F458863

General Info

Members Datasets Scaffolds Average Seq Length
522 352 1044 145

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10007535|Ga0307513_1000753510
Length 169
Sequence MTAHSALRFAASWNGNVTGMPGAGEPSDDLGRFVSAQAGTYEQALAELIAGRKRTHWMWFVFPQIAGLGSSPTAQRYAIASLAEARAYLAHPVLGPRLQKSARALLEVQGKTADEILGYPDNLKLRSSMTLFARAADDPELFEAVLDRYYAGPDPHTLELIEPEPSQPA

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
206 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
207 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
208 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
209 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
224 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
228 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
237 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
252 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
279 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
282 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
283 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
312 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
313 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
314 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
315 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
316 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
317 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
318 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
319 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
320 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
321 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
322 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
323 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
324 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
325 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
326 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
327 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
328 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
329 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
330 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
331 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
332 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
340 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
341 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
342 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
343 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
344 2643221599 Rhizobium sp. Root708 Isolate Unclassified
345 2643221640 Caulobacter sp. Root342 Isolate Unclassified
346 2643221642 Caulobacter sp. Root343 Isolate Unclassified
347 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
348 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
349 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
350 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
351 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
352 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.79
Metatranscriptomes 1.92
Isolates 2.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.67
Nodule 0
Rhizoplane 5.56
Rhizosphere 70.5
Stem 0
Stem Tuber 0
Unclassified 7.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10007535 3300031456 Bacteria 14081
2 JGI25152J39213_1001727 3300002773 Bacteria 8948
3 JGI25150J39212_1005190 3300002774 Bacteria 2807
4 JGI25159J45721_1000637 3300002987 Bacteria 15563
5 JGI25151J46595_10030235 3300003187 Bacteria 2133
6 JGI25153J46596_10001346 3300003215 Bacteria 14704
7 JGI25160J50197_1002213 3300003354 Bacteria 9127
8 JGI25161J50226_1000096 3300003374 Bacteria 72203
9 Ga0055529_1010581 3300003763 Bacteria 1198
10 Ga0055526_1003664 3300003771 Bacteria 9612
11 Ga0055526_1022512 3300003771 Bacteria 2139
12 Ga0055524_1004229 3300003775 Bacteria 6679
13 Ga0055524_1015810 3300003775 Bacteria 2734
14 Ga0055524_1063175 3300003775 Bacteria 754
15 Ga0055528_1002007 3300003790 Bacteria 11416
16 Ga0055528_1009823 3300003790 Bacteria 3960
17 Ga0055540_1003592 3300003792 Bacteria 7406
18 Ga0055540_1011706 3300003792 Bacteria 2806
19 Ga0055540_1012695 3300003792 Bacteria 2625
20 Ga0055531_10039552 3300003794 Bacteria 1398
21 Ga0055543_1000183 3300004625 Bacteria 51527
22 Ga0058860_12232957 3300004801 Bacteria 982
23 Ga0065165_1008666 3300005262 Bacteria 4710
24 Ga0065715_10706989 3300005293 Unclassified 650
25 Ga0070658_10000435 3300005327 Bacteria 36388
26 Ga0070658_10229610 3300005327 Bacteria 1571
27 Ga0070683_100383606 3300005329 Bacteria 1339
28 Ga0068869_100002593 3300005334 Bacteria 10918
29 Ga0070666_10060652 3300005335 Unclassified 2560
30 Ga0070680_100014662 3300005336 Bacteria 6128
31 Ga0070680_100103900 3300005336 Bacteria 2361
32 Ga0070682_100006765 3300005337 Bacteria 6430
33 Ga0070682_100189754 3300005337 Bacteria 1442
34 Ga0068868_100127822 3300005338 Bacteria 2077
35 Ga0070689_101898954 3300005340 Unclassified 544
36 Ga0070691_10057191 3300005341 Bacteria 1871
37 Ga0070661_100074357 3300005344 Bacteria 2502
38 Ga0070661_100539948 3300005344 Bacteria 937
39 Ga0070692_10008921 3300005345 Bacteria 4495
40 Ga0070668_100278615 3300005347 Bacteria 1396
41 Ga0070668_100598371 3300005347 Bacteria 964
42 Ga0070668_101079541 3300005347 Unclassified 724
43 Ga0070669_100291043 3300005353 Bacteria 1311
44 Ga0070675_100341340 3300005354 Bacteria 1327
45 Ga0070671_100150747 3300005355 Bacteria 1963
46 Ga0070671_100524981 3300005355 Unclassified 1020
47 Ga0070673_101399889 3300005364 Bacteria 658
48 Ga0070688_100048560 3300005365 Bacteria 2638
49 Ga0070659_100322982 3300005366 Bacteria 1290
50 Ga0070659_101287284 3300005366 Bacteria 648
51 Ga0070667_100086343 3300005367 Bacteria 2692
52 Ga0070713_100879310 3300005436 Unclassified 861
53 Ga0070701_10254015 3300005438 Bacteria 1063
54 Ga0070700_100204448 3300005441 Bacteria 1389
55 Ga0070700_101480224 3300005441 Bacteria 576
56 Ga0070708_100001125 3300005445 Bacteria 20476
57 Ga0070663_100007513 3300005455 Bacteria 6637
58 Ga0070663_101507556 3300005455 Bacteria 598
59 Ga0070678_100012969 3300005456 Bacteria 5204
60 Ga0070662_100195129 3300005457 Bacteria 1603
61 Ga0070681_10060667 3300005458 Bacteria 3758
62 Ga0070685_10588197 3300005466 Bacteria 799
63 Ga0070707_100278169 3300005468 Unclassified 1627
64 Ga0070684_100552101 3300005535 Bacteria 1069
65 Ga0068853_100015274 3300005539 Bacteria 6310
66 Ga0068853_100768007 3300005539 Unclassified 922
67 Ga0070672_101765529 3300005543 Bacteria 556
68 Ga0070686_100209596 3300005544 Unclassified 1402
69 Ga0070696_100571384 3300005546 Unclassified 908
70 Ga0070693_100003660 3300005547 Bacteria 7184
71 Ga0070665_100068701 3300005548 Bacteria 3552
72 Ga0070665_100083099 3300005548 Bacteria 3207
73 Ga0070665_100262808 3300005548 Bacteria 1727
74 Ga0068855_100003688 3300005563 Bacteria 18736
75 Ga0068855_100149617 3300005563 Unclassified 2655
76 Ga0068855_100358233 3300005563 Bacteria 1605
77 Ga0070664_100846647 3300005564 Bacteria 856
78 Ga0070702_100088176 3300005615 Bacteria 1875
79 Ga0068852_100083561 3300005616 Bacteria 2839
80 Ga0068861_100171710 3300005719 Bacteria 1798
81 Ga0068861_100287980 3300005719 Bacteria 1417
82 Ga0068851_10206857 3300005834 Bacteria 1098
83 Ga0068870_10000800 3300005840 Bacteria 12174
84 Ga0068870_11111525 3300005840 Bacteria 569
85 Ga0068863_100018824 3300005841 Bacteria 6607
86 Ga0068860_100000283 3300005843 Bacteria 72326
87 Ga0068860_100268486 3300005843 Bacteria 1664
88 Ga0068860_101043537 3300005843 Bacteria 836
89 Ga0070717_10000421 3300006028 Bacteria 27110
90 Ga0075365_10032088 3300006038 Bacteria 3374
91 Ga0075363_100001728 3300006048 Bacteria 8488
92 Ga0075364_10139350 3300006051 Bacteria 1631
93 Ga0075364_10402027 3300006051 Unclassified 935
94 Ga0075367_10002408 3300006178 Bacteria 8541
95 Ga0075369_10012197 3300006186 Bacteria 3394
96 Ga0097621_100185408 3300006237 Bacteria 1800
97 Ga0068871_100233549 3300006358 Bacteria 1597
98 Ga0075428_100427839 3300006844 Bacteria 1418
99 Ga0075433_10210773 3300006852 Bacteria 1726
100 Ga0075434_100004337 3300006871 Bacteria 12757
101 Ga0075436_100014375 3300006914 Bacteria 5419
102 Ga0075435_100033932 3300007076 Bacteria 4039
103 Ga0105251_10072015 3300009011 Bacteria 1607
104 Ga0105244_10046633 3300009036 Unclassified 2225
105 Ga0105244_10076330 3300009036 Bacteria 1664
106 Ga0105240_10273182 3300009093 Bacteria 1945
107 Ga0105240_10287861 3300009093 Bacteria 1885
108 Ga0105245_10125981 3300009098 Bacteria 2398
109 Ga0105245_10177858 3300009098 Bacteria 2031
110 Ga0105247_11454525 3300009101 Bacteria 557
111 Ga0114129_10181195 3300009147 Bacteria 2866
112 Ga0105243_10814363 3300009148 Bacteria 922
113 Ga0105241_10034729 3300009174 Bacteria 3790
114 Ga0105241_10130276 3300009174 Bacteria 2036
115 Ga0105248_10110081 3300009177 Bacteria 3106
116 Ga0105248_11965608 3300009177 Unclassified 664
117 Ga0105237_10003936 3300009545 Bacteria 17390
118 Ga0105237_10167416 3300009545 Bacteria 2197
119 Ga0105237_10217043 3300009545 Bacteria 1913
120 Ga0105237_10621954 3300009545 Bacteria 1087
121 Ga0105237_10967049 3300009545 Bacteria 858
122 Ga0105238_10055152 3300009551 Bacteria 3990
123 Ga0105238_10077523 3300009551 Bacteria 3314
124 Ga0105238_10155995 3300009551 Bacteria 2258
125 Ga0105249_10678852 3300009553 Bacteria 1089
126 Ga0105239_10008855 3300010375 Bacteria 11392
127 Ga0105239_10082611 3300010375 Bacteria 3538
128 Ga0105239_11180808 3300010375 Unclassified 882
129 Ga0105246_10002319 3300011119 Bacteria 11497
130 Ga0105246_10255446 3300011119 Bacteria 1393
131 Ga0105246_10879122 3300011119 Bacteria 802
132 Ga0157373_10019532 3300013100 Bacteria 4929
133 Ga0157371_10031231 3300013102 Bacteria 3838
134 Ga0157371_10767601 3300013102 Bacteria 725
135 Ga0157370_10070292 3300013104 Bacteria 3304
136 Ga0157369_10046088 3300013105 Bacteria 4739
137 Ga0157369_10235923 3300013105 Unclassified 1911
138 Ga0157369_10328473 3300013105 Bacteria 1589
139 Ga0171462_1024 3300013250 Bacteria 129278
140 Ga0157374_10037393 3300013296 Bacteria 4455
141 Ga0157374_10043903 3300013296 Bacteria 4130
142 Ga0157374_10079836 3300013296 Bacteria 3101
143 Ga0157374_10419394 3300013296 Bacteria 1337
144 Ga0157374_10705877 3300013296 Unclassified 1022
145 Ga0157378_10016333 3300013297 Bacteria 6500
146 Ga0157378_10022419 3300013297 Bacteria 5559
147 Ga0157378_10065709 3300013297 Bacteria 3247
148 Ga0157378_11258746 3300013297 Unclassified 780
149 Ga0163162_10094363 3300013306 Bacteria 3078
150 Ga0163162_10256182 3300013306 Bacteria 1882
151 Ga0163162_10260935 3300013306 Bacteria 1864
152 Ga0163162_10481893 3300013306 Bacteria 1372
153 Ga0157372_10279310 3300013307 Bacteria 1941
154 Ga0157372_10912352 3300013307 Bacteria 1019
155 Ga0157375_10039749 3300013308 Bacteria 4529
156 Ga0163163_10642598 3300014325 Bacteria 1124
157 Ga0182008_10665800 3300014497 Bacteria 591
158 Ga0157379_10746294 3300014968 Bacteria 921
159 Ga0157379_11410205 3300014968 Bacteria 675
160 Ga0157376_10071030 3300014969 Bacteria 2957
161 Ga0206350_11326130 3300020080 Bacteria 1588
162 Ga0224712_10018175 3300022467 Bacteria 2345
163 Ga0209436_100004 3300025208 Bacteria 196698
164 Ga0207425_1001914 3300025245 Bacteria 7883
165 Ga0207425_1013832 3300025245 Bacteria 1850
166 Ga0209129_1000840 3300025258 Bacteria 19268
167 Ga0209129_1001930 3300025258 Bacteria 10867
168 Ga0209129_1008740 3300025258 Bacteria 2771
169 Ga0209129_1008747 3300025258 Bacteria 2768
170 Ga0209565_1034876 3300025263 Unclassified 962
171 Ga0209455_1005913 3300025272 Bacteria 3691
172 Ga0209673_1003625 3300025273 Bacteria 8930
173 Ga0209673_1011249 3300025273 Bacteria 3702
174 Ga0209673_1050502 3300025273 Bacteria 1104
175 Ga0209673_1084959 3300025273 Bacteria 715
176 Ga0209130_1000001 3300025284 Bacteria 831557
177 Ga0209130_1020841 3300025284 Bacteria 1491
178 Ga0209025_1004371 3300025294 Bacteria 12317
179 Ga0209025_1010758 3300025294 Bacteria 6150
180 Ga0209564_1001805 3300025295 Bacteria 19744
181 Ga0209564_1025940 3300025295 Bacteria 1953
182 Ga0209758_1004604 3300025297 Bacteria 11332
183 Ga0209758_1013346 3300025297 Bacteria 4487
184 Ga0209758_1016838 3300025297 Bacteria 3685
185 Ga0209758_1042159 3300025297 Bacteria 1695
186 Ga0209256_1001343 3300025299 Bacteria 26083
187 Ga0209256_1024612 3300025299 Bacteria 1769
188 Ga0209256_1027559 3300025299 Bacteria 1617
189 Ga0209256_1037077 3300025299 Bacteria 1273
190 Ga0207426_1000005 3300025302 Bacteria 1037188
191 Ga0207426_1001019 3300025302 Bacteria 27036
192 Ga0209051_1003667 3300025303 Bacteria 9937
193 Ga0209051_1026350 3300025303 Bacteria 2344
194 Ga0209257_1021586 3300025304 Bacteria 2333
195 Ga0207656_10051263 3300025321 Bacteria 1784
196 Ga0207713_1069837 3300025735 Bacteria 1300
197 Ga0207688_10044831 3300025901 Bacteria 2465
198 Ga0207680_10794726 3300025903 Bacteria 678
199 Ga0207643_10000104 3300025908 Bacteria 57260
200 Ga0207705_10000043 3300025909 Bacteria 181491
201 Ga0207705_10003883 3300025909 Bacteria 11370
202 Ga0207705_10234663 3300025909 Bacteria 1396
203 Ga0207705_10364966 3300025909 Bacteria 1114
204 Ga0207684_11423500 3300025910 Unclassified 567
205 Ga0207654_10422856 3300025911 Bacteria 930
206 Ga0207654_11253112 3300025911 Bacteria 541
207 Ga0207707_10028326 3300025912 Bacteria 4896
208 Ga0207707_10809337 3300025912 Bacteria 780
209 Ga0207695_10001067 3300025913 Bacteria 47991
210 Ga0207671_10045799 3300025914 Bacteria 3235
211 Ga0207671_10094647 3300025914 Bacteria 2255
212 Ga0207671_10429282 3300025914 Bacteria 1051
213 Ga0207671_10619206 3300025914 Bacteria 862
214 Ga0207660_10029642 3300025917 Bacteria 3756
215 Ga0207660_10128830 3300025917 Bacteria 1924
216 Ga0207657_10103348 3300025919 Bacteria 2362
217 Ga0207649_10077383 3300025920 Bacteria 2143
218 Ga0207652_10012274 3300025921 Bacteria 6919
219 Ga0207652_10918364 3300025921 Bacteria 773
220 Ga0207646_10307663 3300025922 Unclassified 1432
221 Ga0207681_10324696 3300025923 Bacteria 1225
222 Ga0207694_10242773 3300025924 Bacteria 1472
223 Ga0207694_10467194 3300025924 Bacteria 1054
224 Ga0207650_10001714 3300025925 Bacteria 15564
225 Ga0207687_10014822 3300025927 Bacteria 5105
226 Ga0207700_10132353 3300025928 Bacteria 2038
227 Ga0207644_10016855 3300025931 Bacteria 4922
228 Ga0207644_10051654 3300025931 Bacteria 2952
229 Ga0207644_10497468 3300025931 Unclassified 1005
230 Ga0207690_10162247 3300025932 Bacteria 1667
231 Ga0207706_10022097 3300025933 Bacteria 5709
232 Ga0207670_10949742 3300025936 Bacteria 722
233 Ga0207704_10500115 3300025938 Bacteria 980
234 Ga0207691_11480273 3300025940 Bacteria 556
235 Ga0207711_10110847 3300025941 Bacteria 2441
236 Ga0207689_10039869 3300025942 Bacteria 3888
237 Ga0207661_10081069 3300025944 Bacteria 2679
238 Ga0207661_10342711 3300025944 Bacteria 1347
239 Ga0207661_10424789 3300025944 Bacteria 1207
240 Ga0207679_10697102 3300025945 Bacteria 921
241 Ga0207679_10777666 3300025945 Bacteria 872
242 Ga0207667_10005643 3300025949 Bacteria 15264
243 Ga0207667_10364987 3300025949 Unclassified 1472
244 Ga0207667_11554754 3300025949 Bacteria 631
245 Ga0207668_10593169 3300025972 Bacteria 964
246 Ga0207668_10656242 3300025972 Bacteria 919
247 Ga0207640_10567135 3300025981 Bacteria 956
248 Ga0207658_10797464 3300025986 Bacteria 857
249 Ga0207677_10004345 3300026023 Bacteria 7593
250 Ga0207677_12212828 3300026023 Bacteria 512
251 Ga0207703_10038377 3300026035 Bacteria 3822
252 Ga0207639_10008882 3300026041 Bacteria 6912
253 Ga0207639_10928089 3300026041 Bacteria 814
254 Ga0207678_10006037 3300026067 Bacteria 10773
255 Ga0207678_10009692 3300026067 Bacteria 8474
256 Ga0207708_10288936 3300026075 Bacteria 1331
257 Ga0207702_10006230 3300026078 Bacteria 10312
258 Ga0207702_11462002 3300026078 Unclassified 677
259 Ga0207641_10609556 3300026088 Bacteria 1069
260 Ga0207676_10002083 3300026095 Bacteria 14516
261 Ga0207676_12009115 3300026095 Unclassified 577
262 Ga0207674_10142191 3300026116 Bacteria 2359
263 Ga0207675_100073258 3300026118 Bacteria 3204
264 Ga0207675_101847767 3300026118 Unclassified 623
265 Ga0207683_10006291 3300026121 Bacteria 10175
266 Ga0207698_10015538 3300026142 Bacteria 5100
267 Ga0209967_1005070 3300027364 Bacteria 1764
268 Ga0209981_1033721 3300027378 Unclassified 755
269 Ga0209968_1000971 3300027526 Bacteria 4415
270 Ga0209999_1006920 3300027543 Bacteria 2040
271 Ga0209982_1007817 3300027552 Bacteria 1562
272 Ga0209970_1033870 3300027614 Bacteria 894
273 Ga0209813_10107123 3300027866 Bacteria 958
274 Ga0209974_10003640 3300027876 Bacteria 5532
275 Ga0207428_10031430 3300027907 Bacteria 4378
276 Ga0268266_10051056 3300028379 Bacteria 3549
277 Ga0268264_10000325 3300028381 Bacteria 75416
278 Ga0268264_10033959 3300028381 Bacteria 4194
279 Ga0268264_11876916 3300028381 Bacteria 609
280 Ga0307515_10012725 3300028794 Bacteria 15797
281 Ga0307512_10009402 3300030522 Bacteria 9420
282 Ga0265327_10001761 3300031251 Bacteria 25608
283 Ga0307513_10010961 3300031456 Bacteria 11314
284 Ga0307508_10030913 3300031616 Bacteria 4840
285 Ga0307508_10146922 3300031616 Bacteria 1962
286 Ga0316579_10416050 3300031691 Unclassified 650
287 Ga0307516_10139801 3300031730 Bacteria 2192
288 Ga0307516_10192591 3300031730 Bacteria 1764
289 Ga0307413_10258221 3300031824 Bacteria 1297
290 Ga0307413_11004139 3300031824 Bacteria 715
291 Ga0307406_10089012 3300031901 Bacteria 2073
292 Ga0307406_10862097 3300031901 Bacteria 768
293 Ga0307409_101741217 3300031995 Bacteria 652
294 Ga0307414_10008417 3300032004 Bacteria 5849
295 Ga0307415_101302795 3300032126 Bacteria 688
296 Ga0316585_10066389 3300032137 Bacteria 1169
297 Ga0307510_10342875 3300033180 Bacteria 946
298 Ga0373934_0005973 3300035086 Unclassified 4508
299 Ga0373951_0000153 3300035091 Bacteria 25032
300 Ga0373945_0181507 3300035116 Unclassified 866
301 Ga0373943_0144720 3300035170 Unclassified 1283
302 Ga0373955_0074324 3300035172 Bacteria 1907
303 Ga0373935_0009175 3300035692 Bacteria 5920
304 Ga0373927_0013905 3300035695 Bacteria 5339
305 Ga0373933_0082629 3300035724 Bacteria 1972
306 Ga0373947_0010317 3300035725 Bacteria 5361
307 Ga0373947_0153884 3300035725 Bacteria 1483
308 Ga0373925_0009600 3300037068 Bacteria 7050
309 Ga0436364_0060001 3300037853 Unclassified 652
310 Ga0436364_1191411 3300037853 Bacteria 1442
311 Ga0400483_185629 3300039062 Unclassified 1811
312 Ga0436365_0575486 3300039437 Bacteria 1107
313 Ga0436365_1196253 3300039437 Bacteria 36843
314 Ga0439436_0028975 3300041404 Unclassified 1614
315 Ga0439465_0025732 3300041413 Bacteria 1858
316 Ga0439465_0029133 3300041413 Bacteria 1753
317 Ga0451802_1473818 3300041460 Bacteria 566
318 Ga0451839_0282287 3300041496 Bacteria 1122
319 Ga0453683_0223152 3300044673 Unclassified 1199
320 Ga0453684_0023393 3300044712 Bacteria 9107
321 Ga0453684_0045402 3300044712 Bacteria 5862
322 Ga0453684_0072933 3300044712 Bacteria 4331
323 Ga0453684_0251957 3300044712 Bacteria 2027
324 Ga0453684_0429596 3300044712 Bacteria 1474
325 Ga0453684_0693572 3300044712 Bacteria 1107
326 Ga0453684_1101381 3300044712 Bacteria 839
327 Ga0466971_0054165 3300044719 Bacteria 1808
328 Ga0466968_0174613 3300044735 Bacteria 997
329 Ga0466959_0502277 3300045049 Bacteria 820
330 Ga0451576_0193902 3300045051 Bacteria 2122
331 Ga0451576_0643839 3300045051 Bacteria 1114
332 Ga0495590_0061398 3300046457 Bacteria 1316
333 Ga0495638_0378270 3300046460 Bacteria 740
334 Ga0495651_0052297 3300046462 Bacteria 3146
335 Ga0495651_0244342 3300046462 Bacteria 1229
336 Ga0495653_0482397 3300046463 Bacteria 775
337 Ga0495650_0066311 3300046471 Bacteria 1429
338 Ga0495580_0000355 3300046472 Bacteria 37382
339 Ga0495605_0000152 3300046474 Bacteria 89123
340 Ga0495639_0093662 3300046475 Bacteria 1412
341 Ga0495596_0015513 3300046500 Bacteria 3188
342 Ga0495607_0000033 3300046501 Bacteria 149382
343 Ga0495607_0001801 3300046501 Bacteria 18308
344 Ga0495583_0003556 3300046506 Bacteria 11738
345 Ga0495583_0007868 3300046506 Bacteria 6617
346 Ga0495606_0040774 3300046507 Bacteria 3119
347 Ga0495606_0361799 3300046507 Bacteria 767
348 Ga0495610_0014757 3300046512 Bacteria 4574
349 Ga0495616_0007091 3300046513 Bacteria 6730
350 Ga0495628_0087491 3300046516 Bacteria 2415
351 Ga0495630_0014859 3300046517 Bacteria 5678
352 Ga0495630_0608405 3300046517 Unclassified 838
353 Ga0495643_0014880 3300046522 Bacteria 4616
354 Ga0495643_0097150 3300046522 Bacteria 1514
355 Ga0495648_0072324 3300046524 Bacteria 1996
356 Ga0495666_0182258 3300046526 Bacteria 969
357 Ga0495652_0043695 3300046529 Bacteria 3859
358 Ga0495652_0117706 3300046529 Bacteria 2125
359 Ga0495586_0011568 3300046535 Bacteria 4695
360 Ga0495586_0723442 3300046535 Bacteria 575
361 Ga0495609_0000202 3300046538 Bacteria 59327
362 Ga0495609_0008846 3300046538 Bacteria 4901
363 Ga0495609_0311724 3300046538 Bacteria 639
364 Ga0495597_0167021 3300046542 Bacteria 895
365 Ga0495645_0002000 3300046543 Bacteria 13872
366 Ga0495656_0132705 3300046615 Bacteria 1187
367 Ga0495625_0037223 3300046660 Bacteria 3571
368 Ga0495659_0091414 3300046664 Bacteria 1169
369 Ga0495657_0268627 3300046675 Bacteria 1023
370 Ga0495599_0082328 3300046678 Bacteria 2010
371 Ga0495599_0345108 3300046678 Unclassified 893
372 Ga0495623_0132382 3300046679 Bacteria 1492
373 Ga0495623_0133432 3300046679 Bacteria 1484
374 Ga0495646_0237835 3300046680 Bacteria 979
375 Ga0495669_0000174 3300046684 Bacteria 40779
376 Ga0495624_0000059 3300046690 Bacteria 70115
377 Ga0495660_0029100 3300046810 Bacteria 3119
378 Ga0495581_0163902 3300047315 Bacteria 1300
379 Ga0495674_0033163 3300047319 Bacteria 4680
380 Ga0495672_0494299 3300047320 Bacteria 545
381 Ga0495676_0173440 3300047321 Bacteria 1516
382 Ga0495680_0017926 3300047322 Bacteria 6024
383 Ga0495675_0024021 3300047444 Bacteria 3884
384 Ga0495675_0032894 3300047444 Bacteria 3308
385 Ga0495679_007519 3300047446 Bacteria 4530
386 Ga0495684_0072142 3300047471 Bacteria 2624
387 Ga0495686_0428057 3300047472 Bacteria 706
388 Ga0495602_0688970 3300048088 Bacteria 694
389 Ga0495626_0024969 3300048091 Bacteria 2925
390 Ga0496100_0979801 3300048903 Bacteria 665
391 Ga0496102_0115605 3300048905 Bacteria 2503
392 Ga0496103_0327027 3300048906 Bacteria 986
393 Ga0496104_0233196 3300048907 Bacteria 1752
394 Ga0496104_0793694 3300048907 Bacteria 853
395 Ga0496104_1180370 3300048907 Bacteria 669
396 Ga0496105_0081976 3300048908 Bacteria 2664
397 Ga0496105_0228043 3300048908 Bacteria 1514
398 Ga0496106_0000980 3300048909 Bacteria 20817
399 Ga0496106_0092384 3300048909 Bacteria 2337
400 Ga0496107_0284938 3300048910 Bacteria 1230
401 Ga0496107_0602857 3300048910 Bacteria 812
402 Ga0496108_0004913 3300048911 Bacteria 10798
403 Ga0496108_0010711 3300048911 Bacteria 7440
404 Ga0496108_0913957 3300048911 Bacteria 753
405 Ga0496109_0022495 3300048912 Bacteria 5585
406 Ga0496110_0015184 3300048913 Bacteria 6406
407 Ga0496111_0005157 3300048914 Bacteria 8329
408 Ga0496112_0022187 3300048915 Bacteria 6050
409 Ga0496112_0075914 3300048915 Bacteria 3324
410 Ga0496112_0308497 3300048915 Bacteria 1527
411 Ga0496112_0319541 3300048915 Bacteria 1497
412 Ga0496112_0819071 3300048915 Bacteria 855
413 Ga0496113_0568902 3300048916 Bacteria 908
414 Ga0496114_0103431 3300048917 Bacteria 2434
415 Ga0496114_1428722 3300048917 Bacteria 579
416 Ga0496115_0568035 3300048918 Bacteria 905
417 Ga0496115_0795480 3300048918 Bacteria 736
418 Ga0496117_0050979 3300048920 Bacteria 2930
419 Ga0496117_0316216 3300048920 Bacteria 820
420 Ga0496118_0002028 3300048921 Bacteria 28637
421 Ga0496118_0046809 3300048921 Bacteria 3360
422 Ga0496118_0064731 3300048921 Bacteria 2681
423 Ga0496121_0006442 3300048924 Bacteria 14570
424 Ga0496121_0432560 3300048924 Bacteria 853
425 Ga0496122_0011018 3300048925 Bacteria 9238
426 Ga0496123_0013349 3300048926 Bacteria 6906
427 Ga0496123_0344402 3300048926 Bacteria 695
428 Ga0496124_0000149 3300048927 Bacteria 143351
429 Ga0496124_0117885 3300048927 Bacteria 2126
430 Ga0496124_0369346 3300048927 Bacteria 1008
431 Ga0496125_0150160 3300048928 Bacteria 1602
432 Ga0496125_0330607 3300048928 Bacteria 919
433 Ga0496126_0001268 3300048929 Bacteria 40643
434 Ga0495678_223656 3300049459 Bacteria 570
435 Ga0501032_0037930 3300049569 Bacteria 3284
436 Ga0501032_0048376 3300049569 Bacteria 2871
437 Ga0501033_0005242 3300049570 Bacteria 10291
438 Ga0501034_0015666 3300049571 Bacteria 7784
439 Ga0501034_0218384 3300049571 Bacteria 1859
440 Ga0501036_0391762 3300049572 Bacteria 1159
441 Ga0501036_1031865 3300049572 Bacteria 673
442 Ga0501037_0029170 3300049573 Bacteria 4076
443 Ga0501037_0034942 3300049573 Bacteria 3708
444 Ga0501039_0945684 3300049575 Bacteria 670
445 Ga0501043_0058366 3300049579 Bacteria 3029
446 Ga0501043_0067132 3300049579 Bacteria 2817
447 Ga0501046_0003415 3300049580 Bacteria 14586
448 Ga0501046_0042966 3300049580 Bacteria 3601
449 Ga0501047_0042275 3300049581 Bacteria 4404
450 Ga0501047_0101167 3300049581 Bacteria 2762
451 Ga0501048_0044821 3300049582 Bacteria 3160
452 Ga0501048_0065002 3300049582 Bacteria 2580
453 Ga0501067_0182804 3300049583 Bacteria 1168
454 Ga0501069_0119755 3300049585 Bacteria 1503
455 Ga0501070_0060889 3300049586 Bacteria 3128
456 Ga0501073_0069486 3300049589 Bacteria 2454
457 Ga0501080_0785605 3300049742 Bacteria 836
458 Ga0501080_1342439 3300049742 Bacteria 611
459 Ga0501083_0020958 3300049744 Bacteria 4543
460 Ga0501035_0002184 3300049822 Bacteria 19411
461 Ga0501035_0668927 3300049822 Bacteria 840
462 Ga0501044_0002158 3300049823 Bacteria 22557
463 Ga0501044_0436212 3300049823 Bacteria 1218
464 Ga0501044_0482098 3300049823 Bacteria 1143
465 nmdc:mga03n38_29978_c1 3300050490 Bacteria 2283
466 nmdc:mga00v17_68277_c1 3300050491 Bacteria 2197
467 nmdc:mga07m45_133373_c1 3300050496 Bacteria 1437
468 nmdc:mga05p37_108235_c1 3300050507 Bacteria 3419
469 nmdc:mga06r32_796345_c1 3300050510 Bacteria 906
470 nmdc:mga0n895_1069329_c1 3300050512 Bacteria 785
471 nmdc:mga0n895_5226_c1 3300050512 Bacteria 10816
472 nmdc:mga0rr50_675170_c1 3300050513 Bacteria 882
473 nmdc:mga08x19_138799_c1 3300050514 Bacteria 1641
474 nmdc:mga0a205_10333_c1 3300050515 Bacteria 8579
475 nmdc:mga0sz30_17094_c2 3300050516 Bacteria 2141
476 Ga0495655_0041181 3300053083 Bacteria 1180
477 Ga0495655_0043394 3300053083 Bacteria 1159
478 Ga0495595_0032114 3300053084 Bacteria 2363
479 Ga0500646_0044268 3300053090 Bacteria 1263
480 Ga0500651_0153544 3300053093 Bacteria 1381
481 Ga0500651_0350961 3300053093 Bacteria 837
482 Ga0500650_0067495 3300053098 Bacteria 1671
483 Ga0500556_0214054 3300053104 Bacteria 760
484 Ga0500562_062258 3300053108 Bacteria 1003
485 Ga0500569_051398 3300053109 Bacteria 1245
486 Ga0500594_0056577 3300053118 Bacteria 1119
487 Ga0500652_170704 3300053131 Bacteria 895
488 Ga0500559_0217380 3300053136 Bacteria 901
489 Ga0500568_0001209 3300053139 Bacteria 17208
490 Ga0500568_0001408 3300053139 Bacteria 15617
491 Ga0500568_0053792 3300053139 Bacteria 1577
492 Ga0500588_0205684 3300053146 Bacteria 730
493 Ga0500600_0083317 3300053149 Bacteria 1724
494 Ga0500604_0000013 3300053151 Bacteria 92467
495 Ga0500604_0011777 3300053151 Bacteria 2355
496 Ga0500622_0000099 3300053156 Bacteria 86951
497 Ga0500622_0101451 3300053156 Bacteria 1416
498 Ga0500627_0071460 3300053158 Bacteria 1537
499 Ga0500633_0000136 3300053160 Bacteria 9700
500 Ga0500611_120698 3300053727 Bacteria 698
501 Ga0500645_002121 3300053730 Bacteria 9148
502 Ga0587073_0041221 3300059492 Unclassified 1007
503 Ga0587080_042232 3300059503 Unclassified 834
504 Ga0587088_002955 3300059508 Bacteria 2006
505 Ga0587091_033165 3300059511 Bacteria 980
506 Ga0587106_011010 3300059605 Unclassified 1184
507 Ga0587069_008188 3300059642 Bacteria 1314
508 Ga0587076_003991 3300059645 Bacteria 1809
509 Ga0501082_0234379 3300060353 Bacteria 1597
510 Ga0466962_0028351 3300061719 Bacteria 2683
511 2511199820 2510917030 Bacteria 7460662
512 2585221552 2582581298 Bacteria 7315509
513 2585544278 2585427529 Bacteria 7395659
514 2644003460 2643221599 Bacteria 6292121
515 2644226991 2643221640 Bacteria 5258820
516 2644233541 2643221642 Bacteria 5357871
517 2902410727 2902405164 Bacteria 6784948
518 2904447522 2904445276 Bacteria 5310396
519 2919103527 2919100787 Bacteria 7710546
520 2923559673 2923556063 Bacteria 6793593
521 2928533350 2928531327 Bacteria 5101314
522 3005451354 3005445848 Bacteria 6906074
523 Ga0307513_10007535
524 JGI25152J39213_1001727
525 JGI25150J39212_1005190
526 JGI25159J45721_1000637
527 JGI25151J46595_10030235
528 JGI25153J46596_10001346
529 JGI25160J50197_1002213
530 JGI25161J50226_1000096
531 Ga0055529_1010581
532 Ga0055526_1003664
533 Ga0055526_1022512
534 Ga0055524_1004229
535 Ga0055524_1015810
536 Ga0055524_1063175
537 Ga0055528_1002007
538 Ga0055528_1009823
539 Ga0055540_1003592
540 Ga0055540_1011706
541 Ga0055540_1012695
542 Ga0055531_10039552
543 Ga0055543_1000183
544 Ga0058860_12232957
545 Ga0065165_1008666
546 Ga0065715_10706989
547 Ga0070658_10000435
548 Ga0070658_10229610
549 Ga0070683_100383606
550 Ga0068869_100002593
551 Ga0070666_10060652
552 Ga0070680_100014662
553 Ga0070680_100103900
554 Ga0070682_100006765
555 Ga0070682_100189754
556 Ga0068868_100127822
557 Ga0070689_101898954
558 Ga0070691_10057191
559 Ga0070661_100074357
560 Ga0070661_100539948
561 Ga0070692_10008921
562 Ga0070668_100278615
563 Ga0070668_100598371
564 Ga0070668_101079541
565 Ga0070669_100291043
566 Ga0070675_100341340
567 Ga0070671_100150747
568 Ga0070671_100524981
569 Ga0070673_101399889
570 Ga0070688_100048560
571 Ga0070659_100322982
572 Ga0070659_101287284
573 Ga0070667_100086343
574 Ga0070713_100879310
575 Ga0070701_10254015
576 Ga0070700_100204448
577 Ga0070700_101480224
578 Ga0070708_100001125
579 Ga0070663_100007513
580 Ga0070663_101507556
581 Ga0070678_100012969
582 Ga0070662_100195129
583 Ga0070681_10060667
584 Ga0070685_10588197
585 Ga0070707_100278169
586 Ga0070684_100552101
587 Ga0068853_100015274
588 Ga0068853_100768007
589 Ga0070672_101765529
590 Ga0070686_100209596
591 Ga0070696_100571384
592 Ga0070693_100003660
593 Ga0070665_100068701
594 Ga0070665_100083099
595 Ga0070665_100262808
596 Ga0068855_100003688
597 Ga0068855_100149617
598 Ga0068855_100358233
599 Ga0070664_100846647
600 Ga0070702_100088176
601 Ga0068852_100083561
602 Ga0068861_100171710
603 Ga0068861_100287980
604 Ga0068851_10206857
605 Ga0068870_10000800
606 Ga0068870_11111525
607 Ga0068863_100018824
608 Ga0068860_100000283
609 Ga0068860_100268486
610 Ga0068860_101043537
611 Ga0070717_10000421
612 Ga0075365_10032088
613 Ga0075363_100001728
614 Ga0075364_10139350
615 Ga0075364_10402027
616 Ga0075367_10002408
617 Ga0075369_10012197
618 Ga0097621_100185408
619 Ga0068871_100233549
620 Ga0075428_100427839
621 Ga0075433_10210773
622 Ga0075434_100004337
623 Ga0075436_100014375
624 Ga0075435_100033932
625 Ga0105251_10072015
626 Ga0105244_10046633
627 Ga0105244_10076330
628 Ga0105240_10273182
629 Ga0105240_10287861
630 Ga0105245_10125981
631 Ga0105245_10177858
632 Ga0105247_11454525
633 Ga0114129_10181195
634 Ga0105243_10814363
635 Ga0105241_10034729
636 Ga0105241_10130276
637 Ga0105248_10110081
638 Ga0105248_11965608
639 Ga0105237_10003936
640 Ga0105237_10167416
641 Ga0105237_10217043
642 Ga0105237_10621954
643 Ga0105237_10967049
644 Ga0105238_10055152
645 Ga0105238_10077523
646 Ga0105238_10155995
647 Ga0105249_10678852
648 Ga0105239_10008855
649 Ga0105239_10082611
650 Ga0105239_11180808
651 Ga0105246_10002319
652 Ga0105246_10255446
653 Ga0105246_10879122
654 Ga0157373_10019532
655 Ga0157371_10031231
656 Ga0157371_10767601
657 Ga0157370_10070292
658 Ga0157369_10046088
659 Ga0157369_10235923
660 Ga0157369_10328473
661 Ga0171462_1024
662 Ga0157374_10037393
663 Ga0157374_10043903
664 Ga0157374_10079836
665 Ga0157374_10419394
666 Ga0157374_10705877
667 Ga0157378_10016333
668 Ga0157378_10022419
669 Ga0157378_10065709
670 Ga0157378_11258746
671 Ga0163162_10094363
672 Ga0163162_10256182
673 Ga0163162_10260935
674 Ga0163162_10481893
675 Ga0157372_10279310
676 Ga0157372_10912352
677 Ga0157375_10039749
678 Ga0163163_10642598
679 Ga0182008_10665800
680 Ga0157379_10746294
681 Ga0157379_11410205
682 Ga0157376_10071030
683 Ga0206350_11326130
684 Ga0224712_10018175
685 Ga0209436_100004
686 Ga0207425_1001914
687 Ga0207425_1013832
688 Ga0209129_1000840
689 Ga0209129_1001930
690 Ga0209129_1008740
691 Ga0209129_1008747
692 Ga0209565_1034876
693 Ga0209455_1005913
694 Ga0209673_1003625
695 Ga0209673_1011249
696 Ga0209673_1050502
697 Ga0209673_1084959
698 Ga0209130_1000001
699 Ga0209130_1020841
700 Ga0209025_1004371
701 Ga0209025_1010758
702 Ga0209564_1001805
703 Ga0209564_1025940
704 Ga0209758_1004604
705 Ga0209758_1013346
706 Ga0209758_1016838
707 Ga0209758_1042159
708 Ga0209256_1001343
709 Ga0209256_1024612
710 Ga0209256_1027559
711 Ga0209256_1037077
712 Ga0207426_1000005
713 Ga0207426_1001019
714 Ga0209051_1003667
715 Ga0209051_1026350
716 Ga0209257_1021586
717 Ga0207656_10051263
718 Ga0207713_1069837
719 Ga0207688_10044831
720 Ga0207680_10794726
721 Ga0207643_10000104
722 Ga0207705_10000043
723 Ga0207705_10003883
724 Ga0207705_10234663
725 Ga0207705_10364966
726 Ga0207684_11423500
727 Ga0207654_10422856
728 Ga0207654_11253112
729 Ga0207707_10028326
730 Ga0207707_10809337
731 Ga0207695_10001067
732 Ga0207671_10045799
733 Ga0207671_10094647
734 Ga0207671_10429282
735 Ga0207671_10619206
736 Ga0207660_10029642
737 Ga0207660_10128830
738 Ga0207657_10103348
739 Ga0207649_10077383
740 Ga0207652_10012274
741 Ga0207652_10918364
742 Ga0207646_10307663
743 Ga0207681_10324696
744 Ga0207694_10242773
745 Ga0207694_10467194
746 Ga0207650_10001714
747 Ga0207687_10014822
748 Ga0207700_10132353
749 Ga0207644_10016855
750 Ga0207644_10051654
751 Ga0207644_10497468
752 Ga0207690_10162247
753 Ga0207706_10022097
754 Ga0207670_10949742
755 Ga0207704_10500115
756 Ga0207691_11480273
757 Ga0207711_10110847
758 Ga0207689_10039869
759 Ga0207661_10081069
760 Ga0207661_10342711
761 Ga0207661_10424789
762 Ga0207679_10697102
763 Ga0207679_10777666
764 Ga0207667_10005643
765 Ga0207667_10364987
766 Ga0207667_11554754
767 Ga0207668_10593169
768 Ga0207668_10656242
769 Ga0207640_10567135
770 Ga0207658_10797464
771 Ga0207677_10004345
772 Ga0207677_12212828
773 Ga0207703_10038377
774 Ga0207639_10008882
775 Ga0207639_10928089
776 Ga0207678_10006037
777 Ga0207678_10009692
778 Ga0207708_10288936
779 Ga0207702_10006230
780 Ga0207702_11462002
781 Ga0207641_10609556
782 Ga0207676_10002083
783 Ga0207676_12009115
784 Ga0207674_10142191
785 Ga0207675_100073258
786 Ga0207675_101847767
787 Ga0207683_10006291
788 Ga0207698_10015538
789 Ga0209967_1005070
790 Ga0209981_1033721
791 Ga0209968_1000971
792 Ga0209999_1006920
793 Ga0209982_1007817
794 Ga0209970_1033870
795 Ga0209813_10107123
796 Ga0209974_10003640
797 Ga0207428_10031430
798 Ga0268266_10051056
799 Ga0268264_10000325
800 Ga0268264_10033959
801 Ga0268264_11876916
802 Ga0307515_10012725
803 Ga0307512_10009402
804 Ga0265327_10001761
805 Ga0307513_10010961
806 Ga0307508_10030913
807 Ga0307508_10146922
808 Ga0316579_10416050
809 Ga0307516_10139801
810 Ga0307516_10192591
811 Ga0307413_10258221
812 Ga0307413_11004139
813 Ga0307406_10089012
814 Ga0307406_10862097
815 Ga0307409_101741217
816 Ga0307414_10008417
817 Ga0307415_101302795
818 Ga0316585_10066389
819 Ga0307510_10342875
820 Ga0373934_0005973
821 Ga0373951_0000153
822 Ga0373945_0181507
823 Ga0373943_0144720
824 Ga0373955_0074324
825 Ga0373935_0009175
826 Ga0373927_0013905
827 Ga0373933_0082629
828 Ga0373947_0010317
829 Ga0373947_0153884
830 Ga0373925_0009600
831 Ga0436364_0060001
832 Ga0436364_1191411
833 Ga0400483_185629
834 Ga0436365_0575486
835 Ga0436365_1196253
836 Ga0439436_0028975
837 Ga0439465_0025732
838 Ga0439465_0029133
839 Ga0451802_1473818
840 Ga0451839_0282287
841 Ga0453683_0223152
842 Ga0453684_0023393
843 Ga0453684_0045402
844 Ga0453684_0072933
845 Ga0453684_0251957
846 Ga0453684_0429596
847 Ga0453684_0693572
848 Ga0453684_1101381
849 Ga0466971_0054165
850 Ga0466968_0174613
851 Ga0466959_0502277
852 Ga0451576_0193902
853 Ga0451576_0643839
854 Ga0495590_0061398
855 Ga0495638_0378270
856 Ga0495651_0052297
857 Ga0495651_0244342
858 Ga0495653_0482397
859 Ga0495650_0066311
860 Ga0495580_0000355
861 Ga0495605_0000152
862 Ga0495639_0093662
863 Ga0495596_0015513
864 Ga0495607_0000033
865 Ga0495607_0001801
866 Ga0495583_0003556
867 Ga0495583_0007868
868 Ga0495606_0040774
869 Ga0495606_0361799
870 Ga0495610_0014757
871 Ga0495616_0007091
872 Ga0495628_0087491
873 Ga0495630_0014859
874 Ga0495630_0608405
875 Ga0495643_0014880
876 Ga0495643_0097150
877 Ga0495648_0072324
878 Ga0495666_0182258
879 Ga0495652_0043695
880 Ga0495652_0117706
881 Ga0495586_0011568
882 Ga0495586_0723442
883 Ga0495609_0000202
884 Ga0495609_0008846
885 Ga0495609_0311724
886 Ga0495597_0167021
887 Ga0495645_0002000
888 Ga0495656_0132705
889 Ga0495625_0037223
890 Ga0495659_0091414
891 Ga0495657_0268627
892 Ga0495599_0082328
893 Ga0495599_0345108
894 Ga0495623_0132382
895 Ga0495623_0133432
896 Ga0495646_0237835
897 Ga0495669_0000174
898 Ga0495624_0000059
899 Ga0495660_0029100
900 Ga0495581_0163902
901 Ga0495674_0033163
902 Ga0495672_0494299
903 Ga0495676_0173440
904 Ga0495680_0017926
905 Ga0495675_0024021
906 Ga0495675_0032894
907 Ga0495679_007519
908 Ga0495684_0072142
909 Ga0495686_0428057
910 Ga0495602_0688970
911 Ga0495626_0024969
912 Ga0496100_0979801
913 Ga0496102_0115605
914 Ga0496103_0327027
915 Ga0496104_0233196
916 Ga0496104_0793694
917 Ga0496104_1180370
918 Ga0496105_0081976
919 Ga0496105_0228043
920 Ga0496106_0000980
921 Ga0496106_0092384
922 Ga0496107_0284938
923 Ga0496107_0602857
924 Ga0496108_0004913
925 Ga0496108_0010711
926 Ga0496108_0913957
927 Ga0496109_0022495
928 Ga0496110_0015184
929 Ga0496111_0005157
930 Ga0496112_0022187
931 Ga0496112_0075914
932 Ga0496112_0308497
933 Ga0496112_0319541
934 Ga0496112_0819071
935 Ga0496113_0568902
936 Ga0496114_0103431
937 Ga0496114_1428722
938 Ga0496115_0568035
939 Ga0496115_0795480
940 Ga0496117_0050979
941 Ga0496117_0316216
942 Ga0496118_0002028
943 Ga0496118_0046809
944 Ga0496118_0064731
945 Ga0496121_0006442
946 Ga0496121_0432560
947 Ga0496122_0011018
948 Ga0496123_0013349
949 Ga0496123_0344402
950 Ga0496124_0000149
951 Ga0496124_0117885
952 Ga0496124_0369346
953 Ga0496125_0150160
954 Ga0496125_0330607
955 Ga0496126_0001268
956 Ga0495678_223656
957 Ga0501032_0037930
958 Ga0501032_0048376
959 Ga0501033_0005242
960 Ga0501034_0015666
961 Ga0501034_0218384
962 Ga0501036_0391762
963 Ga0501036_1031865
964 Ga0501037_0029170
965 Ga0501037_0034942
966 Ga0501039_0945684
967 Ga0501043_0058366
968 Ga0501043_0067132
969 Ga0501046_0003415
970 Ga0501046_0042966
971 Ga0501047_0042275
972 Ga0501047_0101167
973 Ga0501048_0044821
974 Ga0501048_0065002
975 Ga0501067_0182804
976 Ga0501069_0119755
977 Ga0501070_0060889
978 Ga0501073_0069486
979 Ga0501080_0785605
980 Ga0501080_1342439
981 Ga0501083_0020958
982 Ga0501035_0002184
983 Ga0501035_0668927
984 Ga0501044_0002158
985 Ga0501044_0436212
986 Ga0501044_0482098
987 nmdc:mga03n38_29978_c1
988 nmdc:mga00v17_68277_c1
989 nmdc:mga07m45_133373_c1
990 nmdc:mga05p37_108235_c1
991 nmdc:mga06r32_796345_c1
992 nmdc:mga0n895_1069329_c1
993 nmdc:mga0n895_5226_c1
994 nmdc:mga0rr50_675170_c1
995 nmdc:mga08x19_138799_c1
996 nmdc:mga0a205_10333_c1
997 nmdc:mga0sz30_17094_c2
998 Ga0495655_0041181
999 Ga0495655_0043394
1000 Ga0495595_0032114
1001 Ga0500646_0044268
1002 Ga0500651_0153544
1003 Ga0500651_0350961
1004 Ga0500650_0067495
1005 Ga0500556_0214054
1006 Ga0500562_062258
1007 Ga0500569_051398
1008 Ga0500594_0056577
1009 Ga0500652_170704
1010 Ga0500559_0217380
1011 Ga0500568_0001209
1012 Ga0500568_0001408
1013 Ga0500568_0053792
1014 Ga0500588_0205684
1015 Ga0500600_0083317
1016 Ga0500604_0000013
1017 Ga0500604_0011777
1018 Ga0500622_0000099
1019 Ga0500622_0101451
1020 Ga0500627_0071460
1021 Ga0500633_0000136
1022 Ga0500611_120698
1023 Ga0500645_002121
1024 Ga0587073_0041221
1025 Ga0587080_042232
1026 Ga0587088_002955
1027 Ga0587091_033165
1028 Ga0587106_011010
1029 Ga0587069_008188
1030 Ga0587076_003991
1031 Ga0501082_0234379
1032 Ga0466962_0028351
1033 2511199820
1034 2585221552
1035 2585544278
1036 2644003460
1037 2644226991
1038 2644233541
1039 2902410727
1040 2904447522
1041 2919103527
1042 2923559673
1043 2928533350
1044 3005451354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08837

DUF1810

Protein of unknown function (DUF1810)

27

161

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9877 7 142
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9529 7 142
4qjy-assembly1.cif.gz_B crystal structure of native ara127n, a gh127 beta-l-arabinofuranosidase from geobacillus stearothermophilus t6 0.4717 9 131
1oxj-assembly1.cif.gz_A crystal structure of the smaug rna binding domain 0.4231 10 140
4qjy-assembly1.cif.gz_B crystal structure of native ara127n, a gh127 beta-l-arabinofuranosidase from geobacillus stearothermophilus t6 0.4156 9 131
ID Description Score Start End Superfamily
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9877 7 142 1.25.40.380
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9529 7 142 1.25.40.380
af_Q8VE52_114_320_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5738 4 128 1.25.10.10
af_Q54B61_245_442_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5426 5 140 1.25.10.10
af_Q54B61_245_442_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.51 5 140 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A126P3Q2-F1-model_v4 Calpastatin 0.9998 7 145
AF-A0A376AFM2-F1-model_v4 Calpastatin 0.9977 7 141
AF-A0A0J0YCP7-F1-model_v4 Calpastatin 0.9976 9 141
AF-A0A0Q5ETY2-F1-model_v4 deleted 0.9974 7 142
AF-A0A849WR08-F1-model_v4 DUF1810 family protein 0.9973 7 86

Map