F458848

General Info

Members Datasets Scaffolds Average Seq Length
522 210 1044 155

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10080116|Ga0163162_100801161
Length 189
Sequence VSQRDYYGGIATAAHQTASRANETFFNRNYEDQSMDDKSFLETWDIHNRINLYLLDAVAPASLPRLSASKGRSVGEQFTHIHNVRLMWLKAAAPELLKGLAKVEKENALDKKLLRKSLADSSAAIRSLLEQSVAQGGKVKGFKPHVAAFLGYLISHESHHRGQIALSLKQAGAPLDKKTQFGIWEWGVR

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
160 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
161 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
162 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
177 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
178 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
179 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
180 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
181 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
182 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
183 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
184 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
185 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
186 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
187 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
188 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
189 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
190 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
191 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
192 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
193 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
194 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
195 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
196 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
197 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
198 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
209 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 2.49
Rhizosphere 97.13
Stem 0
Stem Tuber 0
Unclassified 34.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10080116 3300013306 Unclassified 3333
2 MRS2a_Contig_13774 2124908027 Unclassified 553
3 MRS1b_contig_3991722 2162886011 Bacteria 1031
4 CNAas_1000119 3300000532 Bacteria 6501
5 JGI24736J21556_1065740 3300001904 Unclassified 563
6 Ga0065704_10018691 3300005289 Bacteria 1842
7 Ga0065712_10000133 3300005290 Bacteria 66806
8 Ga0065715_10089116 3300005293 Bacteria 14073
9 Ga0065715_10102907 3300005293 Bacteria 3076
10 Ga0065715_10228866 3300005293 Unclassified 1240
11 Ga0065715_10398353 3300005293 Unclassified 885
12 Ga0065707_10175465 3300005295 Unclassified 1454
13 Ga0065707_10234590 3300005295 Bacteria 1176
14 Ga0065707_10452645 3300005295 Unclassified 795
15 Ga0070676_10330096 3300005328 Bacteria 1043
16 Ga0070670_100059931 3300005331 Unclassified 3267
17 Ga0070670_100078199 3300005331 Bacteria 2841
18 Ga0070670_100417637 3300005331 Bacteria 1186
19 Ga0070670_100774598 3300005331 Bacteria 865
20 Ga0070677_10038236 3300005333 Bacteria 1877
21 Ga0068869_100037563 3300005334 Bacteria 3444
22 Ga0068869_100045611 3300005334 Bacteria 3157
23 Ga0068869_100633111 3300005334 Bacteria 906
24 Ga0068869_101582884 3300005334 Unclassified 583
25 Ga0068869_101622223 3300005334 Unclassified 576
26 Ga0070680_100007992 3300005336 Bacteria 8078
27 Ga0070680_100389746 3300005336 Bacteria 1187
28 Ga0070682_100476536 3300005337 Bacteria 962
29 Ga0070689_100053752 3300005340 Bacteria 3117
30 Ga0070689_100272639 3300005340 Unclassified 1401
31 Ga0070689_100875575 3300005340 Unclassified 793
32 Ga0070689_101620724 3300005340 Unclassified 588
33 Ga0070687_100624093 3300005343 Bacteria 744
34 Ga0070692_10255653 3300005345 Bacteria 1051
35 Ga0070668_100020412 3300005347 Bacteria 4999
36 Ga0070669_100029277 3300005353 Unclassified 3969
37 Ga0070669_100037584 3300005353 Unclassified 3512
38 Ga0070669_100610903 3300005353 Bacteria 914
39 Ga0070675_100026898 3300005354 Bacteria 4619
40 Ga0070675_100682576 3300005354 Unclassified 935
41 Ga0070675_101371470 3300005354 Unclassified 652
42 Ga0070671_100042926 3300005355 Unclassified 3760
43 Ga0070674_100675023 3300005356 Unclassified 881
44 Ga0070673_100015551 3300005364 Bacteria 5349
45 Ga0070673_100365101 3300005364 Unclassified 1284
46 Ga0070688_100002417 3300005365 Bacteria 9431
47 Ga0070688_100627527 3300005365 Bacteria 825
48 Ga0070667_100013592 3300005367 Bacteria 6727
49 Ga0070667_100015487 3300005367 Bacteria 6305
50 Ga0070701_10051762 3300005438 Bacteria 2131
51 Ga0070701_10337413 3300005438 Bacteria 937
52 Ga0070711_100000022 3300005439 Bacteria 119718
53 Ga0070711_100521336 3300005439 Unclassified 982
54 Ga0070705_100039713 3300005440 Bacteria 2672
55 Ga0070705_100176897 3300005440 Bacteria 1442
56 Ga0070705_100445035 3300005440 Bacteria 970
57 Ga0070705_100589094 3300005440 Unclassified 858
58 Ga0070700_100000157 3300005441 Bacteria 39668
59 Ga0070700_100073632 3300005441 Bacteria 2187
60 Ga0070700_100448849 3300005441 Bacteria 981
61 Ga0070694_100022351 3300005444 Bacteria 4051
62 Ga0070694_100248037 3300005444 Bacteria 1346
63 Ga0070694_100419832 3300005444 Unclassified 1051
64 Ga0070694_100938710 3300005444 Bacteria 716
65 Ga0070708_100029925 3300005445 Unclassified 4701
66 Ga0070708_100212127 3300005445 Unclassified 1814
67 Ga0070662_100013322 3300005457 Bacteria 5470
68 Ga0070681_10000065 3300005458 Bacteria 76633
69 Ga0070681_10002481 3300005458 Bacteria 16895
70 Ga0070681_10087270 3300005458 Bacteria 3073
71 Ga0070681_10265015 3300005458 Unclassified 1630
72 Ga0068867_100047226 3300005459 Unclassified 3165
73 Ga0068867_100076283 3300005459 Bacteria 2517
74 Ga0068867_100130037 3300005459 Unclassified 1955
75 Ga0070706_100005337 3300005467 Bacteria 12244
76 Ga0070706_100145058 3300005467 Bacteria 2217
77 Ga0070707_100040613 3300005468 Bacteria 4451
78 Ga0070707_100118624 3300005468 Bacteria 2568
79 Ga0070707_100463700 3300005468 Unclassified 1228
80 Ga0070698_100007282 3300005471 Bacteria 11983
81 Ga0070698_100082257 3300005471 Bacteria 3212
82 Ga0070698_100236745 3300005471 Bacteria 1759
83 Ga0070699_100002222 3300005518 Bacteria 17539
84 Ga0070699_100009906 3300005518 Bacteria 8253
85 Ga0070699_100082526 3300005518 Unclassified 2802
86 Ga0070699_100830189 3300005518 Unclassified 846
87 Ga0070699_100873416 3300005518 Unclassified 823
88 Ga0070679_100000013 3300005530 Bacteria 151602
89 Ga0070697_100000209 3300005536 Bacteria 48151
90 Ga0070697_100000498 3300005536 Bacteria 29802
91 Ga0070697_100006770 3300005536 Bacteria 8889
92 Ga0070697_100023679 3300005536 Unclassified 4885
93 Ga0070697_100121520 3300005536 Bacteria 2185
94 Ga0070697_100171717 3300005536 Bacteria 1835
95 Ga0070697_100349985 3300005536 Bacteria 1276
96 Ga0070697_100492993 3300005536 Unclassified 1071
97 Ga0070697_100841195 3300005536 Unclassified 813
98 Ga0068853_100055400 3300005539 Bacteria 3417
99 Ga0068853_100575193 3300005539 Unclassified 1069
100 Ga0068853_100921301 3300005539 Unclassified 840
101 Ga0068853_101995261 3300005539 Unclassified 563
102 Ga0070672_100485138 3300005543 Bacteria 1068
103 Ga0070672_101366682 3300005543 Unclassified 633
104 Ga0070686_100055671 3300005544 Bacteria 2534
105 Ga0070695_100019520 3300005545 Bacteria 4128
106 Ga0070695_100091242 3300005545 Bacteria 2034
107 Ga0070695_100178631 3300005545 Bacteria 1502
108 Ga0070695_100209188 3300005545 Bacteria 1399
109 Ga0070695_100514152 3300005545 Bacteria 928
110 Ga0070695_100774744 3300005545 Unclassified 767
111 Ga0070696_100006607 3300005546 Bacteria 7745
112 Ga0070696_100007650 3300005546 Bacteria 7220
113 Ga0070696_100073795 3300005546 Unclassified 2405
114 Ga0070696_100158000 3300005546 Bacteria 1669
115 Ga0070696_100303911 3300005546 Bacteria 1223
116 Ga0070696_100444542 3300005546 Unclassified 1022
117 Ga0070693_100010285 3300005547 Unclassified 4684
118 Ga0070693_100132585 3300005547 Bacteria 1560
119 Ga0070693_100155260 3300005547 Bacteria 1453
120 Ga0070693_100321248 3300005547 Unclassified 1050
121 Ga0070693_100716524 3300005547 Unclassified 734
122 Ga0070693_100819106 3300005547 Bacteria 691
123 Ga0070704_100311426 3300005549 Unclassified 1316
124 Ga0070704_100412957 3300005549 Bacteria 1154
125 Ga0070704_100485287 3300005549 Unclassified 1070
126 Ga0070704_100630847 3300005549 Unclassified 944
127 Ga0070704_101043055 3300005549 Bacteria 741
128 Ga0070704_101164664 3300005549 Unclassified 702
129 Ga0070704_101206163 3300005549 Bacteria 690
130 Ga0070664_100040685 3300005564 Bacteria 3919
131 Ga0070664_101825655 3300005564 Unclassified 577
132 Ga0068857_100091255 3300005577 Bacteria 2726
133 Ga0068857_100170815 3300005577 Bacteria 1976
134 Ga0068857_100419346 3300005577 Bacteria 1248
135 Ga0068857_100605243 3300005577 Unclassified 1036
136 Ga0068857_100621892 3300005577 Bacteria 1022
137 Ga0068854_100243865 3300005578 Unclassified 1432
138 Ga0068854_100447198 3300005578 Unclassified 1078
139 Ga0068854_100600346 3300005578 Bacteria 940
140 Ga0068856_100037622 3300005614 Bacteria 4748
141 Ga0068856_100307775 3300005614 Unclassified 1602
142 Ga0070702_100007456 3300005615 Bacteria 5239
143 Ga0068852_100114934 3300005616 Bacteria 2453
144 Ga0068852_100272671 3300005616 Bacteria 1629
145 Ga0068852_101158725 3300005616 Unclassified 794
146 Ga0068859_100044067 3300005617 Bacteria 4484
147 Ga0068859_100174479 3300005617 Bacteria 2231
148 Ga0068859_101754954 3300005617 Unclassified 685
149 Ga0068864_100033501 3300005618 Bacteria 4367
150 Ga0068864_100086325 3300005618 Bacteria 2760
151 Ga0068864_100136884 3300005618 Bacteria 2206
152 Ga0068864_100294743 3300005618 Bacteria 1517
153 Ga0068864_100503389 3300005618 Bacteria 1166
154 Ga0068864_100730023 3300005618 Unclassified 969
155 Ga0068864_101076336 3300005618 Unclassified 799
156 Ga0068866_10217639 3300005718 Bacteria 1150
157 Ga0068861_100014316 3300005719 Bacteria 5564
158 Ga0068861_100193253 3300005719 Bacteria 1703
159 Ga0068861_100783075 3300005719 Unclassified 894
160 Ga0068870_10025216 3300005840 Unclassified 2950
161 Ga0068870_10395642 3300005840 Bacteria 898
162 Ga0068870_10508842 3300005840 Bacteria 804
163 Ga0068870_10567100 3300005840 Unclassified 767
164 Ga0068863_100075302 3300005841 Unclassified 3194
165 Ga0068863_100368483 3300005841 Bacteria 1401
166 Ga0068858_100092398 3300005842 Bacteria 2817
167 Ga0068858_100109039 3300005842 Bacteria 2584
168 Ga0068858_100252994 3300005842 Bacteria 1674
169 Ga0068858_100405300 3300005842 Unclassified 1310
170 Ga0068858_101425441 3300005842 Unclassified 682
171 Ga0068858_101648124 3300005842 Unclassified 633
172 Ga0068860_100018430 3300005843 Bacteria 6790
173 Ga0068860_100075580 3300005843 Bacteria 3204
174 Ga0068860_100128251 3300005843 Bacteria 2432
175 Ga0068860_100167837 3300005843 Unclassified 2119
176 Ga0068860_100522344 3300005843 Bacteria 1187
177 Ga0068860_100827602 3300005843 Bacteria 940
178 Ga0068862_100071124 3300005844 Bacteria 3004
179 Ga0068862_100272426 3300005844 Bacteria 1549
180 Ga0068862_100362143 3300005844 Unclassified 1348
181 Ga0068862_100514656 3300005844 Bacteria 1138
182 Ga0068862_100864259 3300005844 Unclassified 887
183 Ga0068862_100948532 3300005844 Unclassified 848
184 Ga0068862_101134048 3300005844 Bacteria 778
185 Ga0070715_10000004 3300006163 Bacteria 305411
186 Ga0070716_100147585 3300006173 Bacteria 1509
187 Ga0070716_101098898 3300006173 Bacteria 634
188 Ga0097621_100030582 3300006237 Bacteria 4264
189 Ga0097621_100047603 3300006237 Bacteria 3475
190 Ga0097621_100397005 3300006237 Bacteria 1234
191 Ga0068871_100068075 3300006358 Bacteria 2923
192 Ga0075428_100000817 3300006844 Bacteria 32586
193 Ga0075428_100054267 3300006844 Bacteria 4392
194 Ga0075428_100191878 3300006844 Bacteria 2209
195 Ga0075430_100045601 3300006846 Bacteria 3703
196 Ga0075430_100123506 3300006846 Bacteria 2158
197 Ga0075431_100029133 3300006847 Bacteria 5680
198 Ga0075431_100171789 3300006847 Bacteria 2227
199 Ga0075431_101912399 3300006847 Bacteria 549
200 Ga0075433_10020745 3300006852 Bacteria 5499
201 Ga0075433_10162500 3300006852 Bacteria 1988
202 Ga0075433_10653415 3300006852 Unclassified 922
203 Ga0075434_100069819 3300006871 Bacteria 3502
204 Ga0075434_100256182 3300006871 Bacteria 1768
205 Ga0075434_100920586 3300006871 Bacteria 889
206 Ga0075429_100001450 3300006880 Bacteria 19467
207 Ga0075429_100207898 3300006880 Bacteria 1715
208 Ga0075429_100260065 3300006880 Bacteria 1519
209 Ga0075429_100335591 3300006880 Unclassified 1323
210 Ga0075436_100000026 3300006914 Bacteria 102984
211 Ga0075436_100000843 3300006914 Bacteria 20363
212 Ga0075436_100084621 3300006914 Bacteria 2201
213 Ga0075436_100122017 3300006914 Bacteria 1824
214 Ga0097620_100044062 3300006931 Bacteria 4484
215 Ga0097620_100174480 3300006931 Bacteria 2231
216 Ga0097620_101754945 3300006931 Unclassified 685
217 Ga0075435_100004061 3300007076 Bacteria 10013
218 Ga0075435_100158065 3300007076 Bacteria 1908
219 Ga0075435_101582042 3300007076 Unclassified 575
220 Ga0105251_10070566 3300009011 Bacteria 1627
221 Ga0111539_10001778 3300009094 Bacteria 28642
222 Ga0111539_10035492 3300009094 Bacteria 6037
223 Ga0111539_10151915 3300009094 Bacteria 2710
224 Ga0111539_10365171 3300009094 Bacteria 1680
225 Ga0105245_10241727 3300009098 Bacteria 1750
226 Ga0105245_10303579 3300009098 Bacteria 1567
227 Ga0105245_10522659 3300009098 Bacteria 1205
228 Ga0105247_10224300 3300009101 Bacteria 1273
229 Ga0105247_10473787 3300009101 Unclassified 907
230 Ga0114129_10110384 3300009147 Bacteria 3796
231 Ga0114129_10378067 3300009147 Bacteria 1871
232 Ga0114129_10532231 3300009147 Unclassified 1531
233 Ga0114129_10600783 3300009147 Bacteria 1425
234 Ga0105243_10011902 3300009148 Bacteria 6580
235 Ga0105243_10014627 3300009148 Bacteria 5937
236 Ga0105243_10040942 3300009148 Unclassified 3622
237 Ga0105243_10159473 3300009148 Bacteria 1944
238 Ga0105243_10574181 3300009148 Unclassified 1081
239 Ga0105243_11096529 3300009148 Unclassified 804
240 Ga0105243_12489272 3300009148 Unclassified 557
241 Ga0105241_10028609 3300009174 Bacteria 4154
242 Ga0105241_10174106 3300009174 Bacteria 1779
243 Ga0105241_10398179 3300009174 Unclassified 1207
244 Ga0105241_10683908 3300009174 Unclassified 935
245 Ga0105241_11620094 3300009174 Unclassified 627
246 Ga0105241_11816556 3300009174 Unclassified 595
247 Ga0105241_11947377 3300009174 Bacteria 577
248 Ga0105241_11986111 3300009174 Unclassified 572
249 Ga0105242_10024750 3300009176 Unclassified 4743
250 Ga0105242_10162468 3300009176 Bacteria 1956
251 Ga0105242_10556587 3300009176 Unclassified 1101
252 Ga0105242_11697556 3300009176 Unclassified 668
253 Ga0105248_10030295 3300009177 Bacteria 6042
254 Ga0105248_10077787 3300009177 Unclassified 3730
255 Ga0105248_10101306 3300009177 Bacteria 3246
256 Ga0105248_10147662 3300009177 Bacteria 2653
257 Ga0105248_10426821 3300009177 Bacteria 1493
258 Ga0105237_10049698 3300009545 Unclassified 4214
259 Ga0105237_10550541 3300009545 Unclassified 1160
260 Ga0105238_10130859 3300009551 Bacteria 2487
261 Ga0105249_10000686 3300009553 Bacteria 30797
262 Ga0105249_10049087 3300009553 Bacteria 3849
263 Ga0105249_10105777 3300009553 Bacteria 2654
264 Ga0105249_10251467 3300009553 Unclassified 1752
265 Ga0105249_10527071 3300009553 Bacteria 1229
266 Ga0105239_10187715 3300010375 Bacteria 2313
267 Ga0105239_10643416 3300010375 Unclassified 1211
268 Ga0105246_10040947 3300011119 Bacteria 3129
269 Ga0105246_10198815 3300011119 Unclassified 1557
270 Ga0157373_10052148 3300013100 Bacteria 2911
271 Ga0157373_10548733 3300013100 Bacteria 838
272 Ga0157371_10089399 3300013102 Unclassified 2181
273 Ga0157374_10229150 3300013296 Bacteria 1825
274 Ga0157378_10043975 3300013297 Unclassified 3965
275 Ga0157378_10080625 3300013297 Unclassified 2940
276 Ga0157378_10125549 3300013297 Bacteria 2370
277 Ga0157378_10150042 3300013297 Bacteria 2171
278 Ga0157378_10294060 3300013297 Bacteria 1570
279 Ga0157378_10774797 3300013297 Bacteria 983
280 Ga0157378_11338377 3300013297 Unclassified 758
281 Ga0163162_10000714 3300013306 Bacteria 30817
282 Ga0163162_10034252 3300013306 Bacteria 5054
283 Ga0163162_10080524 3300013306 Bacteria 3325
284 Ga0163162_10424002 3300013306 Bacteria 1463
285 Ga0157372_10012822 3300013307 Bacteria 8933
286 Ga0157372_10364877 3300013307 Bacteria 1683
287 Ga0157372_10479261 3300013307 Bacteria 1450
288 Ga0157372_11718239 3300013307 Unclassified 722
289 Ga0157375_10025529 3300013308 Bacteria 5492
290 Ga0157375_10052871 3300013308 Bacteria 3995
291 Ga0157375_10121966 3300013308 Bacteria 2717
292 Ga0157375_10148499 3300013308 Bacteria 2477
293 Ga0157375_11093975 3300013308 Unclassified 933
294 Ga0157375_11799286 3300013308 Bacteria 726
295 Ga0163163_10295853 3300014325 Unclassified 1671
296 Ga0163163_10600856 3300014325 Unclassified 1163
297 Ga0157380_10013527 3300014326 Bacteria 5953
298 Ga0157380_10559951 3300014326 Bacteria 1123
299 Ga0157377_10018585 3300014745 Bacteria 3615
300 Ga0157377_10028497 3300014745 Bacteria 3006
301 Ga0157377_10255098 3300014745 Bacteria 1139
302 Ga0157379_10044500 3300014968 Unclassified 3963
303 Ga0163161_10435624 3300017792 Unclassified 1057
304 Ga0207642_10073707 3300025899 Unclassified 1634
305 Ga0207642_10172342 3300025899 Bacteria 1172
306 Ga0207710_10739618 3300025900 Unclassified 516
307 Ga0207680_10083362 3300025903 Unclassified 2015
308 Ga0207647_10033695 3300025904 Bacteria 3276
309 Ga0207647_10281142 3300025904 Bacteria 950
310 Ga0207685_10000004 3300025905 Bacteria 305368
311 Ga0207645_10065679 3300025907 Unclassified 2319
312 Ga0207645_10131983 3300025907 Bacteria 1626
313 Ga0207645_10400996 3300025907 Unclassified 922
314 Ga0207643_10310787 3300025908 Bacteria 982
315 Ga0207643_10369644 3300025908 Bacteria 902
316 Ga0207643_10456181 3300025908 Unclassified 814
317 Ga0207684_10007175 3300025910 Bacteria 10072
318 Ga0207684_10274570 3300025910 Bacteria 1454
319 Ga0207654_10064913 3300025911 Bacteria 2148
320 Ga0207654_10065329 3300025911 Bacteria 2142
321 Ga0207654_10545070 3300025911 Bacteria 823
322 Ga0207654_11220953 3300025911 Unclassified 548
323 Ga0207707_10000004 3300025912 Bacteria 391281
324 Ga0207707_10004447 3300025912 Bacteria 12349
325 Ga0207707_11039223 3300025912 Unclassified 670
326 Ga0207671_10154413 3300025914 Bacteria 1775
327 Ga0207671_10157299 3300025914 Bacteria 1758
328 Ga0207663_10000047 3300025916 Bacteria 67188
329 Ga0207660_10009696 3300025917 Bacteria 6232
330 Ga0207660_10304678 3300025917 Bacteria 1269
331 Ga0207662_10001398 3300025918 Bacteria 11667
332 Ga0207662_10072328 3300025918 Bacteria 2090
333 Ga0207652_10000122 3300025921 Bacteria 85075
334 Ga0207646_10218643 3300025922 Bacteria 1721
335 Ga0207646_10764661 3300025922 Bacteria 862
336 Ga0207681_10022451 3300025923 Bacteria 4025
337 Ga0207681_10848541 3300025923 Bacteria 764
338 Ga0207681_11401663 3300025923 Unclassified 587
339 Ga0207694_10088484 3300025924 Bacteria 2441
340 Ga0207650_10047998 3300025925 Bacteria 3147
341 Ga0207650_10179223 3300025925 Bacteria 1688
342 Ga0207659_10213436 3300025926 Unclassified 1548
343 Ga0207687_11274847 3300025927 Unclassified 632
344 Ga0207644_10074385 3300025931 Bacteria 2493
345 Ga0207644_10510935 3300025931 Unclassified 992
346 Ga0207706_10030938 3300025933 Bacteria 4773
347 Ga0207686_10040844 3300025934 Bacteria 2823
348 Ga0207709_10007737 3300025935 Bacteria 5959
349 Ga0207709_11194459 3300025935 Unclassified 627
350 Ga0207709_11468725 3300025935 Unclassified 565
351 Ga0207670_10013782 3300025936 Bacteria 4780
352 Ga0207670_10113158 3300025936 Bacteria 1960
353 Ga0207670_10378639 3300025936 Unclassified 1127
354 Ga0207670_10463000 3300025936 Unclassified 1024
355 Ga0207665_10143267 3300025939 Unclassified 1706
356 Ga0207665_10168656 3300025939 Bacteria 1579
357 Ga0207665_10421078 3300025939 Bacteria 1020
358 Ga0207691_10016305 3300025940 Bacteria 7054
359 Ga0207691_10092198 3300025940 Bacteria 2713
360 Ga0207691_10370707 3300025940 Bacteria 1223
361 Ga0207711_10100588 3300025941 Bacteria 2557
362 Ga0207711_10137231 3300025941 Bacteria 2198
363 Ga0207711_10363509 3300025941 Bacteria 1341
364 Ga0207711_10745802 3300025941 Unclassified 913
365 Ga0207689_10058723 3300025942 Bacteria 3164
366 Ga0207689_11148063 3300025942 Bacteria 654
367 Ga0207679_10040867 3300025945 Bacteria 3322
368 Ga0207679_10083178 3300025945 Bacteria 2453
369 Ga0207651_10268694 3300025960 Bacteria 1404
370 Ga0207651_10702012 3300025960 Unclassified 891
371 Ga0207651_10894836 3300025960 Unclassified 790
372 Ga0207651_11039202 3300025960 Unclassified 733
373 Ga0207712_10000256 3300025961 Bacteria 51470
374 Ga0207712_10031121 3300025961 Bacteria 3591
375 Ga0207712_10446741 3300025961 Bacteria 1096
376 Ga0207712_10602354 3300025961 Bacteria 951
377 Ga0207668_10004905 3300025972 Bacteria 7872
378 Ga0207668_10114998 3300025972 Unclassified 2026
379 Ga0207640_10425734 3300025981 Unclassified 1088
380 Ga0207640_10728272 3300025981 Bacteria 853
381 Ga0207640_11081766 3300025981 Unclassified 709
382 Ga0207658_10620789 3300025986 Bacteria 972
383 Ga0207703_10178564 3300026035 Unclassified 1872
384 Ga0207703_10478034 3300026035 Bacteria 1167
385 Ga0207703_11079273 3300026035 Unclassified 771
386 Ga0207639_10030656 3300026041 Bacteria 3946
387 Ga0207639_10044681 3300026041 Bacteria 3333
388 Ga0207639_10765592 3300026041 Unclassified 898
389 Ga0207708_10000095 3300026075 Bacteria 67730
390 Ga0207708_10041510 3300026075 Unclassified 3507
391 Ga0207708_10081272 3300026075 Bacteria 2491
392 Ga0207708_10129096 3300026075 Bacteria 1975
393 Ga0207708_10688478 3300026075 Unclassified 873
394 Ga0207708_11379584 3300026075 Unclassified 618
395 Ga0207702_10094299 3300026078 Bacteria 2627
396 Ga0207641_10084923 3300026088 Unclassified 2757
397 Ga0207641_10345195 3300026088 Bacteria 1417
398 Ga0207641_10474890 3300026088 Unclassified 1211
399 Ga0207641_10785195 3300026088 Bacteria 942
400 Ga0207641_11834846 3300026088 Unclassified 608
401 Ga0207648_10018336 3300026089 Bacteria 6339
402 Ga0207648_10021657 3300026089 Bacteria 5775
403 Ga0207648_10083149 3300026089 Unclassified 2792
404 Ga0207648_10207498 3300026089 Bacteria 1739
405 Ga0207676_10108705 3300026095 Unclassified 2316
406 Ga0207676_10153821 3300026095 Bacteria 1984
407 Ga0207676_10355446 3300026095 Bacteria 1356
408 Ga0207676_10484285 3300026095 Bacteria 1172
409 Ga0207676_10757055 3300026095 Bacteria 945
410 Ga0207676_10831334 3300026095 Unclassified 902
411 Ga0207676_11405566 3300026095 Unclassified 694
412 Ga0207674_10027078 3300026116 Bacteria 6073
413 Ga0207674_10111636 3300026116 Bacteria 2708
414 Ga0207674_10127420 3300026116 Bacteria 2511
415 Ga0207674_10175233 3300026116 Bacteria 2097
416 Ga0207674_10390649 3300026116 Bacteria 1345
417 Ga0207674_10515453 3300026116 Bacteria 1155
418 Ga0207674_10670630 3300026116 Unclassified 1001
419 Ga0207674_11726486 3300026116 Unclassified 594
420 Ga0207675_100005791 3300026118 Bacteria 11811
421 Ga0207675_100199737 3300026118 Bacteria 1920
422 Ga0207675_100242513 3300026118 Bacteria 1742
423 Ga0207675_100639291 3300026118 Bacteria 1069
424 Ga0207675_100758427 3300026118 Unclassified 982
425 Ga0207675_100798954 3300026118 Bacteria 957
426 Ga0207698_10608788 3300026142 Bacteria 1078
427 Ga0207698_11695502 3300026142 Unclassified 647
428 Ga0207428_10004776 3300027907 Bacteria 12801
429 Ga0268265_10016178 3300028380 Bacteria 5121
430 Ga0268265_10295819 3300028380 Unclassified 1455
431 Ga0268265_10517354 3300028380 Bacteria 1127
432 Ga0268265_10942652 3300028380 Unclassified 850
433 Ga0268264_11875639 3300028381 Unclassified 609
434 Ga0265318_10076545 3300028577 Bacteria 1238
435 Ga0265316_10137051 3300031344 Bacteria 1841
436 Ga0307513_10358387 3300031456 Bacteria 1204
437 Ga0307408_100202683 3300031548 Bacteria 1607
438 Ga0307414_10657431 3300032004 Bacteria 945
439 Ga0395900_0556307 3300037418 Bacteria 1091
440 Ga0395898_0060289 3300037466 Unclassified 3688
441 Ga0395898_0109995 3300037466 Bacteria 2642
442 Ga0395901_0500685 3300038443 Unclassified 1237
443 Ga0242420_003730 3300038996 Bacteria 2265
444 Ga0439448_0022259 3300042005 Bacteria 1969
445 Ga0439446_0051072 3300042156 Bacteria 1235
446 Ga0439458_0024340 3300042157 Bacteria 1415
447 Ga0466972_0330238 3300044658 Unclassified 713
448 Ga0453683_0516092 3300044673 Bacteria 776
449 Ga0495669_0187877 3300046684 Bacteria 986
450 Ga0495671_0189808 3300046692 Unclassified 998
451 Ga0495636_0000001 3300047318 Bacteria 149950
452 Ga0496102_1598929 3300048905 Unclassified 570
453 Ga0496103_0016798 3300048906 Bacteria 4371
454 Ga0496104_0079438 3300048907 Bacteria 3127
455 Ga0496104_0111468 3300048907 Bacteria 2623
456 Ga0496104_0867955 3300048907 Unclassified 808
457 Ga0496105_0949313 3300048908 Unclassified 646
458 Ga0496107_0021221 3300048910 Bacteria 4591
459 Ga0496107_0269086 3300048910 Unclassified 1268
460 Ga0496108_0054763 3300048911 Bacteria 3348
461 Ga0496110_0139597 3300048913 Bacteria 2191
462 Ga0496112_0317436 3300048915 Unclassified 1503
463 Ga0496112_0350062 3300048915 Unclassified 1420
464 Ga0496112_0536066 3300048915 Unclassified 1105
465 Ga0501291_009316 3300049514 Bacteria 1374
466 Ga0501296_000278 3300049519 Bacteria 5273
467 Ga0501299_000395 3300049522 Bacteria 5139
468 Ga0501199_019300 3300049650 Unclassified 783
469 Ga0501202_008935 3300049652 Unclassified 1834
470 Ga0501209_095260 3300049656 Unclassified 869
471 Ga0501217_001595 3300049661 Bacteria 4291
472 Ga0501227_088614 3300049665 Unclassified 815
473 Ga0501233_022194 3300049668 Bacteria 1369
474 Ga0501249_036608 3300049679 Unclassified 1106
475 Ga0501250_031674 3300049680 Unclassified 737
476 Ga0501257_018102 3300049686 Bacteria 1641
477 Ga0501260_002776 3300049689 Bacteria 1537
478 Ga0501261_007900 3300049690 Unclassified 1370
479 Ga0501225_0008129 3300049705 Bacteria 3017
480 Ga0501234_010411 3300049707 Bacteria 1449
481 Ga0501245_019564 3300049708 Unclassified 1050
482 Ga0501263_051687 3300049760 Unclassified 626
483 Ga0501270_052275 3300049767 Unclassified 744
484 Ga0501271_009073 3300049768 Unclassified 1030
485 Ga0501279_006980 3300049775 Bacteria 1496
486 Ga0501282_026364 3300049778 Unclassified 653
487 Ga0501283_000734 3300049779 Bacteria 4291
488 nmdc:mga05p37_381723_c1 3300050507 Unclassified 1651
489 nmdc:mga05p37_389769_c1 3300050507 Unclassified 1629
490 nmdc:mga05p37_879592_c1 3300050507 Unclassified 969
491 nmdc:mga09592_1285535_c1 3300050508 Unclassified 602
492 nmdc:mga09592_135480_c1 3300050508 Unclassified 2121
493 nmdc:mga09592_188287_c1 3300050508 Bacteria 1786
494 nmdc:mga09592_296754_c1 3300050508 Bacteria 1401
495 nmdc:mga09592_86228_c1 3300050508 Bacteria 2679
496 nmdc:mga0qj67_113400_c1 3300050509 Bacteria 2189
497 nmdc:mga0qj67_114136_c1 3300050509 Bacteria 2182
498 nmdc:mga06r32_155983_c1 3300050510 Bacteria 2264
499 nmdc:mga08y16_163293_c1 3300050511 Bacteria 2314
500 nmdc:mga08y16_40114_c1 3300050511 Bacteria 4909
501 nmdc:mga08y16_43991_c1 3300050511 Bacteria 4679
502 nmdc:mga0n895_129983_c1 3300050512 Bacteria 2543
503 nmdc:mga0n895_1456096_c1 3300050512 Bacteria 652
504 nmdc:mga0n895_179006_c1 3300050512 Unclassified 2151
505 nmdc:mga0rr50_189237_c1 3300050513 Bacteria 1686
506 nmdc:mga0rr50_2725_c1 3300050513 Bacteria 10018
507 nmdc:mga0rr50_335671_c1 3300050513 Bacteria 1269
508 nmdc:mga0rr50_681989_c1 3300050513 Unclassified 877
509 nmdc:mga08x19_117253_c1 3300050514 Bacteria 1781
510 nmdc:mga08x19_1184_c1 3300050514 Bacteria 1826
511 nmdc:mga08x19_26_c1 3300050514 Bacteria 228913
512 nmdc:mga08x19_43578_c1 3300050514 Bacteria 2863
513 nmdc:mga0a205_1015690_c1 3300050515 Unclassified 676
514 nmdc:mga0a205_112243_c1 3300050515 Bacteria 2625
515 nmdc:mga0a205_178623_c1 3300050515 Bacteria 2017
516 nmdc:mga0a205_251397_c1 3300050515 Unclassified 1647
517 nmdc:mga0a205_298226_c1 3300050515 Bacteria 1485
518 nmdc:mga0a205_4219_c1 3300050515 Bacteria 12892
519 nmdc:mga0a205_532546_c1 3300050515 Bacteria 1031
520 Ga0495655_0228538 3300053083 Unclassified 618
521 Ga0500628_001528 3300053129 Bacteria 3941
522 Ga0530510_0114332 3300061734 Bacteria 1978
523 Ga0163162_10080116
524 MRS2a_Contig_13774
525 MRS1b_contig_3991722
526 CNAas_1000119
527 JGI24736J21556_1065740
528 Ga0065704_10018691
529 Ga0065712_10000133
530 Ga0065715_10089116
531 Ga0065715_10102907
532 Ga0065715_10228866
533 Ga0065715_10398353
534 Ga0065707_10175465
535 Ga0065707_10234590
536 Ga0065707_10452645
537 Ga0070676_10330096
538 Ga0070670_100059931
539 Ga0070670_100078199
540 Ga0070670_100417637
541 Ga0070670_100774598
542 Ga0070677_10038236
543 Ga0068869_100037563
544 Ga0068869_100045611
545 Ga0068869_100633111
546 Ga0068869_101582884
547 Ga0068869_101622223
548 Ga0070680_100007992
549 Ga0070680_100389746
550 Ga0070682_100476536
551 Ga0070689_100053752
552 Ga0070689_100272639
553 Ga0070689_100875575
554 Ga0070689_101620724
555 Ga0070687_100624093
556 Ga0070692_10255653
557 Ga0070668_100020412
558 Ga0070669_100029277
559 Ga0070669_100037584
560 Ga0070669_100610903
561 Ga0070675_100026898
562 Ga0070675_100682576
563 Ga0070675_101371470
564 Ga0070671_100042926
565 Ga0070674_100675023
566 Ga0070673_100015551
567 Ga0070673_100365101
568 Ga0070688_100002417
569 Ga0070688_100627527
570 Ga0070667_100013592
571 Ga0070667_100015487
572 Ga0070701_10051762
573 Ga0070701_10337413
574 Ga0070711_100000022
575 Ga0070711_100521336
576 Ga0070705_100039713
577 Ga0070705_100176897
578 Ga0070705_100445035
579 Ga0070705_100589094
580 Ga0070700_100000157
581 Ga0070700_100073632
582 Ga0070700_100448849
583 Ga0070694_100022351
584 Ga0070694_100248037
585 Ga0070694_100419832
586 Ga0070694_100938710
587 Ga0070708_100029925
588 Ga0070708_100212127
589 Ga0070662_100013322
590 Ga0070681_10000065
591 Ga0070681_10002481
592 Ga0070681_10087270
593 Ga0070681_10265015
594 Ga0068867_100047226
595 Ga0068867_100076283
596 Ga0068867_100130037
597 Ga0070706_100005337
598 Ga0070706_100145058
599 Ga0070707_100040613
600 Ga0070707_100118624
601 Ga0070707_100463700
602 Ga0070698_100007282
603 Ga0070698_100082257
604 Ga0070698_100236745
605 Ga0070699_100002222
606 Ga0070699_100009906
607 Ga0070699_100082526
608 Ga0070699_100830189
609 Ga0070699_100873416
610 Ga0070679_100000013
611 Ga0070697_100000209
612 Ga0070697_100000498
613 Ga0070697_100006770
614 Ga0070697_100023679
615 Ga0070697_100121520
616 Ga0070697_100171717
617 Ga0070697_100349985
618 Ga0070697_100492993
619 Ga0070697_100841195
620 Ga0068853_100055400
621 Ga0068853_100575193
622 Ga0068853_100921301
623 Ga0068853_101995261
624 Ga0070672_100485138
625 Ga0070672_101366682
626 Ga0070686_100055671
627 Ga0070695_100019520
628 Ga0070695_100091242
629 Ga0070695_100178631
630 Ga0070695_100209188
631 Ga0070695_100514152
632 Ga0070695_100774744
633 Ga0070696_100006607
634 Ga0070696_100007650
635 Ga0070696_100073795
636 Ga0070696_100158000
637 Ga0070696_100303911
638 Ga0070696_100444542
639 Ga0070693_100010285
640 Ga0070693_100132585
641 Ga0070693_100155260
642 Ga0070693_100321248
643 Ga0070693_100716524
644 Ga0070693_100819106
645 Ga0070704_100311426
646 Ga0070704_100412957
647 Ga0070704_100485287
648 Ga0070704_100630847
649 Ga0070704_101043055
650 Ga0070704_101164664
651 Ga0070704_101206163
652 Ga0070664_100040685
653 Ga0070664_101825655
654 Ga0068857_100091255
655 Ga0068857_100170815
656 Ga0068857_100419346
657 Ga0068857_100605243
658 Ga0068857_100621892
659 Ga0068854_100243865
660 Ga0068854_100447198
661 Ga0068854_100600346
662 Ga0068856_100037622
663 Ga0068856_100307775
664 Ga0070702_100007456
665 Ga0068852_100114934
666 Ga0068852_100272671
667 Ga0068852_101158725
668 Ga0068859_100044067
669 Ga0068859_100174479
670 Ga0068859_101754954
671 Ga0068864_100033501
672 Ga0068864_100086325
673 Ga0068864_100136884
674 Ga0068864_100294743
675 Ga0068864_100503389
676 Ga0068864_100730023
677 Ga0068864_101076336
678 Ga0068866_10217639
679 Ga0068861_100014316
680 Ga0068861_100193253
681 Ga0068861_100783075
682 Ga0068870_10025216
683 Ga0068870_10395642
684 Ga0068870_10508842
685 Ga0068870_10567100
686 Ga0068863_100075302
687 Ga0068863_100368483
688 Ga0068858_100092398
689 Ga0068858_100109039
690 Ga0068858_100252994
691 Ga0068858_100405300
692 Ga0068858_101425441
693 Ga0068858_101648124
694 Ga0068860_100018430
695 Ga0068860_100075580
696 Ga0068860_100128251
697 Ga0068860_100167837
698 Ga0068860_100522344
699 Ga0068860_100827602
700 Ga0068862_100071124
701 Ga0068862_100272426
702 Ga0068862_100362143
703 Ga0068862_100514656
704 Ga0068862_100864259
705 Ga0068862_100948532
706 Ga0068862_101134048
707 Ga0070715_10000004
708 Ga0070716_100147585
709 Ga0070716_101098898
710 Ga0097621_100030582
711 Ga0097621_100047603
712 Ga0097621_100397005
713 Ga0068871_100068075
714 Ga0075428_100000817
715 Ga0075428_100054267
716 Ga0075428_100191878
717 Ga0075430_100045601
718 Ga0075430_100123506
719 Ga0075431_100029133
720 Ga0075431_100171789
721 Ga0075431_101912399
722 Ga0075433_10020745
723 Ga0075433_10162500
724 Ga0075433_10653415
725 Ga0075434_100069819
726 Ga0075434_100256182
727 Ga0075434_100920586
728 Ga0075429_100001450
729 Ga0075429_100207898
730 Ga0075429_100260065
731 Ga0075429_100335591
732 Ga0075436_100000026
733 Ga0075436_100000843
734 Ga0075436_100084621
735 Ga0075436_100122017
736 Ga0097620_100044062
737 Ga0097620_100174480
738 Ga0097620_101754945
739 Ga0075435_100004061
740 Ga0075435_100158065
741 Ga0075435_101582042
742 Ga0105251_10070566
743 Ga0111539_10001778
744 Ga0111539_10035492
745 Ga0111539_10151915
746 Ga0111539_10365171
747 Ga0105245_10241727
748 Ga0105245_10303579
749 Ga0105245_10522659
750 Ga0105247_10224300
751 Ga0105247_10473787
752 Ga0114129_10110384
753 Ga0114129_10378067
754 Ga0114129_10532231
755 Ga0114129_10600783
756 Ga0105243_10011902
757 Ga0105243_10014627
758 Ga0105243_10040942
759 Ga0105243_10159473
760 Ga0105243_10574181
761 Ga0105243_11096529
762 Ga0105243_12489272
763 Ga0105241_10028609
764 Ga0105241_10174106
765 Ga0105241_10398179
766 Ga0105241_10683908
767 Ga0105241_11620094
768 Ga0105241_11816556
769 Ga0105241_11947377
770 Ga0105241_11986111
771 Ga0105242_10024750
772 Ga0105242_10162468
773 Ga0105242_10556587
774 Ga0105242_11697556
775 Ga0105248_10030295
776 Ga0105248_10077787
777 Ga0105248_10101306
778 Ga0105248_10147662
779 Ga0105248_10426821
780 Ga0105237_10049698
781 Ga0105237_10550541
782 Ga0105238_10130859
783 Ga0105249_10000686
784 Ga0105249_10049087
785 Ga0105249_10105777
786 Ga0105249_10251467
787 Ga0105249_10527071
788 Ga0105239_10187715
789 Ga0105239_10643416
790 Ga0105246_10040947
791 Ga0105246_10198815
792 Ga0157373_10052148
793 Ga0157373_10548733
794 Ga0157371_10089399
795 Ga0157374_10229150
796 Ga0157378_10043975
797 Ga0157378_10080625
798 Ga0157378_10125549
799 Ga0157378_10150042
800 Ga0157378_10294060
801 Ga0157378_10774797
802 Ga0157378_11338377
803 Ga0163162_10000714
804 Ga0163162_10034252
805 Ga0163162_10080524
806 Ga0163162_10424002
807 Ga0157372_10012822
808 Ga0157372_10364877
809 Ga0157372_10479261
810 Ga0157372_11718239
811 Ga0157375_10025529
812 Ga0157375_10052871
813 Ga0157375_10121966
814 Ga0157375_10148499
815 Ga0157375_11093975
816 Ga0157375_11799286
817 Ga0163163_10295853
818 Ga0163163_10600856
819 Ga0157380_10013527
820 Ga0157380_10559951
821 Ga0157377_10018585
822 Ga0157377_10028497
823 Ga0157377_10255098
824 Ga0157379_10044500
825 Ga0163161_10435624
826 Ga0207642_10073707
827 Ga0207642_10172342
828 Ga0207710_10739618
829 Ga0207680_10083362
830 Ga0207647_10033695
831 Ga0207647_10281142
832 Ga0207685_10000004
833 Ga0207645_10065679
834 Ga0207645_10131983
835 Ga0207645_10400996
836 Ga0207643_10310787
837 Ga0207643_10369644
838 Ga0207643_10456181
839 Ga0207684_10007175
840 Ga0207684_10274570
841 Ga0207654_10064913
842 Ga0207654_10065329
843 Ga0207654_10545070
844 Ga0207654_11220953
845 Ga0207707_10000004
846 Ga0207707_10004447
847 Ga0207707_11039223
848 Ga0207671_10154413
849 Ga0207671_10157299
850 Ga0207663_10000047
851 Ga0207660_10009696
852 Ga0207660_10304678
853 Ga0207662_10001398
854 Ga0207662_10072328
855 Ga0207652_10000122
856 Ga0207646_10218643
857 Ga0207646_10764661
858 Ga0207681_10022451
859 Ga0207681_10848541
860 Ga0207681_11401663
861 Ga0207694_10088484
862 Ga0207650_10047998
863 Ga0207650_10179223
864 Ga0207659_10213436
865 Ga0207687_11274847
866 Ga0207644_10074385
867 Ga0207644_10510935
868 Ga0207706_10030938
869 Ga0207686_10040844
870 Ga0207709_10007737
871 Ga0207709_11194459
872 Ga0207709_11468725
873 Ga0207670_10013782
874 Ga0207670_10113158
875 Ga0207670_10378639
876 Ga0207670_10463000
877 Ga0207665_10143267
878 Ga0207665_10168656
879 Ga0207665_10421078
880 Ga0207691_10016305
881 Ga0207691_10092198
882 Ga0207691_10370707
883 Ga0207711_10100588
884 Ga0207711_10137231
885 Ga0207711_10363509
886 Ga0207711_10745802
887 Ga0207689_10058723
888 Ga0207689_11148063
889 Ga0207679_10040867
890 Ga0207679_10083178
891 Ga0207651_10268694
892 Ga0207651_10702012
893 Ga0207651_10894836
894 Ga0207651_11039202
895 Ga0207712_10000256
896 Ga0207712_10031121
897 Ga0207712_10446741
898 Ga0207712_10602354
899 Ga0207668_10004905
900 Ga0207668_10114998
901 Ga0207640_10425734
902 Ga0207640_10728272
903 Ga0207640_11081766
904 Ga0207658_10620789
905 Ga0207703_10178564
906 Ga0207703_10478034
907 Ga0207703_11079273
908 Ga0207639_10030656
909 Ga0207639_10044681
910 Ga0207639_10765592
911 Ga0207708_10000095
912 Ga0207708_10041510
913 Ga0207708_10081272
914 Ga0207708_10129096
915 Ga0207708_10688478
916 Ga0207708_11379584
917 Ga0207702_10094299
918 Ga0207641_10084923
919 Ga0207641_10345195
920 Ga0207641_10474890
921 Ga0207641_10785195
922 Ga0207641_11834846
923 Ga0207648_10018336
924 Ga0207648_10021657
925 Ga0207648_10083149
926 Ga0207648_10207498
927 Ga0207676_10108705
928 Ga0207676_10153821
929 Ga0207676_10355446
930 Ga0207676_10484285
931 Ga0207676_10757055
932 Ga0207676_10831334
933 Ga0207676_11405566
934 Ga0207674_10027078
935 Ga0207674_10111636
936 Ga0207674_10127420
937 Ga0207674_10175233
938 Ga0207674_10390649
939 Ga0207674_10515453
940 Ga0207674_10670630
941 Ga0207674_11726486
942 Ga0207675_100005791
943 Ga0207675_100199737
944 Ga0207675_100242513
945 Ga0207675_100639291
946 Ga0207675_100758427
947 Ga0207675_100798954
948 Ga0207698_10608788
949 Ga0207698_11695502
950 Ga0207428_10004776
951 Ga0268265_10016178
952 Ga0268265_10295819
953 Ga0268265_10517354
954 Ga0268265_10942652
955 Ga0268264_11875639
956 Ga0265318_10076545
957 Ga0265316_10137051
958 Ga0307513_10358387
959 Ga0307408_100202683
960 Ga0307414_10657431
961 Ga0395900_0556307
962 Ga0395898_0060289
963 Ga0395898_0109995
964 Ga0395901_0500685
965 Ga0242420_003730
966 Ga0439448_0022259
967 Ga0439446_0051072
968 Ga0439458_0024340
969 Ga0466972_0330238
970 Ga0453683_0516092
971 Ga0495669_0187877
972 Ga0495671_0189808
973 Ga0495636_0000001
974 Ga0496102_1598929
975 Ga0496103_0016798
976 Ga0496104_0079438
977 Ga0496104_0111468
978 Ga0496104_0867955
979 Ga0496105_0949313
980 Ga0496107_0021221
981 Ga0496107_0269086
982 Ga0496108_0054763
983 Ga0496110_0139597
984 Ga0496112_0317436
985 Ga0496112_0350062
986 Ga0496112_0536066
987 Ga0501291_009316
988 Ga0501296_000278
989 Ga0501299_000395
990 Ga0501199_019300
991 Ga0501202_008935
992 Ga0501209_095260
993 Ga0501217_001595
994 Ga0501227_088614
995 Ga0501233_022194
996 Ga0501249_036608
997 Ga0501250_031674
998 Ga0501257_018102
999 Ga0501260_002776
1000 Ga0501261_007900
1001 Ga0501225_0008129
1002 Ga0501234_010411
1003 Ga0501245_019564
1004 Ga0501263_051687
1005 Ga0501270_052275
1006 Ga0501271_009073
1007 Ga0501279_006980
1008 Ga0501282_026364
1009 Ga0501283_000734
1010 nmdc:mga05p37_381723_c1
1011 nmdc:mga05p37_389769_c1
1012 nmdc:mga05p37_879592_c1
1013 nmdc:mga09592_1285535_c1
1014 nmdc:mga09592_135480_c1
1015 nmdc:mga09592_188287_c1
1016 nmdc:mga09592_296754_c1
1017 nmdc:mga09592_86228_c1
1018 nmdc:mga0qj67_113400_c1
1019 nmdc:mga0qj67_114136_c1
1020 nmdc:mga06r32_155983_c1
1021 nmdc:mga08y16_163293_c1
1022 nmdc:mga08y16_40114_c1
1023 nmdc:mga08y16_43991_c1
1024 nmdc:mga0n895_129983_c1
1025 nmdc:mga0n895_1456096_c1
1026 nmdc:mga0n895_179006_c1
1027 nmdc:mga0rr50_189237_c1
1028 nmdc:mga0rr50_2725_c1
1029 nmdc:mga0rr50_335671_c1
1030 nmdc:mga0rr50_681989_c1
1031 nmdc:mga08x19_117253_c1
1032 nmdc:mga08x19_1184_c1
1033 nmdc:mga08x19_26_c1
1034 nmdc:mga08x19_43578_c1
1035 nmdc:mga0a205_1015690_c1
1036 nmdc:mga0a205_112243_c1
1037 nmdc:mga0a205_178623_c1
1038 nmdc:mga0a205_251397_c1
1039 nmdc:mga0a205_298226_c1
1040 nmdc:mga0a205_4219_c1
1041 nmdc:mga0a205_532546_c1
1042 Ga0495655_0228538
1043 Ga0500628_001528
1044 Ga0530510_0114332

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05163

DinB

DinB family

27

179

0.85

PF12867

DinB_2

DinB superfamily

43

164

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.7382 6 142
2f22-assembly1.cif.gz_A crystal structure of a putative dna damage-inducable (dinb) protein (bh3987) from bacillus halodurans at 1.42 a resolution 0.7213 7 144
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7018 6 142
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.7009 6 130
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.6931 4 138
ID Description Score Start End Superfamily
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7525 7 134 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7121 6 142 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7009 6 130 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6758 4 137 1.20.120.450
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6706 7 134 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A6N6SLX2-F1-model_v4 DinB family protein 0.9788 6 152
AF-A0A7V9UNQ6-F1-model_v4 DinB family protein 0.9624 1 155
AF-A0A1Q7NFM4-F1-model_v4 Damage-inducible protein DinB 0.962 1 155
AF-A0A7Y6XMR8-F1-model_v4 Damage-inducible protein DinB 0.9617 6 152
AF-A0A7Y3VYJ5-F1-model_v4 Damage-inducible protein DinB 0.9563 6 155

Map