0207709_10204160 3300025935 Bacteria 1414
133 Ga0207670_10366002 3300025936 Bacteria 1145
134 Ga0207691_10000020 3300025940 Bacteria 133465
135 Ga0207691_10004975 3300025940 Bacteria 12820
136 Ga0207711_10003747 3300025941 Bacteria 13102
137 Ga0207711_10033740 3300025941 Bacteria 4333
138 Ga0207661_10028785 3300025944 Bacteria 4259
139 Ga0207661_10059884 3300025944 Bacteria 3070
140 Ga0207667_10017456 3300025949 Bacteria 8075
141 Ga0207658_10033339 3300025986 Bacteria 3673
142 Ga0207677_10002503 3300026023 Bacteria 9629
143 Ga0207678_10008282 3300026067 Bacteria 9160
144 Ga0207641_10452932 3300026088 Bacteria 1240
145 Ga0207674_10089520 3300026116 Bacteria 3070
146 Ga0207675_100120076 3300026118 Bacteria 2486
147 Ga0207683_10010818 3300026121 Bacteria 7780
148 Ga0207698_10004988 3300026142 Bacteria 8138
149 Ga0268266_10000247 3300028379 Bacteria 91489
150 Ga0268266_10055236 3300028379 Bacteria 3414
151 Ga0268266_10216492 3300028379 Bacteria 1759
152 Ga0265327_10000185 3300031251 Bacteria 131884
153 Ga0307408_100013782 3300031548 Bacteria 5367
154 Ga0307408_100023549 3300031548 Bacteria 4196
155 Ga0307408_100040648 3300031548 Bacteria 3293
156 Ga0307408_100055570 3300031548 Bacteria 2867
157 Ga0307408_100111811 3300031548 Bacteria 2099
158 Ga0307408_100291219 3300031548 Bacteria 1363
159 Ga0316575_10057679 3300031665 Bacteria 1548
160 Ga0265314_10196952 3300031711 Bacteria 1194
161 Ga0316576_10054072 3300031727 Bacteria 2927
162 Ga0316576_10198281 3300031727 Bacteria 1512
163 Ga0316578_10104212 3300031728 Bacteria 1701
164 Ga0307405_10011780 3300031731 Bacteria 4602
165 Ga0307405_10036506 3300031731 Bacteria 2945
166 Ga0307405_10053912 3300031731 Bacteria 2507
167 Ga0307405_10119569 3300031731 Bacteria 1800
168 Ga0307405_10154368 3300031731 Bacteria 1618
169 Ga0307405_10270291 3300031731 Bacteria 1274
170 Ga0316577_10064343 3300031733 Bacteria 2047
171 Ga0307413_10034494 3300031824 Bacteria 2893
172 Ga0307413_10174299 3300031824 Bacteria 1526
173 Ga0307410_10010463 3300031852 Bacteria 5255
174 Ga0307410_10013862 3300031852 Bacteria 4720
175 Ga0307410_10020455 3300031852 Bacteria 4048
176 Ga0307410_10053308 3300031852 Bacteria 2736
177 Ga0307410_10070214 3300031852 Bacteria 2425
178 Ga0307410_10084101 3300031852 Bacteria 2242
179 Ga0307410_10218937 3300031852 Bacteria 1463
180 Ga0307406_10017791 3300031901 Bacteria 4144
181 Ga0307406_10358366 3300031901 Bacteria 1142
182 Ga0307407_10080587 3300031903 Bacteria 1967
183 Ga0307407_10152675 3300031903 Bacteria 1502
184 Ga0307407_10197490 3300031903 Bacteria 1345
185 Ga0307407_10260019 3300031903 Bacteria 1193
186 Ga0307412_10013690 3300031911 Bacteria 4764
187 Ga0307412_10037005 3300031911 Bacteria 3132
188 Ga0307412_10064761 3300031911 Bacteria 2470
189 Ga0307412_10080167 3300031911 Bacteria 2254
190 Ga0307412_10091620 3300031911 Bacteria 2128
191 Ga0307409_100012546 3300031995 Bacteria 5406
192 Ga0307409_100071534 3300031995 Bacteria 2758
193 Ga0307409_100481273 3300031995 Bacteria 1204
194 Ga0307416_100010248 3300032002 Bacteria 6181
195 Ga0307416_100029141 3300032002 Bacteria 4119
196 Ga0307416_100137154 3300032002 Bacteria 2216
197 Ga0307416_100196760 3300032002 Bacteria 1907
198 Ga0307414_10073426 3300032004 Bacteria 2475
199 Ga0307411_10074238 3300032005 Bacteria 2317
200 Ga0307411_10089306 3300032005 Bacteria 2146
201 Ga0307415_100141554 3300032126 Bacteria 1838
202 Ga0307415_100184087 3300032126 Bacteria 1642
203 Ga0373955_0035028 3300035172 Bacteria 2656
204 Ga0316574_0005931 3300035398 Bacteria 6554
205 Ga0316574_0006035 3300035398 Bacteria 6509
206 Ga0373933_0048202 3300035724 Bacteria 2536
207 Ga0373937_0132777 3300036401 Bacteria 2326
208 Ga0373937_0179742 3300036401 Bacteria 1986
209 Ga0316584_0007562 3300036712 Bacteria 7444
210 Ga0395899_0026430 3300037312 Bacteria 4380
211 Ga0395899_0054998 3300037312 Bacteria 2944
212 Ga0395900_0033677 3300037418 Bacteria 5272
213 Ga0395900_0037495 3300037418 Bacteria 4997
214 Ga0395900_0045178 3300037418 Bacteria 4537
215 Ga0395900_0118224 3300037418 Bacteria 2720
216 Ga0395898_0004605 3300037466 Bacteria 15056
217 Ga0395898_0017201 3300037466 Bacteria 7385
218 Ga0395898_0078315 3300037466 Bacteria 3189
219 Ga0395898_0170274 3300037466 Bacteria 2082
220 Ga0395898_0267589 3300037466 Bacteria 1630
221 Ga0395905_0027277 3300037471 Bacteria 5386
222 Ga0395905_0210047 3300037471 Bacteria 1824
223 Ga0395905_0264361 3300037471 Bacteria 1606
224 Ga0395905_0324355 3300037471 Bacteria 1430
225 Ga0395901_0003181 3300038443 Bacteria 16522
226 Ga0395901_0011883 3300038443 Bacteria 8830
227 Ga0395901_0035723 3300038443 Bacteria 5135
228 Ga0395901_0080928 3300038443 Bacteria 3392
229 Ga0395901_0256804 3300038443 Bacteria 1820
230 Ga0395901_0371763 3300038443 Bacteria 1472
231 Ga0395901_0524316 3300038443 Bacteria 1203
232 Ga0436365_0724850 3300039437 Bacteria 1564
233 Ga0439436_0007508 3300041404 Bacteria 3355
234 Ga0439438_038191 3300041405 Bacteria 1254
235 Ga0439433_0000691 3300041999 Bacteria 6540
236 Ga0439442_000626 3300042002 Bacteria 7588
237 Ga0439442_001124 3300042002 Bacteria 5337
238 Ga0439442_007323 3300042002 Bacteria 2218
239 Ga0439449_0002127 3300042007 Bacteria 7772
240 Ga0450920_005486 3300042122 Bacteria 2255
241 Ga0450907_021614 3300042146 Bacteria 1083
242 Ga0439434_0051787 3300042435 Bacteria 1273
243 Ga0450918_000907 3300042531 Bacteria 6221
244 Ga0466972_0030217 3300044658 Bacteria 2667
245 Ga0466965_0033576 3300044683 Bacteria 2508
246 Ga0466966_0020935 3300044684 Bacteria 4299
247 Ga0466966_0041355 3300044684 Bacteria 2962
248 Ga0466966_0043899 3300044684 Bacteria 2864
249 Ga0466966_0103634 3300044684 Bacteria 1758
250 Ga0466961_0009077 3300044693 Bacteria 6341
251 Ga0466961_0025242 3300044693 Bacteria 3822
252 Ga0466961_0072357 3300044693 Bacteria 2187
253 Ga0466963_0039236 3300044694 Bacteria 3100
254 Ga0466963_0073702 3300044694 Bacteria 2302
255 Ga0466964_0008906 3300044706 Bacteria 3774
256 Ga0466964_0017579 3300044706 Bacteria 2736
257 Ga0466971_0019650 3300044719 Bacteria 3001
258 Ga0466957_0009318 3300044842 Bacteria 5601
259 Ga0466957_0038853 3300044842 Bacteria 2870
260 Ga0466957_0066346 3300044842 Bacteria 2224
261 Ga0466957_0203217 3300044842 Bacteria 1302
262 Ga0466957_0236820 3300044842 Bacteria 1210
263 Ga0466957_0317545 3300044842 Bacteria 1050
264 Ga0466960_0032948 3300044901 Bacteria 2404
265 Ga0466960_0103361 3300044901 Bacteria 1471
266 Ga0466959_0054389 3300045049 Bacteria 2925
267 Ga0466959_0094148 3300045049 Bacteria 2149
268 Ga0466959_0130226 3300045049 Bacteria 1783
269 Ga0466958_0033163 3300045836 Bacteria 3075
270 Ga0466958_0178183 3300045836 Bacteria 1348
271 Ga0466967_0000046 3300045976 Bacteria 43911
272 Ga0466967_0000612 3300045976 Bacteria 17825
273 Ga0466967_0005868 3300045976 Bacteria 8595
274 Ga0466967_0009345 3300045976 Bacteria 7268
275 Ga0466967_0044098 3300045976 Bacteria 3866
276 Ga0466967_0061255 3300045976 Bacteria 3338
277 Ga0466967_0153368 3300045976 Bacteria 2155
278 Ga0466967_0572783 3300045976 Bacteria 1112
279 Ga0495603_0024979 3300046455 Bacteria 3614
280 Ga0495629_0004724 3300046459 Bacteria 10209
281 Ga0495641_0020863 3300046461 Bacteria 3310
282 Ga0495651_0128347 3300046462 Bacteria 1854
283 Ga0495653_0009152 3300046463 Bacteria 8097
284 Ga0495653_0022005 3300046463 Bacteria 5159
285 Ga0495662_0009886 3300046476 Bacteria 4685
286 Ga0495664_0006098 3300046477 Bacteria 6652
287 Ga0495608_0013436 3300046511 Bacteria 5678
288 Ga0495608_0019322 3300046511 Bacteria 4691
289 Ga0495628_0032870 3300046516 Bacteria 4184
290 Ga0495628_0085569 3300046516 Bacteria 2446
291 Ga0495630_0053754 3300046517 Bacteria 3016
292 Ga0495643_0059295 3300046522 Bacteria 2035
293 Ga0495644_0051253 3300046523 Bacteria 1550
294 Ga0495652_0000963 3300046529 Bacteria 32966
295 Ga0495652_0139583 3300046529 Bacteria 1907
296 Ga0495665_0004768 3300046531 Bacteria 7323
297 Ga0495665_0009914 3300046531 Bacteria 5158
298 Ga0495640_0036993 3300046533 Bacteria 3446
299 Ga0495586_0001117 3300046535 Bacteria 15104
300 Ga0495586_0005810 3300046535 Bacteria 6597
301 Ga0495586_0074036 3300046535 Bacteria 1863
302 Ga0495587_0001817 3300046536 Bacteria 14247
303 Ga0495587_0017319 3300046536 Bacteria 4477
304 Ga0495587_0028986 3300046536 Bacteria 3363
305 Ga0495587_0038827 3300046536 Bacteria 2852
306 Ga0495645_0010369 3300046543 Bacteria 6530
307 Ga0495667_0004558 3300046559 Bacteria 9357
308 Ga0495667_0114280 3300046559 Bacteria 1744
309 Ga0495656_0119711 3300046615 Bacteria 1241
310 Ga0495668_0001186 3300046616 Bacteria 26476
311 Ga0495625_0000405 3300046660 Bacteria 65434
312 Ga0495635_0013408 3300046663 Bacteria 5738
313 Ga0495635_0056709 3300046663 Bacteria 2696
314 Ga0495588_0050607 3300046674 Bacteria 2138
315 Ga0495588_0084628 3300046674 Bacteria 1657
316 Ga0495657_0001607 3300046675 Bacteria 19422
317 Ga0495657_0088487 3300046675 Bacteria 1991
318 Ga0495657_0227745 3300046675 Bacteria 1128
319 Ga0495599_0064303 3300046678 Bacteria 2292
320 Ga0495623_0075488 3300046679 Bacteria 2093
321 Ga0495646_0168007 3300046680 Bacteria 1210
322 Ga0495613_0317023 3300046689 Bacteria 1077
323 Ga0495600_0037813 3300046809 Bacteria 3139
324 Ga0495581_0002683 3300047315 Bacteria 10124
325 Ga0495581_0020363 3300047315 Bacteria 3850
326 Ga0495581_0086250 3300047315 Bacteria 1820
327 Ga0495604_0059748 3300047317 Bacteria 2921
328 Ga0495604_0074833 3300047317 Bacteria 2551
329 Ga0495636_0027125 3300047318 Bacteria 2333
330 Ga0495674_0000010 3300047319 Bacteria 285794
331 Ga0495674_0061276 3300047319 Bacteria 3280
332 Ga0495680_0031417 3300047322 Bacteria 4323
333 Ga0495675_0058871 3300047444 Bacteria 2436
334 Ga0495685_050541 3300047447 Bacteria 1411
335 Ga0495681_0092848 3300047470 Bacteria 1330
336 Ga0495602_0032497 3300048088 Bacteria 4911
337 Ga0495602_0034084 3300048088 Bacteria 4768
338 Ga0496100_0002534 3300048903 Bacteria 9310
339 Ga0496100_0082682 3300048903 Bacteria 2172
340 Ga0496100_0264148 3300048903 Bacteria 1277
341 Ga0496101_0067947 3300048904 Bacteria 2604
342 Ga0496101_0106070 3300048904 Bacteria 2109
343 Ga0496101_0234649 3300048904 Bacteria 1426
344 Ga0496102_0016228 3300048905 Bacteria 6508
345 Ga0496102_0078635 3300048905 Bacteria 3036
346 Ga0496102_0103738 3300048905 Bacteria 2644
347 Ga0496102_0622148 3300048905 Bacteria 1003
348 Ga0496103_0006871 3300048906 Bacteria 6795
349 Ga0496103_0074188 3300048906 Bacteria 2132
350 Ga0496103_0095568 3300048906 Bacteria 1877
351 Ga0496103_0162656 3300048906 Bacteria 1432
352 Ga0496103_0193503 3300048906 Bacteria 1307
353 Ga0496103_0212618 3300048906 Bacteria 1244
354 Ga0496104_0011647 3300048907 Bacteria 7883
355 Ga0496104_0081051 3300048907 Bacteria 3094
356 Ga0496104_0082565 3300048907 Bacteria 3064
357 Ga0496104_0100173 3300048907 Bacteria 2773
358 Ga0496104_0126230 3300048907 Bacteria 2457
359 Ga0496104_0352886 3300048907 Bacteria 1383
360 Ga0496104_0473952 3300048907 Bacteria 1163
361 Ga0496104_0616458 3300048907 Bacteria 995
362 Ga0496105_0001910 3300048908 Bacteria 14963
363 Ga0496105_0010789 3300048908 Bacteria 7195
364 Ga0496105_0011313 3300048908 Bacteria 7046
365 Ga0496105_0012678 3300048908 Bacteria 6676
366 Ga0496106_0066818 3300048909 Bacteria 2739
367 Ga0496107_0066381 3300048910 Bacteria 2616
368 Ga0496107_0089133 3300048910 Bacteria 2252
369 Ga0496107_0099363 3300048910 Bacteria 2132
370 Ga0496107_0101513 3300048910 Bacteria 2109
371 Ga0496108_0060794 3300048911 Bacteria 3179
372 Ga0496108_0284587 3300048911 Bacteria 1439
373 Ga0496109_0065082 3300048912 Bacteria 3337
374 Ga0496109_0090027 3300048912 Bacteria 2837
375 Ga0496109_0142977 3300048912 Bacteria 2237
376 Ga0496109_0143866 3300048912 Bacteria 2230
377 Ga0496109_0172745 3300048912 Bacteria 2028
378 Ga0496109_0446707 3300048912 Bacteria 1221
379 Ga0496110_0000033 3300048913 Bacteria 65539
380 Ga0496110_0019534 3300048913 Bacteria 5704
381 Ga0496110_0034154 3300048913 Bacteria 4404
382 Ga0496110_0065488 3300048913 Bacteria 3212
383 Ga0496110_0094192 3300048913 Bacteria 2681
384 Ga0496110_0106804 3300048913 Bacteria 2512
385 Ga0496110_0150154 3300048913 Bacteria 2109
386 Ga0496110_0220100 3300048913 Bacteria 1726
387 Ga0496111_0000125 3300048914 Bacteria 33642
388 Ga0496111_0010066 3300048914 Bacteria 6327
389 Ga0496111_0037221 3300048914 Bacteria 3482
390 Ga0496111_0049676 3300048914 Bacteria 3025
391 Ga0496111_0052692 3300048914 Bacteria 2938
392 Ga0496111_0082037 3300048914 Bacteria 2354
393 Ga0496111_0109015 3300048914 Bacteria 2038
394 Ga0496111_0125473 3300048914 Bacteria 1897
395 Ga0496112_0008431 3300048915 Bacteria 9230
396 Ga0496112_0010109 3300048915 Bacteria 8544
397 Ga0496112_0028414 3300048915 Bacteria 5398
398 Ga0496112_0045827 3300048915 Bacteria 4286
399 Ga0496113_0037714 3300048916 Bacteria 3549
400 Ga0496113_0194175 3300048916 Bacteria 1612
401 Ga0496113_0415677 3300048916 Bacteria 1080
402 Ga0496114_0000014 3300048917 Bacteria 297902
403 Ga0496114_0015629 3300048917 Bacteria 6104
404 Ga0496114_0043091 3300048917 Bacteria 3742
405 Ga0496114_0095133 3300048917 Bacteria 2534
406 Ga0496114_0516034 3300048917 Bacteria 1057
407 Ga0496115_0000255 3300048918 Bacteria 47200
408 Ga0496116_0004412 3300048919 Bacteria 13448
409 Ga0496117_0013864 3300048920 Bacteria 6990
410 Ga0496118_0004985 3300048921 Bacteria 15350
411 Ga0496118_0033975 3300048921 Bacteria 4172
412 Ga0496118_0055942 3300048921 Bacteria 2971
413 Ga0496119_0001069 3300048922 Bacteria 34780
414 Ga0496119_0004707 3300048922 Bacteria 13419
415 Ga0496119_0027032 3300048922 Bacteria 3959
416 Ga0496120_0000954 3300048923 Bacteria 39412
417 Ga0496120_0012901 3300048923 Bacteria 5656
418 Ga0496121_0001544 3300048924 Bacteria 38548
419 Ga0496121_0011110 3300048924 Bacteria 10049
420 Ga0496124_0022784 3300048927 Bacteria 5734
421 Ga0496124_0318505 3300048927 Bacteria 1115
422 Ga0496125_0050035 3300048928 Bacteria 3465
423 Ga0496126_0004638 3300048929 Bacteria 16263
424 Ga0496126_0042775 3300048929 Bacteria 4182
425 Ga0501031_0010455 3300049568 Bacteria 6044
426 Ga0501032_0013510 3300049569 Bacteria 5805
427 Ga0501033_0001230 3300049570 Bacteria 22966
428 Ga0501034_0000488 3300049571 Bacteria 64385
429 Ga0501034_0007155 3300049571 Bacteria 11908
430 Ga0501036_0015200 3300049572 Bacteria 6426
431 Ga0501036_0033895 3300049572 Bacteria 4319
432 Ga0501037_0003173 3300049573 Bacteria 11932
433 Ga0501037_0060828 3300049573 Bacteria 2755
434 Ga0501038_0011896 3300049574 Bacteria 7942
435 Ga0501038_0019496 3300049574 Bacteria 6112
436 Ga0501038_0027134 3300049574 Bacteria 5097
437 Ga0501038_0251056 3300049574 Bacteria 1401
438 Ga0501039_0034021 3300049575 Bacteria 3932
439 Ga0501040_0029679 3300049576 Bacteria 3693
440 Ga0501042_0047764 3300049578 Bacteria 3052
441 Ga0501043_0003943 3300049579 Bacteria 12172
442 Ga0501043_0015464 3300049579 Bacteria 5977
443 Ga0501043_0271003 3300049579 Bacteria 1303
444 Ga0501046_0005091 3300049580 Bacteria 11789
445 Ga0501047_0003010 3300049581 Bacteria 15995
446 Ga0501047_0004573 3300049581 Bacteria 13013
447 Ga0501047_0157361 3300049581 Bacteria 2145
448 Ga0501047_0187966 3300049581 Bacteria 1930
449 Ga0501048_0013723 3300049582 Bacteria 6011
450 Ga0501067_0159944 3300049583 Bacteria 1254
451 Ga0501068_0016389 3300049584 Bacteria 4272
452 Ga0501069_0018808 3300049585 Bacteria 3730
453 Ga0501070_0001442 3300049586 Bacteria 21250
454 Ga0501070_0009904 3300049586 Bacteria 8056
455 Ga0501073_0004815 3300049589 Bacteria 10129
456 Ga0501074_0262451 3300049590 Bacteria 1228
457 Ga0501079_0022506 3300049741 Bacteria 4833
458 Ga0501080_0015178 3300049742 Bacteria 7097
459 Ga0501080_0027273 3300049742 Bacteria 5312
460 Ga0501083_0013347 3300049744 Bacteria 5744
461 Ga0501083_0015680 3300049744 Bacteria 5304
462 Ga0501035_0006942 3300049822 Bacteria 10578
463 Ga0501035_0038818 3300049822 Bacteria 4310
464 Ga0501044_0003363 3300049823 Bacteria 18035
465 Ga0501044_0007886 3300049823 Bacteria 11703
466 Ga0501044_0103282 3300049823 Bacteria 2865
467 Ga0501044_0149191 3300049823 Bacteria 2321
468 Ga0501044_0264730 3300049823 Bacteria 1657
469 Ga0501045_0135018 3300049824 Bacteria 1834
470 nmdc:mga00v17_111408_c1 3300050491 Bacteria 1736
471 nmdc:mga07m45_56218_c1 3300050496 Bacteria 2224
472 nmdc:mga09592_5164_c1 3300050508 Bacteria 10606
473 nmdc:mga08y16_10921_c1 3300050511 Bacteria 9538
474 nmdc:mga08x19_62034_c1 3300050514 Bacteria 2423
475 nmdc:mga0a205_86829_c1 3300050515 Bacteria 3022
476 Ga0495601_0089996 3300053077 Bacteria 1974
477 Ga0495655_0032815 3300053083 Bacteria 1274
478 Ga0495595_0001728 3300053084 Bacteria 8542
479 Ga0495619_0000022 3300053085 Bacteria 184144
480 Ga0495619_0008692 3300053085 Bacteria 6423
481 Ga0495619_0025018 3300053085 Bacteria 3831
482 Ga0500641_0014422 3300053096 Bacteria 2917
483 Ga0500556_0000644 3300053104 Bacteria 21874
484 Ga0500568_0000032 3300053139 Bacteria 147655
485 Ga0500590_051967 3300053148 Bacteria 2081
486 Ga0500599_002653 3300053736 Bacteria 2157
487 Ga0501082_0074467 3300060353 Bacteria 2924
488 Ga0466962_0005187 3300061719 Bacteria 6270
489 Ga0466962_0146809 3300061719 Bacteria 1144
490 2537900890 2537561592 Bacteria 4348607
491 2555230342 2554235227 Bacteria 3637389
492 2566992160 2565956761 Bacteria 6601618
493 2644094552 2643221616 Bacteria 4066575
494 2644102111 2643221617 Bacteria 5139111
495 2644115334 2643221620 Bacteria 5134593
496 2644607547 2643221711 Bacteria 4865335
497 2655033937 2654587600 Bacteria 3911798
498 2738870294 2738541305 Bacteria 4910150
499 2738888348 2738541308 Bacteria 7020677
500 2753035989 2751185725 Bacteria 5740550
501 2753325986 2751185792 Bacteria 5739090
502 2808894272 2808606370 Bacteria 4942454
503 2812373694 2811994882 Bacteria 4688362
504 2819426307 2818991318 Bacteria 5266538
505 2819665342 2818991458 Bacteria 4794049
506 2819691446 2818991462 Bacteria 4320267
507 2819727517 2818991469 Bacteria 4644110
508 2884764023 2884763398 Bacteria 4091164
509 2904538018 2904535858 Bacteria 6308016
510 2904778125 2904776348 Bacteria 4658726
511 2910814818 2910809715 Bacteria 4982797
512 2919060178 2919059106 Bacteria 4991624
513 2919395304 2919391150 Bacteria 4884741
514 2922557201 2922554459 Bacteria 6683962
515 2939650308 2939647034 Bacteria 4681660
516 2945923835 2945920336 Bacteria 4501603
517 2945944506 2945941187 Bacteria 4682474
518 2945957304 2945956166 Bacteria 5110334
519 2946040421 2946037020 Bacteria 4900426
520 2954001686 2953998280 Bacteria 4812144
521 2974316489 2974315732 Bacteria 4602776
522 8054109746 8054107350 Bacteria 5022511
523 Ga0501032_0003416
524 JGI25162J39368_1010273
525 JGI25164J39214_1001102
526 JGI25165J46597_1000014
527 rootH2_10085513
528 Ga0070683_100155886
529 Ga0070670_100138735
530 Ga0070666_10038337
531 Ga0070666_10180959
532 Ga0070689_100231213
533 Ga0070668_100244320
534 Ga0070669_100008474
535 Ga0070669_100010580
536 Ga0070675_100004238
537 Ga0070671_100017642
538 Ga0070674_100127830
539 Ga0070673_100279268
540 Ga0070688_100005702
541 Ga0070688_100005975
542 Ga0070667_100128201
543 Ga0070667_100139945
544 Ga0070714_100037632
545 Ga0070714_100078053
546 Ga0070714_100118612
547 Ga0070713_100001904
548 Ga0070713_100050180
549 Ga0070713_100140360
550 Ga0070708_100283441
551 Ga0070663_100000859
552 Ga0070678_100012734
553 Ga0070685_10000018
554 Ga0070685_10001560
555 Ga0070706_100099689
556 Ga0070707_100158946
557 Ga0070698_100014435
558 Ga0070698_100128061
559 Ga0070699_100031996
560 Ga0070679_100037721
561 Ga0070684_100049369
562 Ga0070672_100000004
563 Ga0070672_100108289
564 Ga0070665_100051052
565 Ga0070665_100090558
566 Ga0068855_100009285
567 Ga0068857_100089264
568 Ga0068856_100149750
569 Ga0068852_100039173
570 Ga0068863_100063307
571 Ga0068863_100468378
572 Ga0081540_1000129
573 Ga0070717_10038018
574 Ga0070717_10083773
575 Ga0075365_10050547
576 Ga0075365_10242647
577 Ga0075363_100055329
578 Ga0075364_10093978
579 Ga0075432_10000095
580 Ga0075428_100302719
581 Ga0075433_10010907
582 Ga0075434_100021060
583 Ga0075429_100006435
584 Ga0075436_100059614
585 Ga0105251_10014085
586 Ga0105244_10004517
587 Ga0105244_10086106
588 Ga0105240_10494751
589 Ga0111539_10047017
590 Ga0105245_10000283
591 Ga0105245_10011020
592 Ga0105245_10127864
593 Ga0105245_10331354
594 Ga0105247_10000649
595 Ga0114129_10429267
596 Ga0105243_10026965
597 Ga0105243_10064123
598 Ga0105241_10028290
599 Ga0105248_10002486
600 Ga0105248_10051753
601 Ga0105237_10087995
602 Ga0105238_10242197
603 Ga0105246_10013664
604 Ga0157369_10011880
605 Ga0157369_10128563
606 Ga0163162_10087353
607 Ga0163162_10166688
608 Ga0163162_10196397
609 Ga0157375_10051386
610 Ga0157375_10225014
611 Ga0163163_10029162
612 Ga0157380_10001287
613 Ga0182008_10081392
614 Ga0157377_10105179
615 Ga0157379_10063437
616 Ga0157379_10084390
617 Ga0157376_10072535
618 Ga0163161_10098728
619 Ga0207427_100121
620 Ga0209437_100398
621 Ga0209233_1000014
622 Ga0209051_1014337
623 Ga0207697_10000412
624 Ga0207697_10000805
625 Ga0207655_1001561
626 Ga0207655_1015236
627 Ga0207655_1072177
628 Ga0207713_1035501
629 Ga0207682_10009340
630 Ga0207692_10019244
631 Ga0207692_10046702
632 Ga0207710_10000426
633 Ga0207680_10005659
634 Ga0207680_10015104
635 Ga0207645_10011034
636 Ga0207684_10053071
637 Ga0207671_10015734
638 Ga0207652_10000307
639 Ga0207681_10006222
640 Ga0207650_10017213
641 Ga0207687_10000007
642 Ga0207687_10006313
643 Ga0207687_10096326
644 Ga0207687_10183817
645 Ga0207700_10068410
646 Ga0207700_10078482
647 Ga0207700_10086654
648 Ga0207664_10070326
649 Ga0207664_10071978
650 Ga0207664_10099587
651 Ga0207690_10140296
652 Ga0207709_10012655
653 Ga0207709_10091230
654 Ga0207709_10204160
655 Ga0207670_10366002
656 Ga0207691_10000020
657 Ga0207691_10004975
658 Ga0207711_10003747
659 Ga0207711_10033740
660 Ga0207661_10028785
661 Ga0207661_10059884
662 Ga0207667_10017456
663 Ga0207658_10033339
664 Ga0207677_10002503
665 Ga0207678_10008282
666 Ga0207641_10452932
667 Ga0207674_10089520
668 Ga0207675_100120076
669 Ga0207683_10010818
670 Ga0207698_10004988
671 Ga0268266_10000247
672 Ga0268266_10055236
673 Ga0268266_10216492
674 Ga0265327_10000185
675 Ga0307408_100013782
676 Ga0307408_100023549
677 Ga0307408_100040648
678 Ga0307408_100055570
679 Ga0307408_100111811
680 Ga0307408_100291219
681 Ga0316575_10057679
682 Ga0265314_10196952
683 Ga0316576_10054072
684 Ga0316576_10198281
685 Ga0316578_10104212
686 Ga0307405_10011780
687 Ga0307405_10036506
688 Ga0307405_10053912
689 Ga0307405_10119569
690 Ga0307405_10154368
691 Ga0307405_10270291
692 Ga0316577_10064343
693 Ga0307413_10034494
694 Ga0307413_10174299
695 Ga0307410_10010463
696 Ga0307410_10013862
697 Ga0307410_10020455
698 Ga0307410_10053308
699 Ga0307410_10070214
700 Ga0307410_10084101
701 Ga0307410_10218937
702 Ga0307406_10017791
703 Ga0307406_10358366
704 Ga0307407_10080587
705 Ga0307407_10152675
706 Ga0307407_10197490
707 Ga0307407_10260019
708 Ga0307412_10013690
709 Ga0307412_10037005
710 Ga0307412_10064761
711 Ga0307412_10080167
712 Ga0307412_10091620
713 Ga0307409_100012546
714 Ga0307409_100071534
715 Ga0307409_100481273
716 Ga0307416_100010248
717 Ga0307416_100029141
718 Ga0307416_100137154
719 Ga0307416_100196760
720 Ga0307414_10073426
721 Ga0307411_10074238
722 Ga0307411_10089306
723 Ga0307415_100141554
724 Ga0307415_100184087
725 Ga0373955_0035028
726 Ga0316574_0005931
727 Ga0316574_0006035
728 Ga0373933_0048202
729 Ga0373937_0132777
730 Ga0373937_0179742
731 Ga0316584_0007562
732 Ga0395899_0026430
733 Ga0395899_0054998
734 Ga0395900_0033677
735 Ga0395900_0037495
736 Ga0395900_0045178
737 Ga0395900_0118224
738 Ga0395898_0004605
739 Ga0395898_0017201
740 Ga0395898_0078315
741 Ga0395898_0170274
742 Ga0395898_0267589
743 Ga0395905_0027277
744 Ga0395905_0210047
745 Ga0395905_0264361
746 Ga0395905_0324355
747 Ga0395901_0003181
748 Ga0395901_0011883
749 Ga0395901_0035723
750 Ga0395901_0080928
751 Ga0395901_0256804
752 Ga0395901_0371763
753 Ga0395901_0524316
754 Ga0436365_0724850
755 Ga0439436_0007508
756 Ga0439438_038191
757 Ga0439433_0000691
758 Ga0439442_000626
759 Ga0439442_001124
760 Ga0439442_007323
761 Ga0439449_0002127
762 Ga0450920_005486
763 Ga0450907_021614
764 Ga0439434_0051787
765 Ga0450918_000907
766 Ga0466972_0030217
767 Ga0466965_0033576
768 Ga0466966_0020935
769 Ga0466966_0041355
770 Ga0466966_0043899
771 Ga0466966_0103634
772 Ga0466961_0009077
773 Ga0466961_0025242
774 Ga0466961_0072357
775 Ga0466963_0039236
776 Ga0466963_0073702
777 Ga0466964_0008906
778 Ga0466964_0017579
779 Ga0466971_0019650
780 Ga0466957_0009318
781 Ga0466957_0038853
782 Ga0466957_0066346
783 Ga0466957_0203217
784 Ga0466957_0236820
785 Ga0466957_0317545
786 Ga0466960_0032948
787 Ga0466960_0103361
788 Ga0466959_0054389
789 Ga0466959_0094148
790 Ga0466959_0130226
791 Ga0466958_0033163
792 Ga0466958_0178183
793 Ga0466967_0000046
794 Ga0466967_0000612
795 Ga0466967_0005868
796 Ga0466967_0009345
797 Ga0466967_0044098
798 Ga0466967_0061255
799 Ga0466967_0153368
800 Ga0466967_0572783
801 Ga0495603_0024979
802 Ga0495629_0004724
803 Ga0495641_0020863
804 Ga0495651_0128347
805 Ga0495653_0009152
806 Ga0495653_0022005
807 Ga0495662_0009886
808 Ga0495664_0006098
809 Ga0495608_0013436
810 Ga0495608_0019322
811 Ga0495628_0032870
812 Ga0495628_0085569
813 Ga0495630_0053754
814 Ga0495643_0059295
815 Ga0495644_0051253
816 Ga0495652_0000963
817 Ga0495652_0139583
818 Ga0495665_0004768
819 Ga0495665_0009914
820 Ga0495640_0036993
821 Ga0495586_0001117
822 Ga0495586_0005810
823 Ga0495586_0074036
824 Ga0495587_0001817
825 Ga0495587_0017319
826 Ga0495587_0028986
827 Ga0495587_0038827
828 Ga0495645_0010369
829 Ga0495667_0004558
830 Ga0495667_0114280
831 Ga0495656_0119711
832 Ga0495668_0001186
833 Ga0495625_0000405
834 Ga0495635_0013408
835 Ga0495635_0056709
836 Ga0495588_0050607
837 Ga0495588_0084628
838 Ga0495657_0001607
839 Ga0495657_0088487
840 Ga0495657_0227745
841 Ga0495599_0064303
842 Ga0495623_0075488
843 Ga0495646_0168007
844 Ga0495613_0317023
845 Ga0495600_0037813
846 Ga0495581_0002683
847 Ga0495581_0020363
848 Ga0495581_0086250
849 Ga0495604_0059748
850 Ga0495604_0074833
851 Ga0495636_0027125
852 Ga0495674_0000010
853 Ga0495674_0061276
854 Ga0495680_0031417
855 Ga0495675_0058871
856 Ga0495685_050541
857 Ga0495681_0092848
858 Ga0495602_0032497
859 Ga0495602_0034084
860 Ga0496100_0002534
861 Ga0496100_0082682
862 Ga0496100_0264148
863 Ga0496101_0067947
864 Ga0496101_0106070
865 Ga0496101_0234649
866 Ga0496102_0016228
867 Ga0496102_0078635
868 Ga0496102_0103738
869 Ga0496102_0622148
870 Ga0496103_0006871
871 Ga0496103_0074188
872 Ga0496103_0095568
873 Ga0496103_0162656
874 Ga0496103_0193503
875 Ga0496103_0212618
876 Ga0496104_0011647
877 Ga0496104_0081051
878 Ga0496104_0082565
879 Ga0496104_0100173
880 Ga0496104_0126230
881 Ga0496104_0352886
882 Ga0496104_0473952
883 Ga0496104_0616458
884 Ga0496105_0001910
885 Ga0496105_0010789
886 Ga0496105_0011313
887 Ga0496105_0012678
888 Ga0496106_0066818
889 Ga0496107_0066381
890 Ga0496107_0089133
891 Ga0496107_0099363
892 Ga0496107_0101513
893 Ga0496108_0060794
894 Ga0496108_0284587
895 Ga0496109_0065082
896 Ga0496109_0090027
897 Ga0496109_0142977
898 Ga0496109_0143866
899 Ga0496109_0172745
900 Ga0496109_0446707
901 Ga0496110_0000033
902 Ga0496110_0019534
903 Ga0496110_0034154
904 Ga0496110_0065488
905 Ga0496110_0094192
906 Ga0496110_0106804
907 Ga0496110_0150154
908 Ga0496110_0220100
909 Ga0496111_0000125
910 Ga0496111_0010066
911 Ga0496111_0037221
912 Ga0496111_0049676
913 Ga0496111_0052692
914 Ga0496111_0082037
915 Ga0496111_0109015
916 Ga0496111_0125473
917 Ga0496112_0008431
918 Ga0496112_0010109
919 Ga0496112_0028414
920 Ga0496112_0045827
921 Ga0496113_0037714
922 Ga0496113_0194175
923 Ga0496113_0415677
924 Ga0496114_0000014
925 Ga0496114_0015629
926 Ga0496114_0043091
927 Ga0496114_0095133
928 Ga0496114_0516034
929 Ga0496115_0000255
930 Ga0496116_0004412
931 Ga0496117_0013864
932 Ga0496118_0004985
933 Ga0496118_0033975
934 Ga0496118_0055942
935 Ga0496119_0001069
936 Ga0496119_0004707
937 Ga0496119_0027032
938 Ga0496120_0000954
939 Ga0496120_0012901
940 Ga0496121_0001544
941 Ga0496121_0011110
942 Ga0496124_0022784
943 Ga0496124_0318505
944 Ga0496125_0050035
945 Ga0496126_0004638
946 Ga0496126_0042775
947 Ga0501031_0010455
948 Ga0501032_0013510
949 Ga0501033_0001230
950 Ga0501034_0000488
951 Ga0501034_0007155
952 Ga0501036_0015200
953 Ga0501036_0033895
954 Ga0501037_0003173
955 Ga0501037_0060828
956 Ga0501038_0011896
957 Ga0501038_0019496
958 Ga0501038_0027134
959 Ga0501038_0251056
960 Ga0501039_0034021
961 Ga0501040_0029679
962 Ga0501042_0047764
963 Ga0501043_0003943
964 Ga0501043_0015464
965 Ga0501043_0271003
966 Ga0501046_0005091
967 Ga0501047_0003010
968 Ga0501047_0004573
969 Ga0501047_0157361
970 Ga0501047_0187966
971 Ga0501048_0013723
972 Ga0501067_0159944
973 Ga0501068_0016389
974 Ga0501069_0018808
975 Ga0501070_0001442
976 Ga0501070_0009904
977 Ga0501073_0004815
978 Ga0501074_0262451
979 Ga0501079_0022506
980 Ga0501080_0015178
981 Ga0501080_0027273
982 Ga0501083_0013347
983 Ga0501083_0015680
984 Ga0501035_0006942
985 Ga0501035_0038818
986 Ga0501044_0003363
987 Ga0501044_0007886
988 Ga0501044_0103282
989 Ga0501044_0149191
990 Ga0501044_0264730
991 Ga0501045_0135018
992 nmdc:mga00v17_111408_c1
993 nmdc:mga07m45_56218_c1
994 nmdc:mga09592_5164_c1
995 nmdc:mga08y16_10921_c1
996 nmdc:mga08x19_62034_c1
997 nmdc:mga0a205_86829_c1
998 Ga0495601_0089996
999 Ga0495655_0032815
1000 Ga0495595_0001728
1001 Ga0495619_0000022
1002 Ga0495619_0008692
1003 Ga0495619_0025018
1004 Ga0500641_0014422
1005 Ga0500556_0000644
1006 Ga0500568_0000032
1007 Ga0500590_051967
1008 Ga0500599_002653
1009 Ga0501082_0074467
1010 Ga0466962_0005187
1011 Ga0466962_0146809
1012 2537900890
1013 2555230342
1014 2566992160
1015 2644094552
1016 2644102111
1017 2644115334
1018 2644607547
1019 2655033937
1020 2738870294
1021 2738888348
1022 2753035989
1023 2753325986
1024 2808894272
1025 2812373694
1026 2819426307
1027 2819665342
1028 2819691446
1029 2819727517
1030 2884764023
1031 2904538018
1032 2904778125
1033 2910814818
1034 2919060178
1035 2919395304
1036 2922557201
1037 2939650308
1038 2945923835
1039 2945944506
1040 2945957304
1041 2946040421
1042 2954001686
1043 2974316489
1044 8054109746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

67

343

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h8j-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9393 23 318
5h8l-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine 0.9335 24 318
5h8i-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine 0.9293 24 321
5h8j-assembly2.cif.gz_I crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9288 23 318
5h8l-assembly2.cif.gz_I crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine 0.926 23 320
ID Description Score Start End Superfamily
5h8jC00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9213 22 321 3.60.110.10
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9168 27 320 3.60.110.10
af_O59829_1_271_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9125 29 318 3.60.110.10
1j31B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9018 29 313 3.60.110.10
5h8jC00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9009 22 321 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A0A6UK21-F1-model_v4 Hydrolase 0.9804 3 316 GO:0033388
GO:0050126
AF-A0A0A6UK21-F1-model_v4 Hydrolase 0.974 3 316 GO:0033388
GO:0050126
AF-A0A127A5F8-F1-model_v4 Hydrolase 0.9729 3 319 GO:0033388
GO:0050126
AF-A0A352B1E9-F1-model_v4 Hydrolase 0.9717 36 318 GO:0033388
GO:0050126
AF-A0A4Z1CGV4-F1-model_v4 Hydrolase 0.9657 3 324 GO:0033388
GO:0050126

Map