F458835

General Info

Members Datasets Scaffolds Average Seq Length
522 275 519 131

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_11003956|Ga0105245_110039561
Length 157
Sequence LENPAVESIPILRMGEFLLVTIQVDMHDRLAMALQDDLTNRISSTGARGVLIDISALDVVDSFIGRMLANIAQMSRILDAQTVVTGMRPAVAITLVELGMTLTGVKTALTVERGMEMLQAALAGQRMSRDEDVIDEDGDLDDRGPSMGDATDAIGQR

Samples

Sample ID Description Type Environment
1 2849660919 Nostoc sp. T09 Isolate Unclassified
2 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
3 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
189 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
190 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
191 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
192 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
195 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
263 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
264 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.38
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0
Rhizoplane 3.07
Rhizosphere 93.68
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10001968 3300005327 Bacteria 17279
2 Ga0070658_10217825 3300005327 Bacteria 1614
3 Ga0070658_10590152 3300005327 Bacteria 963
4 Ga0070676_10842526 3300005328 Bacteria 679
5 Ga0068869_100053039 3300005334 Bacteria 2946
6 Ga0068869_101986236 3300005334 Bacteria 522
7 Ga0070666_10389019 3300005335 Bacteria 1002
8 Ga0070680_100954372 3300005336 Bacteria 740
9 Ga0070682_100746763 3300005337 Bacteria 789
10 Ga0070682_100977597 3300005337 Bacteria 701
11 Ga0068868_100124110 3300005338 Bacteria 2108
12 Ga0068868_101043720 3300005338 Bacteria 750
13 Ga0070660_100444737 3300005339 Bacteria 1075
14 Ga0070660_100598356 3300005339 Bacteria 922
15 Ga0070660_101127691 3300005339 Bacteria 664
16 Ga0070689_100217580 3300005340 Bacteria 1566
17 Ga0070689_101229854 3300005340 Bacteria 673
18 Ga0070687_100299219 3300005343 Bacteria 1020
19 Ga0070661_100036949 3300005344 Bacteria 3552
20 Ga0070692_10338694 3300005345 Bacteria 931
21 Ga0070668_101557229 3300005347 Bacteria 605
22 Ga0070669_100071140 3300005353 Bacteria 2573
23 Ga0070675_100157293 3300005354 Bacteria 1952
24 Ga0070675_100617598 3300005354 Bacteria 984
25 Ga0070675_100794209 3300005354 Bacteria 865
26 Ga0070671_100014251 3300005355 Bacteria 6420
27 Ga0070674_100051129 3300005356 Bacteria 2847
28 Ga0070674_101821993 3300005356 Bacteria 552
29 Ga0070659_100014178 3300005366 Bacteria 5951
30 Ga0070659_100095509 3300005366 Bacteria 2388
31 Ga0070709_10044365 3300005434 Bacteria 2753
32 Ga0070714_100132881 3300005435 Bacteria 2225
33 Ga0070714_100475182 3300005435 Bacteria 1190
34 Ga0070714_100689575 3300005435 Unclassified 985
35 Ga0070714_101058551 3300005435 Bacteria 790
36 Ga0070713_100015549 3300005436 Bacteria 5697
37 Ga0070713_100098188 3300005436 Unclassified 2532
38 Ga0070713_100550043 3300005436 Bacteria 1093
39 Ga0070713_100918727 3300005436 Bacteria 842
40 Ga0070713_101954642 3300005436 Bacteria 569
41 Ga0070710_10012536 3300005437 Bacteria 4213
42 Ga0070710_10436159 3300005437 Bacteria 885
43 Ga0070701_10080293 3300005438 Bacteria 1764
44 Ga0070701_10100386 3300005438 Bacteria 1602
45 Ga0070701_10443175 3300005438 Bacteria 832
46 Ga0070711_100008882 3300005439 Bacteria 6166
47 Ga0070711_100020094 3300005439 Bacteria 4298
48 Ga0070705_100933819 3300005440 Bacteria 700
49 Ga0070700_100164704 3300005441 Bacteria 1530
50 Ga0070694_100093888 3300005444 Bacteria 2110
51 Ga0070694_100842974 3300005444 Bacteria 754
52 Ga0070678_100241025 3300005456 Bacteria 1512
53 Ga0070681_10167178 3300005458 Bacteria 2122
54 Ga0070681_10270923 3300005458 Bacteria 1609
55 Ga0070681_11102506 3300005458 Bacteria 715
56 Ga0068867_100021645 3300005459 Bacteria 4589
57 Ga0068867_100165891 3300005459 Bacteria 1745
58 Ga0070685_10300390 3300005466 Bacteria 1082
59 Ga0070706_100022755 3300005467 Bacteria 5772
60 Ga0070706_100347173 3300005467 Bacteria 1383
61 Ga0070707_100052872 3300005468 Bacteria 3894
62 Ga0070698_100004000 3300005471 Bacteria 16224
63 Ga0070699_100007282 3300005518 Bacteria 9632
64 Ga0070679_100000928 3300005530 Bacteria 25490
65 Ga0070679_100024391 3300005530 Bacteria 5926
66 Ga0070679_100041268 3300005530 Bacteria 4592
67 Ga0070679_100122249 3300005530 Bacteria 2588
68 Ga0070679_100349299 3300005530 Bacteria 1427
69 Ga0070679_100865626 3300005530 Bacteria 847
70 Ga0070684_100124182 3300005535 Bacteria 2324
71 Ga0070684_100435321 3300005535 Bacteria 1211
72 Ga0070697_100018136 3300005536 Bacteria 5547
73 Ga0070697_100438364 3300005536 Bacteria 1137
74 Ga0068853_100108486 3300005539 Bacteria 2463
75 Ga0070672_101897782 3300005543 Bacteria 536
76 Ga0070686_100073417 3300005544 Bacteria 2246
77 Ga0070695_100509916 3300005545 Bacteria 932
78 Ga0070695_100557853 3300005545 Bacteria 894
79 Ga0070696_100010058 3300005546 Bacteria 6330
80 Ga0070696_100113670 3300005546 Bacteria 1952
81 Ga0070693_100307533 3300005547 Bacteria 1071
82 Ga0070665_100012652 3300005548 Bacteria 8498
83 Ga0070665_100028104 3300005548 Bacteria 5665
84 Ga0070665_100305548 3300005548 Bacteria 1594
85 Ga0070665_100442626 3300005548 Bacteria 1309
86 Ga0070665_101919063 3300005548 Bacteria 598
87 Ga0070704_100164062 3300005549 Bacteria 1760
88 Ga0070704_100962949 3300005549 Bacteria 770
89 Ga0070704_101339337 3300005549 Bacteria 656
90 Ga0068855_100008079 3300005563 Bacteria 12714
91 Ga0068855_100010290 3300005563 Bacteria 11281
92 Ga0068855_100202498 3300005563 Bacteria 2234
93 Ga0068855_100995582 3300005563 Bacteria 881
94 Ga0068855_102065746 3300005563 Unclassified 574
95 Ga0070664_100095054 3300005564 Bacteria 2585
96 Ga0070664_100140677 3300005564 Bacteria 2125
97 Ga0070664_100465982 3300005564 Bacteria 1161
98 Ga0070664_100663758 3300005564 Bacteria 969
99 Ga0070664_101966589 3300005564 Bacteria 555
100 Ga0068857_100097426 3300005577 Bacteria 2637
101 Ga0068857_100299633 3300005577 Bacteria 1482
102 Ga0068856_100019093 3300005614 Bacteria 6653
103 Ga0068856_100067700 3300005614 Bacteria 3529
104 Ga0068856_100074742 3300005614 Bacteria 3356
105 Ga0068856_100146188 3300005614 Bacteria 2372
106 Ga0068856_101822903 3300005614 Bacteria 620
107 Ga0070702_100607421 3300005615 Bacteria 821
108 Ga0068852_100018624 3300005616 Bacteria 5473
109 Ga0068852_100112552 3300005616 Bacteria 2477
110 Ga0068852_101629355 3300005616 Bacteria 668
111 Ga0068859_100090927 3300005617 Bacteria 3103
112 Ga0068859_100189346 3300005617 Bacteria 2142
113 Ga0068864_100556235 3300005618 Bacteria 1109
114 Ga0068864_100597322 3300005618 Bacteria 1071
115 Ga0068864_101339347 3300005618 Bacteria 717
116 Ga0068864_101950286 3300005618 Bacteria 593
117 Ga0068866_10633599 3300005718 Bacteria 726
118 Ga0068861_100144450 3300005719 Bacteria 1945
119 Ga0068861_100368210 3300005719 Bacteria 1266
120 Ga0068870_10085002 3300005840 Bacteria 1758
121 Ga0068863_100427054 3300005841 Bacteria 1299
122 Ga0068860_100184010 3300005843 Bacteria 2020
123 Ga0068862_100165926 3300005844 Bacteria 1974
124 Ga0068862_100353626 3300005844 Bacteria 1364
125 Ga0068862_100596275 3300005844 Bacteria 1060
126 Ga0068862_100946913 3300005844 Bacteria 849
127 Ga0081455_10920133 3300005937 Bacteria 543
128 Ga0070717_10010529 3300006028 Bacteria 6987
129 Ga0070717_10029809 3300006028 Bacteria 4382
130 Ga0070717_10075731 3300006028 Bacteria 2815
131 Ga0070717_10135134 3300006028 Bacteria 2123
132 Ga0070715_10001107 3300006163 Bacteria 7661
133 Ga0070716_100000323 3300006173 Bacteria 19282
134 Ga0070716_100545774 3300006173 Bacteria 863
135 Ga0070716_100654379 3300006173 Bacteria 797
136 Ga0070712_100000897 3300006175 Bacteria 17835
137 Ga0070712_100009092 3300006175 Bacteria 6257
138 Ga0070712_100362492 3300006175 Bacteria 1189
139 Ga0075366_11017329 3300006195 Bacteria 517
140 Ga0097621_100648837 3300006237 Bacteria 968
141 Ga0097621_100837184 3300006237 Bacteria 854
142 Ga0075370_10225498 3300006353 Bacteria 1108
143 Ga0075370_10411325 3300006353 Bacteria 812
144 Ga0068871_100334006 3300006358 Bacteria 1337
145 Ga0068871_100896892 3300006358 Bacteria 821
146 Ga0068871_100935080 3300006358 Bacteria 805
147 Ga0075428_100013276 3300006844 Bacteria 9165
148 Ga0075428_100101521 3300006844 Bacteria 3136
149 Ga0075428_101211139 3300006844 Bacteria 796
150 Ga0075430_100017563 3300006846 Bacteria 6092
151 Ga0075430_100815394 3300006846 Bacteria 769
152 Ga0075430_101759691 3300006846 Bacteria 508
153 Ga0075431_100015958 3300006847 Bacteria 7621
154 Ga0075431_100047283 3300006847 Bacteria 4436
155 Ga0075431_100237260 3300006847 Bacteria 1856
156 Ga0075429_100182806 3300006880 Bacteria 1837
157 Ga0075429_100317294 3300006880 Bacteria 1364
158 Ga0075429_100353285 3300006880 Bacteria 1287
159 Ga0097620_100090930 3300006931 Bacteria 3103
160 Ga0097620_100189348 3300006931 Bacteria 2142
161 Ga0099794_10000385 3300007265 Bacteria 15053
162 Ga0105240_10030476 3300009093 Bacteria 7011
163 Ga0111539_10007326 3300009094 Bacteria 14127
164 Ga0111539_10020701 3300009094 Bacteria 8100
165 Ga0105245_11003956 3300009098 Bacteria 879
166 Ga0114129_10046441 3300009147 Bacteria 6103
167 Ga0114129_11471239 3300009147 Bacteria 838
168 Ga0114129_12287274 3300009147 Bacteria 649
169 Ga0105243_10670224 3300009148 Bacteria 1007
170 Ga0105243_11060700 3300009148 Bacteria 816
171 Ga0105241_10640847 3300009174 Bacteria 964
172 Ga0105241_10879250 3300009174 Bacteria 831
173 Ga0105237_10012566 3300009545 Bacteria 8920
174 Ga0105238_10017637 3300009551 Bacteria 7257
175 Ga0105238_10540517 3300009551 Bacteria 1169
176 Ga0105238_10978013 3300009551 Bacteria 867
177 Ga0105249_11973341 3300009553 Bacteria 656
178 Ga0105239_10318174 3300010375 Unclassified 1754
179 Ga0105239_12665071 3300010375 Bacteria 583
180 Ga0105246_10815769 3300011119 Bacteria 829
181 Ga0157319_1000024 3300012497 Bacteria 65569
182 Ga0157373_10022980 3300013100 Bacteria 4522
183 Ga0157373_10157573 3300013100 Bacteria 1597
184 Ga0157371_10275514 3300013102 Bacteria 1215
185 Ga0157370_10002059 3300013104 Bacteria 24637
186 Ga0157370_10082279 3300013104 Bacteria 3028
187 Ga0157370_10332797 3300013104 Unclassified 1400
188 Ga0157370_10926585 3300013104 Bacteria 790
189 Ga0157370_11122689 3300013104 Bacteria 710
190 Ga0157369_10004385 3300013105 Bacteria 16661
191 Ga0157369_10004481 3300013105 Bacteria 16457
192 Ga0157369_10010372 3300013105 Bacteria 10621
193 Ga0157369_10716875 3300013105 Bacteria 1030
194 Ga0157369_12581853 3300013105 Eukaryota 514
195 Ga0157374_10008230 3300013296 Bacteria 8910
196 Ga0157374_10103848 3300013296 Bacteria 2728
197 Ga0157374_10644333 3300013296 Bacteria 1071
198 Ga0157378_10015059 3300013297 Bacteria 6769
199 Ga0157378_12024317 3300013297 Bacteria 626
200 Ga0163162_10846736 3300013306 Bacteria 1030
201 Ga0163162_11214805 3300013306 Unclassified 856
202 Ga0163162_11536912 3300013306 Bacteria 758
203 Ga0157372_10009024 3300013307 Bacteria 10598
204 Ga0157372_10017977 3300013307 Bacteria 7597
205 Ga0157372_10053265 3300013307 Bacteria 4509
206 Ga0157372_10136094 3300013307 Bacteria 2829
207 Ga0157372_11149614 3300013307 Bacteria 898
208 Ga0157372_11920120 3300013307 Bacteria 680
209 Ga0157375_10957366 3300013308 Bacteria 997
210 Ga0163163_10094152 3300014325 Bacteria 3013
211 Ga0163163_10308333 3300014325 Bacteria 1635
212 Ga0163163_10526347 3300014325 Bacteria 1245
213 Ga0163163_10697236 3300014325 Bacteria 1079
214 Ga0163163_11840301 3300014325 Bacteria 666
215 Ga0163163_12806263 3300014325 Bacteria 543
216 Ga0157380_10016317 3300014326 Bacteria 5475
217 Ga0157380_10336774 3300014326 Bacteria 1405
218 Ga0157380_10980655 3300014326 Bacteria 877
219 Ga0157380_11580942 3300014326 Bacteria 711
220 Ga0157376_10413247 3300014969 Bacteria 1307
221 Ga0213874_10120924 3300021377 Bacteria 890
222 Ga0209257_1000244 3300025304 Bacteria 126098
223 Ga0207692_10207834 3300025898 Bacteria 1154
224 Ga0207688_10392473 3300025901 Bacteria 860
225 Ga0207680_10090857 3300025903 Bacteria 1942
226 Ga0207647_10150797 3300025904 Bacteria 1359
227 Ga0207685_10000180 3300025905 Bacteria 9569
228 Ga0207685_10163251 3300025905 Bacteria 1019
229 Ga0207685_10232593 3300025905 Bacteria 882
230 Ga0207685_10411829 3300025905 Bacteria 695
231 Ga0207699_10049586 3300025906 Bacteria 2472
232 Ga0207699_10128008 3300025906 Bacteria 1652
233 Ga0207699_10592756 3300025906 Bacteria 807
234 Ga0207645_11065901 3300025907 Bacteria 546
235 Ga0207705_10105476 3300025909 Bacteria 2077
236 Ga0207705_10172190 3300025909 Bacteria 1630
237 Ga0207684_10017363 3300025910 Bacteria 6173
238 Ga0207654_10000096 3300025911 Bacteria 59187
239 Ga0207707_10042145 3300025912 Bacteria 3986
240 Ga0207707_10132131 3300025912 Bacteria 2183
241 Ga0207707_11077418 3300025912 Bacteria 656
242 Ga0207707_11514032 3300025912 Unclassified 531
243 Ga0207695_10000147 3300025913 Bacteria 208929
244 Ga0207695_10215808 3300025913 Bacteria 1827
245 Ga0207695_10777414 3300025913 Bacteria 838
246 Ga0207671_10049449 3300025914 Bacteria 3113
247 Ga0207671_10141769 3300025914 Bacteria 1852
248 Ga0207693_10002000 3300025915 Bacteria 17895
249 Ga0207693_10314888 3300025915 Bacteria 1225
250 Ga0207663_10018995 3300025916 Bacteria 3863
251 Ga0207663_10073182 3300025916 Bacteria 2217
252 Ga0207663_10096007 3300025916 Bacteria 1979
253 Ga0207663_11168966 3300025916 Bacteria 619
254 Ga0207660_10032477 3300025917 Bacteria 3603
255 Ga0207662_10071693 3300025918 Bacteria 2098
256 Ga0207657_10057492 3300025919 Bacteria 3352
257 Ga0207657_10348455 3300025919 Bacteria 1168
258 Ga0207649_10005007 3300025920 Bacteria 7163
259 Ga0207649_10150637 3300025920 Bacteria 1602
260 Ga0207652_10026299 3300025921 Bacteria 4845
261 Ga0207652_10473417 3300025921 Bacteria 1128
262 Ga0207652_10536197 3300025921 Bacteria 1052
263 Ga0207646_10056014 3300025922 Bacteria 3525
264 Ga0207681_10241592 3300025923 Bacteria 1406
265 Ga0207694_10008750 3300025924 Bacteria 7636
266 Ga0207694_11615196 3300025924 Bacteria 546
267 Ga0207687_10669529 3300025927 Bacteria 879
268 Ga0207700_10240870 3300025928 Bacteria 1542
269 Ga0207700_10271559 3300025928 Bacteria 1456
270 Ga0207700_10608077 3300025928 Bacteria 973
271 Ga0207700_10904202 3300025928 Bacteria 790
272 Ga0207664_10223258 3300025929 Bacteria 1635
273 Ga0207664_10604345 3300025929 Unclassified 985
274 Ga0207644_10006445 3300025931 Bacteria 7649
275 Ga0207690_10029969 3300025932 Bacteria 3465
276 Ga0207690_10152190 3300025932 Bacteria 1716
277 Ga0207690_10785146 3300025932 Bacteria 786
278 Ga0207706_10040918 3300025933 Bacteria 4109
279 Ga0207686_10230811 3300025934 Unclassified 1342
280 Ga0207670_10160238 3300025936 Bacteria 1679
281 Ga0207670_10963012 3300025936 Bacteria 717
282 Ga0207665_10129568 3300025939 Bacteria 1789
283 Ga0207691_10379883 3300025940 Bacteria 1206
284 Ga0207711_10043472 3300025941 Bacteria 3833
285 Ga0207711_10226781 3300025941 Bacteria 1710
286 Ga0207711_10260226 3300025941 Bacteria 1594
287 Ga0207689_10012502 3300025942 Bacteria 7252
288 Ga0207689_11313966 3300025942 Bacteria 607
289 Ga0207661_10304229 3300025944 Bacteria 1430
290 Ga0207679_10216024 3300025945 Bacteria 1611
291 Ga0207679_10309666 3300025945 Bacteria 1364
292 Ga0207679_10332618 3300025945 Bacteria 1319
293 Ga0207679_10883491 3300025945 Bacteria 817
294 Ga0207667_10005604 3300025949 Bacteria 15317
295 Ga0207667_10172181 3300025949 Bacteria 2225
296 Ga0207667_10259893 3300025949 Bacteria 1775
297 Ga0207677_10100402 3300026023 Bacteria 2128
298 Ga0207703_10725871 3300026035 Bacteria 946
299 Ga0207703_11213971 3300026035 Bacteria 725
300 Ga0207703_11586178 3300026035 Bacteria 630
301 Ga0207639_10196767 3300026041 Bacteria 1726
302 Ga0207708_10187395 3300026075 Bacteria 1645
303 Ga0207702_10074945 3300026078 Bacteria 2922
304 Ga0207702_10121243 3300026078 Bacteria 2341
305 Ga0207702_10133849 3300026078 Bacteria 2234
306 Ga0207702_10327346 3300026078 Bacteria 1461
307 Ga0207641_10249187 3300026088 Bacteria 1658
308 Ga0207641_10445760 3300026088 Bacteria 1250
309 Ga0207648_11080322 3300026089 Bacteria 752
310 Ga0207676_10115629 3300026095 Bacteria 2253
311 Ga0207676_10683682 3300026095 Bacteria 993
312 Ga0207675_100067075 3300026118 Bacteria 3354
313 Ga0207675_100269243 3300026118 Bacteria 1653
314 Ga0207675_100355711 3300026118 Bacteria 1436
315 Ga0207683_10272719 3300026121 Bacteria 1546
316 Ga0207683_10833815 3300026121 Bacteria 856
317 Ga0207698_10002324 3300026142 Bacteria 11256
318 Ga0207698_10258357 3300026142 Bacteria 1599
319 Ga0209588_1000459 3300027671 Bacteria 10476
320 Ga0207428_10028142 3300027907 Bacteria 4672
321 Ga0268266_10177827 3300028379 Bacteria 1935
322 Ga0268266_10183489 3300028379 Bacteria 1907
323 Ga0268266_10903235 3300028379 Bacteria 854
324 Ga0268265_10226196 3300028380 Bacteria 1641
325 Ga0268265_10387980 3300028380 Bacteria 1287
326 Ga0268265_10756851 3300028380 Bacteria 943
327 Ga0268265_11021677 3300028380 Bacteria 817
328 Ga0268265_11068298 3300028380 Bacteria 800
329 Ga0268264_10604696 3300028381 Bacteria 1081
330 Ga0265320_10438885 3300031240 Bacteria 576
331 Ga0307513_10504288 3300031456 Bacteria 927
332 Ga0307509_10559922 3300031507 Bacteria 820
333 Ga0307408_100028299 3300031548 Bacteria 3872
334 Ga0307408_100319995 3300031548 Bacteria 1306
335 Ga0307410_10610809 3300031852 Bacteria 910
336 Ga0307410_10932627 3300031852 Bacteria 745
337 Ga0307406_10283882 3300031901 Bacteria 1264
338 Ga0307406_10641813 3300031901 Bacteria 880
339 Ga0307407_10701684 3300031903 Bacteria 762
340 Ga0307407_11303784 3300031903 Bacteria 570
341 Ga0307409_100194407 3300031995 Bacteria 1809
342 Ga0307416_100051425 3300032002 Bacteria 3291
343 Ga0307416_100207453 3300032002 Bacteria 1865
344 Ga0307414_10090127 3300032004 Bacteria 2275
345 Ga0307414_10346838 3300032004 Bacteria 1273
346 Ga0307414_10997293 3300032004 Bacteria 771
347 Ga0307411_10086339 3300032005 Bacteria 2176
348 Ga0307411_10512811 3300032005 Bacteria 1016
349 Ga0307411_11388698 3300032005 Bacteria 642
350 Ga0307415_100752330 3300032126 Bacteria 885
351 Ga0373929_0070467 3300035085 Bacteria 835
352 Ga0373929_0240674 3300035085 Bacteria 521
353 Ga0373940_0079129 3300035088 Bacteria 969
354 Ga0373949_0042919 3300035090 Bacteria 1117
355 Ga0373951_0054717 3300035091 Bacteria 988
356 Ga0373951_0252877 3300035091 Bacteria 530
357 Ga0373941_0025182 3300035115 Bacteria 1716
358 Ga0373960_0023150 3300035121 Bacteria 1671
359 Ga0373955_0043719 3300035172 Bacteria 2411
360 Ga0373962_0035723 3300035242 Bacteria 1381
361 Ga0373931_0077484 3300035691 Bacteria 1827
362 Ga0373925_0740212 3300037068 Bacteria 810
363 Ga0395900_1800252 3300037418 Bacteria 523
364 Ga0395901_0290551 3300038443 Bacteria 1697
365 Ga0436365_1166453 3300039437 Bacteria 725
366 Ga0436363_1249388 3300039450 Bacteria 1222
367 Ga0436362_0047640 3300039453 Bacteria 2609
368 Ga0451797_0615519 3300041453 Bacteria 1923
369 Ga0451807_1327508 3300041486 Bacteria 4075
370 Ga0451807_2694753 3300041486 Bacteria 3461
371 Ga0439454_082918 3300042011 Bacteria 583
372 Ga0450890_000910 3300042127 Bacteria 4274
373 Ga0439435_0069314 3300042436 Bacteria 1042
374 Ga0439444_0084540 3300042437 Bacteria 699
375 Ga0439444_0097382 3300042437 Bacteria 663
376 Ga0439459_0000467 3300042438 Bacteria 5270
377 Ga0439459_0032160 3300042438 Bacteria 1074
378 Ga0439464_0278166 3300042439 Bacteria 544
379 Ga0439460_0021856 3300042461 Bacteria 1752
380 Ga0439440_0094174 3300042993 Bacteria 807
381 Ga0466963_0086163 3300044694 Bacteria 2134
382 Ga0466960_0562991 3300044901 Bacteria 673
383 Ga0466959_0217774 3300045049 Bacteria 1325
384 Ga0451576_0010098 3300045051 Bacteria 10871
385 Ga0451576_0269167 3300045051 Unclassified 1781
386 Ga0466958_0128657 3300045836 Bacteria 1589
387 Ga0466958_0718909 3300045836 Unclassified 651
388 Ga0466967_0790600 3300045976 Bacteria 942
389 Ga0466967_1000227 3300045976 Bacteria 832
390 Ga0495603_0231717 3300046455 Bacteria 1065
391 Ga0495629_0022580 3300046459 Bacteria 4485
392 Ga0495580_0001268 3300046472 Bacteria 22280
393 Ga0495580_0014762 3300046472 Bacteria 5918
394 Ga0495580_0078439 3300046472 Bacteria 2304
395 Ga0495580_0168016 3300046472 Bacteria 1517
396 Ga0495594_0059019 3300046499 Bacteria 2121
397 Ga0495594_0077707 3300046499 Bacteria 1852
398 Ga0495616_0003390 3300046513 Bacteria 10217
399 Ga0495632_0083244 3300046519 Bacteria 1524
400 Ga0495632_0267283 3300046519 Bacteria 764
401 Ga0495632_0273298 3300046519 Bacteria 753
402 Ga0495666_0203710 3300046526 Bacteria 909
403 Ga0495642_0050841 3300046528 Bacteria 1705
404 Ga0495642_0072187 3300046528 Bacteria 1445
405 Ga0495665_0553631 3300046531 Bacteria 577
406 Ga0495586_0602148 3300046535 Unclassified 635
407 Ga0495645_0534102 3300046543 Bacteria 729
408 Ga0495622_0418275 3300046557 Bacteria 576
409 Ga0495658_0083436 3300046683 Bacteria 1880
410 Ga0495672_0499880 3300047320 Bacteria 540
411 Ga0495676_0343060 3300047321 Bacteria 1000
412 Ga0495676_0476973 3300047321 Bacteria 821
413 Ga0495686_0001342 3300047472 Bacteria 27533
414 Ga0496102_0011374 3300048905 Bacteria 7669
415 Ga0496103_0010070 3300048906 Bacteria 5590
416 Ga0496104_0214486 3300048907 Bacteria 1837
417 Ga0496104_1215000 3300048907 Bacteria 657
418 Ga0496105_1053550 3300048908 Bacteria 606
419 Ga0496106_0052953 3300048909 Bacteria 3064
420 Ga0496110_0343508 3300048913 Bacteria 1360
421 Ga0496110_1653026 3300048913 Bacteria 550
422 Ga0496112_0023045 3300048915 Bacteria 5942
423 Ga0496112_0128688 3300048915 Bacteria 2503
424 Ga0496113_0540614 3300048916 Bacteria 935
425 Ga0496114_0374740 3300048917 Bacteria 1260
426 Ga0496115_0461694 3300048918 Bacteria 1024
427 Ga0496125_0402857 3300048928 Bacteria 799
428 Ga0501036_0019541 3300049572 Bacteria 5687
429 Ga0501036_0237515 3300049572 Bacteria 1529
430 Ga0501038_0678624 3300049574 Bacteria 774
431 Ga0501039_0106569 3300049575 Bacteria 2189
432 Ga0501039_0171603 3300049575 Bacteria 1705
433 Ga0501040_0128227 3300049576 Bacteria 1783
434 Ga0501040_0248019 3300049576 Bacteria 1270
435 Ga0501040_0976413 3300049576 Bacteria 614
436 Ga0501040_1182902 3300049576 Bacteria 555
437 Ga0501041_0208693 3300049577 Bacteria 1225
438 Ga0501042_0015219 3300049578 Bacteria 5264
439 Ga0501042_0102509 3300049578 Bacteria 2059
440 Ga0501042_0113985 3300049578 Bacteria 1947
441 Ga0501043_1124357 3300049579 Bacteria 554
442 Ga0501046_0064679 3300049580 Bacteria 2855
443 Ga0501046_0547335 3300049580 Bacteria 825
444 Ga0501047_0061986 3300049581 Bacteria 3608
445 Ga0501048_0518057 3300049582 Bacteria 855
446 Ga0501068_0115890 3300049584 Bacteria 1669
447 Ga0501069_0010953 3300049585 Bacteria 4808
448 Ga0501069_0575207 3300049585 Bacteria 675
449 Ga0501070_0112595 3300049586 Bacteria 2249
450 Ga0501070_0432925 3300049586 Bacteria 1062
451 Ga0501071_0005747 3300049587 Bacteria 8002
452 Ga0501071_0038701 3300049587 Bacteria 3408
453 Ga0501071_0158325 3300049587 Bacteria 1692
454 Ga0501072_0014673 3300049588 Bacteria 6007
455 Ga0501072_0474349 3300049588 Bacteria 990
456 Ga0501072_1033766 3300049588 Bacteria 640
457 Ga0501074_0222158 3300049590 Bacteria 1345
458 Ga0501074_0319345 3300049590 Bacteria 1103
459 Ga0501075_0030021 3300049591 Bacteria 4023
460 Ga0501075_0288609 3300049591 Bacteria 1250
461 Ga0501075_0318206 3300049591 Bacteria 1186
462 Ga0501076_0011033 3300049592 Bacteria 6719
463 Ga0501076_0607147 3300049592 Bacteria 903
464 Ga0501076_0841832 3300049592 Bacteria 756
465 Ga0501077_0142118 3300049593 Bacteria 1522
466 Ga0501079_0101306 3300049741 Bacteria 2233
467 Ga0501080_0419870 3300049742 Bacteria 1202
468 Ga0501080_0502205 3300049742 Bacteria 1084
469 Ga0501081_0002396 3300049743 Bacteria 11812
470 Ga0501081_0146581 3300049743 Bacteria 1694
471 Ga0501081_0248299 3300049743 Bacteria 1299
472 Ga0501035_0128662 3300049822 Bacteria 2209
473 Ga0501035_1029103 3300049822 Bacteria 646
474 Ga0501044_0015753 3300049823 Bacteria 8142
475 Ga0501045_0165149 3300049824 Bacteria 1649
476 Ga0501045_0467850 3300049824 Bacteria 937
477 nmdc:mga07m45_444525_c1 3300050496 Bacteria 752
478 nmdc:mga05p37_1459115_c1 3300050507 Bacteria 684
479 nmdc:mga05p37_43892_c1 3300050507 Bacteria 5500
480 nmdc:mga09592_260045_c1 3300050508 Bacteria 1505
481 nmdc:mga09592_472387_c1 3300050508 Bacteria 1081
482 nmdc:mga09592_576028_c1 3300050508 Bacteria 966
483 nmdc:mga09592_596520_c1 3300050508 Bacteria 946
484 nmdc:mga0qj67_40482_c1 3300050509 Bacteria 3662
485 nmdc:mga06r32_11332_c1 3300050510 Bacteria 8029
486 nmdc:mga06r32_218022_c1 3300050510 Bacteria 1896
487 nmdc:mga06r32_30780_c1 3300050510 Bacteria 5036
488 nmdc:mga06r32_38373_c1 3300050510 Bacteria 4538
489 nmdc:mga06r32_5858_c1 3300050510 Bacteria 11060
490 nmdc:mga08y16_1644255_c1 3300050511 Bacteria 599
491 nmdc:mga08y16_194887_c1 3300050511 Bacteria 2101
492 nmdc:mga08y16_24174_c1 3300050511 Bacteria 6413
493 nmdc:mga08y16_746508_c1 3300050511 Bacteria 975
494 Ga0495601_0623652 3300053077 Bacteria 691
495 Ga0495619_0038766 3300053085 Bacteria 3109
496 Ga0500643_035054 3300053087 Bacteria 1508
497 Ga0500583_0600426 3300053092 Bacteria 506
498 Ga0500658_0039439 3300053134 Bacteria 1888
499 Ga0500568_0358532 3300053139 Bacteria 528
500 Ga0500616_0000491 3300053153 Bacteria 51066
501 Ga0501084_0267769 3300054114 Bacteria 1442
502 Ga0501084_0364301 3300054114 Bacteria 1222
503 Ga0590071_000420 3300059421 Bacteria 12423
504 Ga0590074_001361 3300059423 Bacteria 3915
505 Ga0590075_000174 3300059424 Bacteria 17903
506 Ga0590077_000539 3300059426 Bacteria 10461
507 Ga0590077_023913 3300059426 Bacteria 1311
508 Ga0587070_016127 3300059491 Bacteria 1193
509 Ga0587077_143210 3300059493 Bacteria 618
510 Ga0501082_0010418 3300060353 Bacteria 8002
511 Ga0501082_0115289 3300060353 Bacteria 2327
512 Ga0501082_0207832 3300060353 Bacteria 1703
513 Ga0501082_0643100 3300060353 Bacteria 928
514 Ga0501082_1488999 3300060353 Bacteria 591
515 Ga0501082_1944593 3300060353 Bacteria 513
516 Ga0530510_0158922 3300061734 Bacteria 1671
517 Ga0530510_0203749 3300061734 Bacteria 1470
518 Ga0530510_0471505 3300061734 Bacteria 950
519 Ga0530510_0956100 3300061734 Bacteria 655

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_12581853 Ga0157369_125818531 113
2 3300045049 Ga0466959_0217774 Ga0466959_0217774_898_1293 113
3 3300045836 Ga0466958_0718909 Ga0466958_0718909_146_541 113
4 3300009551 Ga0105238_10017637 Ga0105238_100176374 115
5 3300013307 Ga0157372_11149614 Ga0157372_111496142 115
6 3300014325 Ga0163163_10697236 Ga0163163_106972361 115
7 3300005339 Ga0070660_101127691 Ga0070660_1011276911 116
8 3300005435 Ga0070714_101058551 Ga0070714_1010585512 116
9 3300005458 Ga0070681_10270923 Ga0070681_102709233 116
10 3300005530 Ga0070679_100041268 Ga0070679_1000412685 116
11 3300005563 Ga0068855_100008079 Ga0068855_1000080798 116
12 3300013100 Ga0157373_10157573 Ga0157373_101575732 116
13 3300013104 Ga0157370_10002059 Ga0157370_1000205918 116
14 3300013105 Ga0157369_10004385 Ga0157369_1000438512 116
15 3300013307 Ga0157372_10009024 Ga0157372_100090245 116
16 3300005458 Ga0070681_11102506 Ga0070681_111025061 117
17 3300005530 Ga0070679_100122249 Ga0070679_1001222492 117
18 3300013306 Ga0163162_11536912 Ga0163162_115369122 117
19 3300025912 Ga0207707_11077418 Ga0207707_110774181 117
20 3300025921 Ga0207652_10536197 Ga0207652_105361972 117
21 3300031852 Ga0307410_10932627 Ga0307410_109326272 117
22 3300037418 Ga0395900_1800252 Ga0395900_1800252_15_398 117
23 3300038443 Ga0395901_0290551 Ga0395901_0290551_524_907 117
24 3300049574 Ga0501038_0678624 Ga0501038_0678624_228_647 117
25 3300049742 Ga0501080_0502205 Ga0501080_0502205_607_1026 117
26 3300050510 nmdc:mga06r32_5858_c1 nmdc:mga06r32_5858_c1_5558_5947 117
27 3300059421 Ga0590071_000420 Ga0590071_000420_1159_1563 117
28 3300059426 Ga0590077_023913 Ga0590077_023913_676_1077 117
29 3300005327 Ga0070658_10590152 Ga0070658_105901522 118
30 3300005339 Ga0070660_100444737 Ga0070660_1004447372 118
31 3300005339 Ga0070660_100598356 Ga0070660_1005983562 118
32 3300005344 Ga0070661_100036949 Ga0070661_1000369493 118
33 3300005366 Ga0070659_100014178 Ga0070659_1000141783 118
34 3300005435 Ga0070714_100689575 Ga0070714_1006895752 118
35 3300005436 Ga0070713_100098188 Ga0070713_1000981883 118
36 3300005458 Ga0070681_10167178 Ga0070681_101671783 118
37 3300005539 Ga0068853_100108486 Ga0068853_1001084863 118
38 3300005549 Ga0070704_100962949 Ga0070704_1009629492 118
39 3300005563 Ga0068855_100010290 Ga0068855_10001029013 118
40 3300005563 Ga0068855_100202498 Ga0068855_1002024983 118
41 3300005563 Ga0068855_102065746 Ga0068855_1020657461 118
42 3300005564 Ga0070664_100140677 Ga0070664_1001406774 118
43 3300005564 Ga0070664_100465982 Ga0070664_1004659822 118
44 3300005614 Ga0068856_100067700 Ga0068856_1000677003 118
45 3300005614 Ga0068856_100146188 Ga0068856_1001461884 118
46 3300005937 Ga0081455_10920133 Ga0081455_109201331 118
47 3300006028 Ga0070717_10010529 Ga0070717_100105297 118
48 3300006237 Ga0097621_100648837 Ga0097621_1006488372 118
49 3300006353 Ga0075370_10411325 Ga0075370_104113251 118
50 3300006844 Ga0075428_100013276 Ga0075428_1000132766 118
51 3300006880 Ga0075429_100353285 Ga0075429_1003532852 118
52 3300009094 Ga0111539_10020701 Ga0111539_100207016 118
53 3300009147 Ga0114129_12287274 Ga0114129_122872741 118
54 3300009551 Ga0105238_10978013 Ga0105238_109780132 118
55 3300010375 Ga0105239_10318174 Ga0105239_103181742 118
56 3300013102 Ga0157371_10275514 Ga0157371_102755143 118
57 3300013104 Ga0157370_10332797 Ga0157370_103327972 118
58 3300013104 Ga0157370_11122689 Ga0157370_111226892 118
59 3300013105 Ga0157369_10004481 Ga0157369_100044815 118
60 3300013105 Ga0157369_10010372 Ga0157369_100103723 118
61 3300013296 Ga0157374_10008230 Ga0157374_100082301 118
62 3300013296 Ga0157374_10103848 Ga0157374_101038484 118
63 3300013307 Ga0157372_10053265 Ga0157372_100532653 118
64 3300013308 Ga0157375_10957366 Ga0157375_109573662 118
65 3300014325 Ga0163163_10526347 Ga0163163_105263473 118
66 3300014326 Ga0157380_11580942 Ga0157380_115809422 118
67 3300014969 Ga0157376_10413247 Ga0157376_104132472 118
68 3300025904 Ga0207647_10150797 Ga0207647_101507972 118
69 3300025919 Ga0207657_10057492 Ga0207657_100574922 118
70 3300025919 Ga0207657_10348455 Ga0207657_103484553 118
71 3300025920 Ga0207649_10005007 Ga0207649_100050072 118
72 3300025928 Ga0207700_10271559 Ga0207700_102715592 118
73 3300025929 Ga0207664_10604345 Ga0207664_106043452 118
74 3300025932 Ga0207690_10029969 Ga0207690_100299693 118
75 3300025932 Ga0207690_10152190 Ga0207690_101521903 118
76 3300025945 Ga0207679_10216024 Ga0207679_102160242 118
77 3300025945 Ga0207679_10309666 Ga0207679_103096662 118
78 3300025949 Ga0207667_10005604 Ga0207667_100056042 118
79 3300025949 Ga0207667_10172181 Ga0207667_101721813 118
80 3300026041 Ga0207639_10196767 Ga0207639_101967673 118
81 3300026078 Ga0207702_10074945 Ga0207702_100749454 118
82 3300026078 Ga0207702_10327346 Ga0207702_103273462 118
83 3300028379 Ga0268266_10183489 Ga0268266_101834892 118
84 3300046459 Ga0495629_0022580 Ga0495629_0022580_521_907 118
85 3300046499 Ga0495594_0059019 Ga0495594_0059019_148_534 118
86 3300046519 Ga0495632_0267283 Ga0495632_0267283_218_601 118
87 3300046557 Ga0495622_0418275 Ga0495622_0418275_131_517 118
88 3300047320 Ga0495672_0499880 Ga0495672_0499880_49_432 118
89 3300047321 Ga0495676_0476973 Ga0495676_0476973_39_425 118
90 3300047472 Ga0495686_0001342 Ga0495686_0001342_21844_22281 118
91 3300048907 Ga0496104_1215000 Ga0496104_1215000_41_436 118
92 3300048915 Ga0496112_0128688 Ga0496112_0128688_301_696 118
93 3300048916 Ga0496113_0540614 Ga0496113_0540614_340_735 118
94 3300048918 Ga0496115_0461694 Ga0496115_0461694_201_596 118
95 3300050496 nmdc:mga07m45_444525_c1 nmdc:mga07m45_444525_c1_28_426 118
96 3300050508 nmdc:mga09592_260045_c1 nmdc:mga09592_260045_c1_711_1100 118
97 3300050511 nmdc:mga08y16_24174_c1 nmdc:mga08y16_24174_c1_4947_5336 118
98 3300053087 Ga0500643_035054 Ga0500643_035054_720_1103 118
99 3300053092 Ga0500583_0600426 Ga0500583_0600426_34_417 118
100 3300053134 Ga0500658_0039439 Ga0500658_0039439_1408_1791 118
101 3300053139 Ga0500568_0358532 Ga0500568_0358532_85_468 118
102 iso_pu_bacteria 2889306138 2889307468 118
103 3300005618 Ga0068864_100597322 Ga0068864_1005973222 119
104 3300005840 Ga0068870_10085002 Ga0068870_100850022 119
105 3300021377 Ga0213874_10120924 Ga0213874_101209242 119
106 3300039450 Ga0436363_1249388 Ga0436363_1249388_197_589 119
107 3300039453 Ga0436362_0047640 Ga0436362_0047640_2092_2484 119
108 3300005354 Ga0070675_100617598 Ga0070675_1006175982 120
109 3300005616 Ga0068852_100018624 Ga0068852_1000186244 120
110 3300014325 Ga0163163_11840301 Ga0163163_118403011 120
111 3300026142 Ga0207698_10002324 Ga0207698_100023244 120
112 3300031240 Ga0265320_10438885 Ga0265320_104388852 120
113 3300046528 Ga0495642_0072187 Ga0495642_0072187_17_424 120
114 3300049743 Ga0501081_0248299 Ga0501081_0248299_477_866 120
115 3300050511 nmdc:mga08y16_746508_c1 nmdc:mga08y16_746508_c1_120_512 120
116 3300053077 Ga0495601_0623652 Ga0495601_0623652_285_674 120
117 3300053085 Ga0495619_0038766 Ga0495619_0038766_589_978 120
118 3300059491 Ga0587070_016127 Ga0587070_016127_653_1048 120
119 3300059493 Ga0587077_143210 Ga0587077_143210_97_492 120
120 3300060353 Ga0501082_0643100 Ga0501082_0643100_213_602 120
121 3300005334 Ga0068869_100053039 Ga0068869_1000530392 121
122 3300005336 Ga0070680_100954372 Ga0070680_1009543722 121
123 3300005347 Ga0070668_101557229 Ga0070668_1015572292 121
124 3300005353 Ga0070669_100071140 Ga0070669_1000711402 121
125 3300005354 Ga0070675_100157293 Ga0070675_1001572932 121
126 3300005356 Ga0070674_100051129 Ga0070674_1000511291 121
127 3300005436 Ga0070713_101954642 Ga0070713_1019546421 121
128 3300005437 Ga0070710_10436159 Ga0070710_104361592 121
129 3300005438 Ga0070701_10443175 Ga0070701_104431752 121
130 3300005444 Ga0070694_100093888 Ga0070694_1000938883 121
131 3300005459 Ga0068867_100021645 Ga0068867_1000216454 121
132 3300005467 Ga0070706_100022755 Ga0070706_1000227553 121
133 3300005467 Ga0070706_100347173 Ga0070706_1003471732 121
134 3300005468 Ga0070707_100052872 Ga0070707_1000528722 121
135 3300005471 Ga0070698_100004000 Ga0070698_10000400016 121
136 3300005518 Ga0070699_100007282 Ga0070699_1000072827 121
137 3300005536 Ga0070697_100018136 Ga0070697_1000181362 121
138 3300005545 Ga0070695_100509916 Ga0070695_1005099162 121
139 3300005545 Ga0070695_100557853 Ga0070695_1005578532 121
140 3300005546 Ga0070696_100113670 Ga0070696_1001136703 121
141 3300005547 Ga0070693_100307533 Ga0070693_1003075332 121
142 3300005548 Ga0070665_100442626 Ga0070665_1004426263 121
143 3300005616 Ga0068852_101629355 Ga0068852_1016293552 121
144 3300005719 Ga0068861_100144450 Ga0068861_1001444502 121
145 3300005843 Ga0068860_100184010 Ga0068860_1001840103 121
146 3300005844 Ga0068862_100353626 Ga0068862_1003536262 121
147 3300006195 Ga0075366_11017329 Ga0075366_110173292 121
148 3300007265 Ga0099794_10000385 Ga0099794_100003857 121
149 3300009148 Ga0105243_10670224 Ga0105243_106702242 121
150 3300009174 Ga0105241_10640847 Ga0105241_106408472 121
151 3300014326 Ga0157380_10016317 Ga0157380_100163174 121
152 3300014326 Ga0157380_10980655 Ga0157380_109806552 121
153 3300025905 Ga0207685_10163251 Ga0207685_101632512 121
154 3300025906 Ga0207699_10592756 Ga0207699_105927562 121
155 3300025907 Ga0207645_11065901 Ga0207645_110659012 121
156 3300025910 Ga0207684_10017363 Ga0207684_100173632 121
157 3300025912 Ga0207707_10132131 Ga0207707_101321313 121
158 3300025916 Ga0207663_10096007 Ga0207663_100960072 121
159 3300025922 Ga0207646_10056014 Ga0207646_100560142 121
160 3300025923 Ga0207681_10241592 Ga0207681_102415923 121
161 3300025933 Ga0207706_10040918 Ga0207706_100409184 121
162 3300025942 Ga0207689_10012502 Ga0207689_100125027 121
163 3300026035 Ga0207703_11213971 Ga0207703_112139712 121
164 3300026118 Ga0207675_100269243 Ga0207675_1002692432 121
165 3300026121 Ga0207683_10272719 Ga0207683_102727193 121
166 3300027671 Ga0209588_1000459 Ga0209588_10004599 121
167 3300028381 Ga0268264_10604696 Ga0268264_106046962 121
168 3300035091 Ga0373951_0252877 Ga0373951_0252877_83_490 121
169 3300045051 Ga0451576_0010098 Ga0451576_0010098_6291_6698 121
170 3300046472 Ga0495580_0168016 Ga0495580_0168016_293_700 121
171 3300048908 Ga0496105_1053550 Ga0496105_1053550_54_458 121
172 3300048913 Ga0496110_0343508 Ga0496110_0343508_179_583 121
173 3300048917 Ga0496114_0374740 Ga0496114_0374740_291_695 121
174 3300049572 Ga0501036_0019541 Ga0501036_0019541_3949_4338 121
175 3300049576 Ga0501040_1182902 Ga0501040_1182902_31_420 121
176 3300049577 Ga0501041_0208693 Ga0501041_0208693_118_507 121
177 3300049578 Ga0501042_0015219 Ga0501042_0015219_2328_2717 121
178 3300049587 Ga0501071_0005747 Ga0501071_0005747_3589_3978 121
179 3300049592 Ga0501076_0841832 Ga0501076_0841832_249_638 121
180 3300049742 Ga0501080_0419870 Ga0501080_0419870_216_605 121
181 3300049822 Ga0501035_1029103 Ga0501035_1029103_147_536 121
182 3300050511 nmdc:mga08y16_1644255_c1 nmdc:mga08y16_1644255_c1_11_400 121
183 3300053153 Ga0500616_0000491 Ga0500616_0000491_13027_13431 121
184 3300060353 Ga0501082_1944593 Ga0501082_1944593_87_476 121
185 3300005334 Ga0068869_101986236 Ga0068869_1019862361 122
186 3300005335 Ga0070666_10389019 Ga0070666_103890192 122
187 3300005337 Ga0070682_100746763 Ga0070682_1007467632 122
188 3300005338 Ga0068868_100124110 Ga0068868_1001241102 122
189 3300005340 Ga0070689_101229854 Ga0070689_1012298541 122
190 3300005354 Ga0070675_100794209 Ga0070675_1007942092 122
191 3300005355 Ga0070671_100014251 Ga0070671_1000142515 122
192 3300005356 Ga0070674_101821993 Ga0070674_1018219931 122
193 3300005438 Ga0070701_10100386 Ga0070701_101003862 122
194 3300005441 Ga0070700_100164704 Ga0070700_1001647042 122
195 3300005536 Ga0070697_100438364 Ga0070697_1004383642 122
196 3300005543 Ga0070672_101897782 Ga0070672_1018977821 122
197 3300005548 Ga0070665_100012652 Ga0070665_1000126524 122
198 3300005548 Ga0070665_100305548 Ga0070665_1003055483 122
199 3300005548 Ga0070665_101919063 Ga0070665_1019190632 122
200 3300005617 Ga0068859_100189346 Ga0068859_1001893462 122
201 3300005618 Ga0068864_100556235 Ga0068864_1005562352 122
202 3300005718 Ga0068866_10633599 Ga0068866_106335992 122
203 3300005719 Ga0068861_100368210 Ga0068861_1003682103 122
204 3300005841 Ga0068863_100427054 Ga0068863_1004270542 122
205 3300005844 Ga0068862_100596275 Ga0068862_1005962753 122
206 3300006846 Ga0075430_100815394 Ga0075430_1008153942 122
207 3300006847 Ga0075431_100237260 Ga0075431_1002372603 122
208 3300006931 Ga0097620_100189348 Ga0097620_1001893482 122
209 3300009148 Ga0105243_11060700 Ga0105243_110607002 122
210 3300009553 Ga0105249_11973341 Ga0105249_119733412 122
211 3300011119 Ga0105246_10815769 Ga0105246_108157692 122
212 3300013297 Ga0157378_10015059 Ga0157378_100150592 122
213 3300013306 Ga0163162_10846736 Ga0163162_108467362 122
214 3300014325 Ga0163163_10094152 Ga0163163_100941523 122
215 3300014325 Ga0163163_10308333 Ga0163163_103083333 122
216 3300025903 Ga0207680_10090857 Ga0207680_100908573 122
217 3300025931 Ga0207644_10006445 Ga0207644_100064458 122
218 3300025936 Ga0207670_10963012 Ga0207670_109630122 122
219 3300025940 Ga0207691_10379883 Ga0207691_103798832 122
220 3300025941 Ga0207711_10260226 Ga0207711_102602263 122
221 3300025942 Ga0207689_11313966 Ga0207689_113139662 122
222 3300026023 Ga0207677_10100402 Ga0207677_101004023 122
223 3300026075 Ga0207708_10187395 Ga0207708_101873952 122
224 3300026088 Ga0207641_10445760 Ga0207641_104457601 122
225 3300026089 Ga0207648_11080322 Ga0207648_110803221 122
226 3300026095 Ga0207676_10683682 Ga0207676_106836822 122
227 3300026118 Ga0207675_100067075 Ga0207675_1000670752 122
228 3300026118 Ga0207675_100355711 Ga0207675_1003557113 122
229 3300028379 Ga0268266_10177827 Ga0268266_101778272 122
230 3300028379 Ga0268266_10903235 Ga0268266_109032352 122
231 3300028380 Ga0268265_10387980 Ga0268265_103879802 122
232 3300028380 Ga0268265_11068298 Ga0268265_110682982 122
233 3300031456 Ga0307513_10504288 Ga0307513_105042882 122
234 3300031507 Ga0307509_10559922 Ga0307509_105599222 122
235 3300031903 Ga0307407_11303784 Ga0307407_113037842 122
236 3300041453 Ga0451797_0615519 Ga0451797_0615519_401_784 122
237 3300041486 Ga0451807_1327508 Ga0451807_1327508_2463_2846 122
238 3300041486 Ga0451807_2694753 Ga0451807_2694753_1428_1811 122
239 3300042437 Ga0439444_0097382 Ga0439444_0097382_74_463 122
240 3300042993 Ga0439440_0094174 Ga0439440_0094174_244_627 122
241 3300046513 Ga0495616_0003390 Ga0495616_0003390_1116_1499 122
242 3300046519 Ga0495632_0083244 Ga0495632_0083244_1012_1395 122
243 3300046519 Ga0495632_0273298 Ga0495632_0273298_170_553 122
244 3300046683 Ga0495658_0083436 Ga0495658_0083436_1380_1769 122
245 3300049586 Ga0501070_0432925 Ga0501070_0432925_323_706 122
246 3300049587 Ga0501071_0158325 Ga0501071_0158325_741_1124 122
247 3300049588 Ga0501072_0474349 Ga0501072_0474349_400_783 122
248 3300049591 Ga0501075_0288609 Ga0501075_0288609_851_1234 122
249 3300050510 nmdc:mga06r32_218022_c1 nmdc:mga06r32_218022_c1_854_1237 122
250 3300059423 Ga0590074_001361 Ga0590074_001361_1680_2063 122
251 3300059424 Ga0590075_000174 Ga0590075_000174_4723_5106 122
252 3300059426 Ga0590077_000539 Ga0590077_000539_3023_3406 122
253 3300060353 Ga0501082_1488999 Ga0501082_1488999_172_555 122
254 3300061734 Ga0530510_0471505 Ga0530510_0471505_110_493 122
255 iso_pu_bacteria 2849660919 2849668402 122
256 3300005327 Ga0070658_10217825 Ga0070658_102178253 123
257 3300005337 Ga0070682_100977597 Ga0070682_1009775972 123
258 3300005340 Ga0070689_100217580 Ga0070689_1002175802 123
259 3300005343 Ga0070687_100299219 Ga0070687_1002992192 123
260 3300005345 Ga0070692_10338694 Ga0070692_103386942 123
261 3300005366 Ga0070659_100095509 Ga0070659_1000955094 123
262 3300005435 Ga0070714_100132881 Ga0070714_1001328813 123
263 3300005435 Ga0070714_100475182 Ga0070714_1004751822 123
264 3300005436 Ga0070713_100918727 Ga0070713_1009187272 123
265 3300005438 Ga0070701_10080293 Ga0070701_100802932 123
266 3300005456 Ga0070678_100241025 Ga0070678_1002410253 123
267 3300005459 Ga0068867_100165891 Ga0068867_1001658912 123
268 3300005466 Ga0070685_10300390 Ga0070685_103003902 123
269 3300005530 Ga0070679_100000928 Ga0070679_10000092813 123
270 3300005530 Ga0070679_100024391 Ga0070679_1000243914 123
271 3300005530 Ga0070679_100349299 Ga0070679_1003492993 123
272 3300005530 Ga0070679_100865626 Ga0070679_1008656262 123
273 3300005535 Ga0070684_100124182 Ga0070684_1001241822 123
274 3300005535 Ga0070684_100435321 Ga0070684_1004353212 123
275 3300005544 Ga0070686_100073417 Ga0070686_1000734172 123
276 3300005564 Ga0070664_100095054 Ga0070664_1000950542 123
277 3300005564 Ga0070664_101966589 Ga0070664_1019665892 123
278 3300005577 Ga0068857_100097426 Ga0068857_1000974263 123
279 3300005577 Ga0068857_100299633 Ga0068857_1002996332 123
280 3300005614 Ga0068856_100074742 Ga0068856_1000747423 123
281 3300005614 Ga0068856_101822903 Ga0068856_1018229031 123
282 3300005615 Ga0070702_100607421 Ga0070702_1006074212 123
283 3300005616 Ga0068852_100112552 Ga0068852_1001125522 123
284 3300005844 Ga0068862_100165926 Ga0068862_1001659263 123
285 3300006028 Ga0070717_10029809 Ga0070717_100298095 123
286 3300006173 Ga0070716_100545774 Ga0070716_1005457742 123
287 3300006358 Ga0068871_100334006 Ga0068871_1003340062 123
288 3300006358 Ga0068871_100896892 Ga0068871_1008968922 123
289 3300009093 Ga0105240_10030476 Ga0105240_100304766 123
290 3300009094 Ga0111539_10007326 Ga0111539_100073268 123
291 3300013104 Ga0157370_10082279 Ga0157370_100822792 123
292 3300013104 Ga0157370_10926585 Ga0157370_109265851 123
293 3300013307 Ga0157372_10136094 Ga0157372_101360943 123
294 3300014326 Ga0157380_10336774 Ga0157380_103367742 123
295 3300025909 Ga0207705_10172190 Ga0207705_101721902 123
296 3300025912 Ga0207707_10042145 Ga0207707_100421454 123
297 3300025913 Ga0207695_10000147 Ga0207695_10000147131 123
298 3300025917 Ga0207660_10032477 Ga0207660_100324773 123
299 3300025918 Ga0207662_10071693 Ga0207662_100716934 123
300 3300025920 Ga0207649_10150637 Ga0207649_101506373 123
301 3300025921 Ga0207652_10026299 Ga0207652_100262996 123
302 3300025921 Ga0207652_10473417 Ga0207652_104734172 123
303 3300025924 Ga0207694_10008750 Ga0207694_100087504 123
304 3300025928 Ga0207700_10608077 Ga0207700_106080772 123
305 3300025929 Ga0207664_10223258 Ga0207664_102232583 123
306 3300025932 Ga0207690_10785146 Ga0207690_107851462 123
307 3300025934 Ga0207686_10230811 Ga0207686_102308113 123
308 3300025936 Ga0207670_10160238 Ga0207670_101602382 123
309 3300025941 Ga0207711_10043472 Ga0207711_100434724 123
310 3300025944 Ga0207661_10304229 Ga0207661_103042293 123
311 3300025945 Ga0207679_10332618 Ga0207679_103326182 123
312 3300025945 Ga0207679_10883491 Ga0207679_108834912 123
313 3300025949 Ga0207667_10259893 Ga0207667_102598932 123
314 3300026035 Ga0207703_10725871 Ga0207703_107258712 123
315 3300026078 Ga0207702_10121243 Ga0207702_101212432 123
316 3300026088 Ga0207641_10249187 Ga0207641_102491872 123
317 3300026095 Ga0207676_10115629 Ga0207676_101156292 123
318 3300026121 Ga0207683_10833815 Ga0207683_108338152 123
319 3300026142 Ga0207698_10258357 Ga0207698_102583572 123
320 3300027907 Ga0207428_10028142 Ga0207428_100281424 123
321 3300028380 Ga0268265_10226196 Ga0268265_102261962 123
322 3300032004 Ga0307414_10090127 Ga0307414_100901271 123
323 3300032004 Ga0307414_10997293 Ga0307414_109972931 123
324 3300032005 Ga0307411_10086339 Ga0307411_100863392 123
325 3300032005 Ga0307411_10512811 Ga0307411_105128112 123
326 3300035172 Ga0373955_0043719 Ga0373955_0043719_1313_1699 123
327 3300042438 Ga0439459_0032160 Ga0439459_0032160_508_894 123
328 3300045976 Ga0466967_0790600 Ga0466967_0790600_374_766 123
329 3300046543 Ga0495645_0534102 Ga0495645_0534102_29_418 123
330 3300047321 Ga0495676_0343060 Ga0495676_0343060_567_956 123
331 3300048913 Ga0496110_1653026 Ga0496110_1653026_68_460 123
332 3300048928 Ga0496125_0402857 Ga0496125_0402857_359_751 123
333 3300049575 Ga0501039_0106569 Ga0501039_0106569_1640_2029 123
334 3300049576 Ga0501040_0128227 Ga0501040_0128227_1327_1716 123
335 3300049582 Ga0501048_0518057 Ga0501048_0518057_69_458 123
336 3300049584 Ga0501068_0115890 Ga0501068_0115890_1055_1444 123
337 3300049587 Ga0501071_0038701 Ga0501071_0038701_1109_1498 123
338 3300049588 Ga0501072_0014673 Ga0501072_0014673_2044_2433 123
339 3300049591 Ga0501075_0030021 Ga0501075_0030021_1930_2328 123
340 3300049592 Ga0501076_0011033 Ga0501076_0011033_1611_2000 123
341 3300049593 Ga0501077_0142118 Ga0501077_0142118_410_808 123
342 3300049741 Ga0501079_0101306 Ga0501079_0101306_591_980 123
343 3300049743 Ga0501081_0002396 Ga0501081_0002396_3509_3907 123
344 3300049743 Ga0501081_0146581 Ga0501081_0146581_1163_1552 123
345 3300050511 nmdc:mga08y16_194887_c1 nmdc:mga08y16_194887_c1_456_842 123
346 3300054114 Ga0501084_0267769 Ga0501084_0267769_826_1215 123
347 3300060353 Ga0501082_0010418 Ga0501082_0010418_1335_1733 123
348 3300061734 Ga0530510_0158922 Ga0530510_0158922_285_683 123
349 3300061734 Ga0530510_0203749 Ga0530510_0203749_218_607 123
350 iso_pu_bacteria 2886848708 2886852327 123
351 3300005618 Ga0068864_101339347 Ga0068864_1013393472 124
352 3300009147 Ga0114129_11471239 Ga0114129_114712392 124
353 3300013306 Ga0163162_11214805 Ga0163162_112148051 124
354 3300025905 Ga0207685_10232593 Ga0207685_102325932 124
355 3300025928 Ga0207700_10904202 Ga0207700_109042022 124
356 3300028380 Ga0268265_10756851 Ga0268265_107568513 124
357 3300049572 Ga0501036_0237515 Ga0501036_0237515_555_959 124
358 3300049575 Ga0501039_0171603 Ga0501039_0171603_793_1197 124
359 3300049576 Ga0501040_0248019 Ga0501040_0248019_179_580 124
360 3300049578 Ga0501042_0102509 Ga0501042_0102509_736_1134 124
361 3300049578 Ga0501042_0113985 Ga0501042_0113985_720_1124 124
362 3300049579 Ga0501043_1124357 Ga0501043_1124357_80_484 124
363 3300049580 Ga0501046_0064679 Ga0501046_0064679_318_722 124
364 3300049580 Ga0501046_0547335 Ga0501046_0547335_293_679 124
365 3300049581 Ga0501047_0061986 Ga0501047_0061986_314_700 124
366 3300049586 Ga0501070_0112595 Ga0501070_0112595_852_1256 124
367 3300049590 Ga0501074_0222158 Ga0501074_0222158_321_719 124
368 3300049590 Ga0501074_0319345 Ga0501074_0319345_61_447 124
369 3300049591 Ga0501075_0318206 Ga0501075_0318206_486_884 124
370 3300049592 Ga0501076_0607147 Ga0501076_0607147_309_707 124
371 3300049822 Ga0501035_0128662 Ga0501035_0128662_914_1300 124
372 3300049823 Ga0501044_0015753 Ga0501044_0015753_1162_1548 124
373 3300049824 Ga0501045_0165149 Ga0501045_0165149_1080_1478 124
374 3300049824 Ga0501045_0467850 Ga0501045_0467850_286_690 124
375 3300050507 nmdc:mga05p37_1459115_c1 nmdc:mga05p37_1459115_c1_180_569 124
376 3300054114 Ga0501084_0364301 Ga0501084_0364301_455_859 124
377 3300060353 Ga0501082_0115289 Ga0501082_0115289_1249_1647 124
378 3300060353 Ga0501082_0207832 Ga0501082_0207832_790_1194 124
379 3300005434 Ga0070709_10044365 Ga0070709_100443653 125
380 3300005436 Ga0070713_100015549 Ga0070713_1000155492 125
381 3300005436 Ga0070713_100550043 Ga0070713_1005500431 125
382 3300005437 Ga0070710_10012536 Ga0070710_100125362 125
383 3300005439 Ga0070711_100008882 Ga0070711_1000088824 125
384 3300005439 Ga0070711_100020094 Ga0070711_1000200944 125
385 3300005564 Ga0070664_100663758 Ga0070664_1006637582 125
386 3300005614 Ga0068856_100019093 Ga0068856_1000190936 125
387 3300006028 Ga0070717_10075731 Ga0070717_100757312 125
388 3300006028 Ga0070717_10135134 Ga0070717_101351343 125
389 3300006163 Ga0070715_10001107 Ga0070715_100011072 125
390 3300006173 Ga0070716_100000323 Ga0070716_10000032313 125
391 3300006173 Ga0070716_100654379 Ga0070716_1006543792 125
392 3300006175 Ga0070712_100000897 Ga0070712_1000008974 125
393 3300006175 Ga0070712_100009092 Ga0070712_1000090924 125
394 3300006846 Ga0075430_101759691 Ga0075430_1017596912 125
395 3300006880 Ga0075429_100182806 Ga0075429_1001828062 125
396 3300006880 Ga0075429_100317294 Ga0075429_1003172942 125
397 3300009147 Ga0114129_10046441 Ga0114129_100464415 125
398 3300009174 Ga0105241_10879250 Ga0105241_108792502 125
399 3300009545 Ga0105237_10012566 Ga0105237_100125666 125
400 3300010375 Ga0105239_12665071 Ga0105239_126650712 125
401 3300013100 Ga0157373_10022980 Ga0157373_100229803 125
402 3300013296 Ga0157374_10644333 Ga0157374_106443332 125
403 3300013297 Ga0157378_12024317 Ga0157378_120243171 125
404 3300013307 Ga0157372_10017977 Ga0157372_100179776 125
405 3300025898 Ga0207692_10207834 Ga0207692_102078343 125
406 3300025901 Ga0207688_10392473 Ga0207688_103924732 125
407 3300025905 Ga0207685_10000180 Ga0207685_100001805 125
408 3300025905 Ga0207685_10411829 Ga0207685_104118292 125
409 3300025906 Ga0207699_10049586 Ga0207699_100495863 125
410 3300025906 Ga0207699_10128008 Ga0207699_101280082 125
411 3300025914 Ga0207671_10141769 Ga0207671_101417693 125
412 3300025915 Ga0207693_10002000 Ga0207693_1000200010 125
413 3300025916 Ga0207663_10018995 Ga0207663_100189954 125
414 3300025916 Ga0207663_10073182 Ga0207663_100731822 125
415 3300025916 Ga0207663_11168966 Ga0207663_111689662 125
416 3300025928 Ga0207700_10240870 Ga0207700_102408702 125
417 3300025939 Ga0207665_10129568 Ga0207665_101295683 125
418 3300026078 Ga0207702_10133849 Ga0207702_101338493 125
419 3300031548 Ga0307408_100319995 Ga0307408_1003199952 125
420 3300031852 Ga0307410_10610809 Ga0307410_106108092 125
421 3300031901 Ga0307406_10641813 Ga0307406_106418132 125
422 3300031903 Ga0307407_10701684 Ga0307407_107016842 125
423 3300032002 Ga0307416_100207453 Ga0307416_1002074533 125
424 3300032004 Ga0307414_10346838 Ga0307414_103468382 125
425 3300032126 Ga0307415_100752330 Ga0307415_1007523302 125
426 3300037068 Ga0373925_0740212 Ga0373925_0740212_377_766 125
427 3300044901 Ga0466960_0562991 Ga0466960_0562991_210_644 125
428 3300046455 Ga0495603_0231717 Ga0495603_0231717_194_583 125
429 3300046472 Ga0495580_0001268 Ga0495580_0001268_1442_1831 125
430 3300046472 Ga0495580_0014762 Ga0495580_0014762_5327_5716 125
431 3300046472 Ga0495580_0078439 Ga0495580_0078439_893_1282 125
432 3300046499 Ga0495594_0077707 Ga0495594_0077707_68_457 125
433 3300046526 Ga0495666_0203710 Ga0495666_0203710_217_606 125
434 3300046528 Ga0495642_0050841 Ga0495642_0050841_1100_1489 125
435 3300046531 Ga0495665_0553631 Ga0495665_0553631_78_467 125
436 3300048907 Ga0496104_0214486 Ga0496104_0214486_773_1162 125
437 3300048915 Ga0496112_0023045 Ga0496112_0023045_2349_2738 125
438 3300049585 Ga0501069_0575207 Ga0501069_0575207_166_573 125
439 3300049588 Ga0501072_1033766 Ga0501072_1033766_33_434 125
440 3300050507 nmdc:mga05p37_43892_c1 nmdc:mga05p37_43892_c1_3769_4176 125
441 3300050508 nmdc:mga09592_576028_c1 nmdc:mga09592_576028_c1_112_534 125
442 3300050509 nmdc:mga0qj67_40482_c1 nmdc:mga0qj67_40482_c1_1539_1946 125
443 3300050510 nmdc:mga06r32_30780_c1 nmdc:mga06r32_30780_c1_3413_3820 125
444 3300005338 Ga0068868_101043720 Ga0068868_1010437201 126
445 3300005440 Ga0070705_100933819 Ga0070705_1009338192 126
446 3300005444 Ga0070694_100842974 Ga0070694_1008429742 126
447 3300005546 Ga0070696_100010058 Ga0070696_1000100582 126
448 3300005549 Ga0070704_100164062 Ga0070704_1001640623 126
449 3300005549 Ga0070704_101339337 Ga0070704_1013393372 126
450 3300005563 Ga0068855_100995582 Ga0068855_1009955822 126
451 3300005617 Ga0068859_100090927 Ga0068859_1000909273 126
452 3300005844 Ga0068862_100946913 Ga0068862_1009469132 126
453 3300006353 Ga0075370_10225498 Ga0075370_102254982 126
454 3300006844 Ga0075428_101211139 Ga0075428_1012111392 126
455 3300006846 Ga0075430_100017563 Ga0075430_1000175635 126
456 3300006847 Ga0075431_100015958 Ga0075431_1000159585 126
457 3300006847 Ga0075431_100047283 Ga0075431_1000472832 126
458 3300006931 Ga0097620_100090930 Ga0097620_1000909303 126
459 3300012497 Ga0157319_1000024 Ga0157319_100002443 126
460 3300025304 Ga0209257_1000244 Ga0209257_100024457 126
461 3300025913 Ga0207695_10777414 Ga0207695_107774142 126
462 3300025914 Ga0207671_10049449 Ga0207671_100494494 126
463 3300025924 Ga0207694_11615196 Ga0207694_116151962 126
464 3300025941 Ga0207711_10226781 Ga0207711_102267812 126
465 3300028380 Ga0268265_11021677 Ga0268265_110216772 126
466 3300031548 Ga0307408_100028299 Ga0307408_1000282993 126
467 3300031901 Ga0307406_10283882 Ga0307406_102838823 126
468 3300031995 Ga0307409_100194407 Ga0307409_1001944072 126
469 3300032002 Ga0307416_100051425 Ga0307416_1000514255 126
470 3300032005 Ga0307411_11388698 Ga0307411_113886982 126
471 3300035085 Ga0373929_0070467 Ga0373929_0070467_220_624 126
472 3300035088 Ga0373940_0079129 Ga0373940_0079129_162_566 126
473 3300035090 Ga0373949_0042919 Ga0373949_0042919_201_605 126
474 3300035091 Ga0373951_0054717 Ga0373951_0054717_564_968 126
475 3300035115 Ga0373941_0025182 Ga0373941_0025182_691_1095 126
476 3300035121 Ga0373960_0023150 Ga0373960_0023150_621_1025 126
477 3300035242 Ga0373962_0035723 Ga0373962_0035723_252_656 126
478 3300035691 Ga0373931_0077484 Ga0373931_0077484_902_1306 126
479 3300039437 Ga0436365_1166453 Ga0436365_1166453_309_701 126
480 3300042011 Ga0439454_082918 Ga0439454_082918_47_481 126
481 3300042127 Ga0450890_000910 Ga0450890_000910_2064_2498 126
482 3300042436 Ga0439435_0069314 Ga0439435_0069314_14_418 126
483 3300042437 Ga0439444_0084540 Ga0439444_0084540_192_626 126
484 3300042438 Ga0439459_0000467 Ga0439459_0000467_826_1260 126
485 3300042439 Ga0439464_0278166 Ga0439464_0278166_101_505 126
486 3300042461 Ga0439460_0021856 Ga0439460_0021856_59_463 126
487 3300045051 Ga0451576_0269167 Ga0451576_0269167_1298_1690 126
488 3300048905 Ga0496102_0011374 Ga0496102_0011374_2889_3293 126
489 3300048906 Ga0496103_0010070 Ga0496103_0010070_167_571 126
490 3300048909 Ga0496106_0052953 Ga0496106_0052953_191_595 126
491 3300049576 Ga0501040_0976413 Ga0501040_0976413_11_415 126
492 3300049585 Ga0501069_0010953 Ga0501069_0010953_982_1392 126
493 3300050508 nmdc:mga09592_472387_c1 nmdc:mga09592_472387_c1_598_1002 126
494 3300050510 nmdc:mga06r32_38373_c1 nmdc:mga06r32_38373_c1_3770_4174 126
495 3300005618 Ga0068864_101950286 Ga0068864_1019502862 127
496 3300006175 Ga0070712_100362492 Ga0070712_1003624923 127
497 3300006358 Ga0068871_100935080 Ga0068871_1009350802 127
498 3300006844 Ga0075428_100101521 Ga0075428_1001015213 127
499 3300009551 Ga0105238_10540517 Ga0105238_105405171 127
500 3300014325 Ga0163163_12806263 Ga0163163_128062632 127
501 3300025912 Ga0207707_11514032 Ga0207707_115140322 127
502 3300025913 Ga0207695_10215808 Ga0207695_102158081 127
503 3300025915 Ga0207693_10314888 Ga0207693_103148882 127
504 3300035085 Ga0373929_0240674 Ga0373929_0240674_77_475 127
505 3300044694 Ga0466963_0086163 Ga0466963_0086163_729_1163 127
506 3300045836 Ga0466958_0128657 Ga0466958_0128657_430_864 127
507 3300045976 Ga0466967_1000227 Ga0466967_1000227_368_802 127
508 3300046535 Ga0495586_0602148 Ga0495586_0602148_146_586 127
509 3300050508 nmdc:mga09592_596520_c1 nmdc:mga09592_596520_c1_303_707 127
510 3300050510 nmdc:mga06r32_11332_c1 nmdc:mga06r32_11332_c1_1571_1975 127
511 3300061734 Ga0530510_0956100 Ga0530510_0956100_179_589 127
512 3300005548 Ga0070665_100028104 Ga0070665_1000281043 128
513 3300013307 Ga0157372_11920120 Ga0157372_119201202 128
514 3300025911 Ga0207654_10000096 Ga0207654_1000009635 128
515 3300026035 Ga0207703_11586178 Ga0207703_115861782 128
516 3300005328 Ga0070676_10842526 Ga0070676_108425261 130
517 3300005327 Ga0070658_10001968 Ga0070658_1000196810 137
518 3300006237 Ga0097621_100837184 Ga0097621_1008371842 137
519 3300009098 Ga0105245_11003956 Ga0105245_110039561 137
520 3300013105 Ga0157369_10716875 Ga0157369_107168752 137
521 3300025909 Ga0207705_10105476 Ga0207705_101054762 137
522 3300025927 Ga0207687_10669529 Ga0207687_106695292 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

8

114

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qcm-assembly1.cif.gz_d cryo em structure of the listeria stressosome 0.9259 3 118
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.9252 3 116
6qcm-assembly1.cif.gz_d cryo em structure of the listeria stressosome 0.904 3 118
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.9029 3 116
7b0u-assembly1.cif.gz_A stressosome complex from listeria innocua 0.8985 2 117
ID Description Score Start End Superfamily
2vy9B00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.879 5 117 3.30.750.24
2vy9B00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8649 5 117 3.30.750.24
af_Q9Y7S9_23_399_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8368 22 80 3.20.20.80
3if5A02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.827 6 86 3.30.750.24
af_Q80ZD3_447_566_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8255 3 113 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A6N0LJD2-F1-model_v4 STAS domain-containing protein 1 1 114
AF-A0A177RCC5-F1-model_v4 deleted 0.9984 1 118
AF-S5W0E4-F1-model_v4 Anti-sigma-factor antagonist 0.9962 2 119
AF-A0A327U379-F1-model_v4 RsbT antagonist protein RsbS 0.996 2 119
AF-A0A7W0CDW5-F1-model_v4 RsbT antagonist protein RsbS 0.9953 1 113

Feature Viewer

pLDDT pTM Quality
85.54 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map