F458807

General Info

Members Datasets Scaffolds Average Seq Length
522 295 1044 206

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100392579|Ga0070667_1003925792
Length 236
Sequence MRRRRSSPPTPRRASGCWASDVSAQRQPGPGASAPLLVVDGVEKRYARGLFNRQVTFSLAASFAIEQPGIVGVMGPNGSGKTTLFELITGGNQPDAGRVLCAGRDIHQVRYRERDRLAIHYHQSYQVRHFKRRKPAFMLEPANNDYPLIHLFDEPQFNTQDGYIGFMLDFFRKLKADGRLVFLCLHPTERYHLDILAEVCERYLFVFRGAVSEAPDLATLAQDGRVREYLGNVLPQ

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
92 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
179 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
180 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
181 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
182 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
185 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
188 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
189 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
190 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
191 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
192 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
197 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
209 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
263 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
267 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
268 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
269 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
270 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
271 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
272 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
273 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
274 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
275 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
278 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
279 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
280 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
281 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
282 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
287 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
288 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
289 2643221736 Bosea sp. Root483D1 Isolate Unclassified
290 2738543012 Acidovorax sp. CF301 Isolate Unclassified
291 2738543013 Variovorax sp. BT01 Isolate Unclassified
292 2816332133 Acidovorax radicis 2721A Isolate Unclassified
293 2844104063 Bosea sp. Tri-39 Isolate Nodule
294 2851246043 Bosea sp. Tri-54 Isolate Nodule
295 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.35
Nodule 0.38
Rhizoplane 2.68
Rhizosphere 63.22
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100392579 3300005367 Bacteria 1262
2 RicEn_FSXC84216_b1 2010549000 Bacteria 849
3 JGI25155J39150_1000009 3300002704 Bacteria 224358
4 JGI25156J39149_1000009 3300002705 Bacteria 224379
5 JGI25154J39366_1000024 3300002738 Bacteria 211372
6 JGI25157J39369_1000007 3300002741 Bacteria 224377
7 JGI25150J39212_1006533 3300002774 Bacteria 2400
8 JGI25151J46595_10015329 3300003187 Bacteria 3381
9 JGI25151J46595_10082734 3300003187 Bacteria 923
10 JGI25161J50226_1000009 3300003374 Bacteria 224699
11 Ga0055526_1001087 3300003771 Bacteria 19828
12 Ga0055526_1006267 3300003771 Bacteria 6513
13 Ga0055537_1000020 3300003773 Bacteria 117325
14 Ga0055524_1000047 3300003775 Bacteria 150887
15 Ga0055534_1002308 3300003784 Bacteria 6695
16 Ga0055534_1009229 3300003784 Bacteria 2162
17 Ga0055528_1008379 3300003790 Bacteria 4437
18 Ga0055540_1000027 3300003792 Bacteria 187454
19 Ga0055531_10022119 3300003794 Bacteria 2436
20 Ga0055543_1000199 3300004625 Bacteria 49097
21 Ga0065165_1007480 3300005262 Bacteria 5354
22 Ga0065165_1011520 3300005262 Bacteria 3677
23 Ga0065165_1016890 3300005262 Bacteria 2712
24 Ga0070676_10002086 3300005328 Bacteria 10168
25 Ga0070676_10202751 3300005328 Bacteria 1301
26 Ga0070683_100091671 3300005329 Bacteria 2854
27 Ga0070690_100026013 3300005330 Bacteria 3607
28 Ga0070690_100026135 3300005330 Bacteria 3599
29 Ga0070690_100049795 3300005330 Bacteria 2672
30 Ga0070670_100010516 3300005331 Bacteria 7900
31 Ga0070670_100028336 3300005331 Bacteria 4820
32 Ga0070670_100176210 3300005331 Bacteria 1856
33 Ga0068869_100035954 3300005334 Bacteria 3514
34 Ga0070666_10028269 3300005335 Bacteria 3679
35 Ga0070666_10137284 3300005335 Bacteria 1702
36 Ga0068868_100029831 3300005338 Bacteria 4179
37 Ga0070689_100802431 3300005340 Bacteria 828
38 Ga0070661_100170268 3300005344 Bacteria 1654
39 Ga0070668_100090835 3300005347 Bacteria 2406
40 Ga0070668_100201351 3300005347 Bacteria 1634
41 Ga0070668_100744820 3300005347 Bacteria 867
42 Ga0070668_100815221 3300005347 Bacteria 830
43 Ga0070669_100089783 3300005353 Bacteria 2302
44 Ga0070675_100000422 3300005354 Bacteria 28826
45 Ga0070675_100006740 3300005354 Bacteria 8833
46 Ga0070671_100006469 3300005355 Bacteria 9365
47 Ga0070671_100156672 3300005355 Bacteria 1924
48 Ga0070674_100015653 3300005356 Bacteria 4741
49 Ga0070673_100001471 3300005364 Bacteria 13789
50 Ga0070673_100045357 3300005364 Bacteria 3409
51 Ga0070673_100106383 3300005364 Bacteria 2319
52 Ga0070673_100116975 3300005364 Bacteria 2218
53 Ga0070673_100343050 3300005364 Bacteria 1324
54 Ga0070688_100046517 3300005365 Bacteria 2687
55 Ga0070667_100007971 3300005367 Bacteria 8783
56 Ga0070667_100031036 3300005367 Bacteria 4456
57 Ga0070705_100181830 3300005440 Bacteria 1425
58 Ga0070705_100554015 3300005440 Bacteria 882
59 Ga0070700_100556673 3300005441 Bacteria 892
60 Ga0070663_100172237 3300005455 Bacteria 1674
61 Ga0070678_100000948 3300005456 Bacteria 14931
62 Ga0070678_100011250 3300005456 Bacteria 5511
63 Ga0070678_100017620 3300005456 Bacteria 4606
64 Ga0070678_100083273 3300005456 Bacteria 2431
65 Ga0068867_100033545 3300005459 Bacteria 3718
66 Ga0068867_100239920 3300005459 Bacteria 1469
67 Ga0070685_10035351 3300005466 Bacteria 2818
68 Ga0070685_10086432 3300005466 Bacteria 1891
69 Ga0070697_100027349 3300005536 Bacteria 4562
70 Ga0068853_100155557 3300005539 Bacteria 2060
71 Ga0070672_100034060 3300005543 Bacteria 3862
72 Ga0070672_100165879 3300005543 Bacteria 1835
73 Ga0070686_100120175 3300005544 Bacteria 1803
74 Ga0070695_100128362 3300005545 Bacteria 1744
75 Ga0070695_100333978 3300005545 Bacteria 1131
76 Ga0070696_100223673 3300005546 Bacteria 1413
77 Ga0070665_100124598 3300005548 Bacteria 2579
78 Ga0070704_100046174 3300005549 Bacteria 3035
79 Ga0070704_100239356 3300005549 Bacteria 1485
80 Ga0070704_100438880 3300005549 Bacteria 1122
81 Ga0070664_100012425 3300005564 Bacteria 6920
82 Ga0070664_100746139 3300005564 Bacteria 913
83 Ga0070702_100267145 3300005615 Bacteria 1168
84 Ga0068859_100018531 3300005617 Bacteria 6995
85 Ga0068859_100027586 3300005617 Bacteria 5695
86 Ga0068859_100053433 3300005617 Bacteria 4063
87 Ga0068859_100162600 3300005617 Bacteria 2312
88 Ga0068859_100412229 3300005617 Bacteria 1447
89 Ga0068859_100765612 3300005617 Bacteria 1054
90 Ga0068864_100001444 3300005618 Bacteria 19588
91 Ga0068864_100035078 3300005618 Bacteria 4269
92 Ga0068864_100046032 3300005618 Bacteria 3743
93 Ga0068866_10470690 3300005718 Bacteria 826
94 Ga0068861_100140444 3300005719 Bacteria 1971
95 Ga0068861_100945873 3300005719 Bacteria 819
96 Ga0068863_100095896 3300005841 Bacteria 2816
97 Ga0068858_100006313 3300005842 Bacteria 11543
98 Ga0068858_100187211 3300005842 Bacteria 1955
99 Ga0068858_100445159 3300005842 Bacteria 1248
100 Ga0068858_100767461 3300005842 Bacteria 940
101 Ga0068860_100005311 3300005843 Bacteria 13077
102 Ga0068860_100037442 3300005843 Bacteria 4644
103 Ga0068860_100109630 3300005843 Bacteria 2638
104 Ga0068862_100039839 3300005844 Bacteria 3992
105 Ga0081455_10081810 3300005937 Bacteria 2644
106 Ga0075365_10002556 3300006038 Bacteria 8979
107 Ga0075365_10046082 3300006038 Bacteria 2862
108 Ga0075365_10053623 3300006038 Bacteria 2671
109 Ga0075365_10080650 3300006038 Bacteria 2203
110 Ga0075365_10147505 3300006038 Bacteria 1635
111 Ga0075365_10196182 3300006038 Bacteria 1414
112 Ga0075368_10000648 3300006042 Bacteria 10599
113 Ga0075368_10002562 3300006042 Bacteria 5956
114 Ga0075368_10011396 3300006042 Bacteria 3234
115 Ga0075368_10012475 3300006042 Bacteria 3107
116 Ga0075363_100001154 3300006048 Bacteria 9682
117 Ga0075363_100090079 3300006048 Bacteria 1687
118 Ga0075363_100114699 3300006048 Bacteria 1500
119 Ga0075363_100163270 3300006048 Bacteria 1262
120 Ga0075364_10007934 3300006051 Bacteria 6322
121 Ga0075364_10074230 3300006051 Bacteria 2242
122 Ga0075364_10577234 3300006051 Bacteria 768
123 Ga0075362_10222094 3300006177 Bacteria 923
124 Ga0075367_10000455 3300006178 Bacteria 15220
125 Ga0075367_10002682 3300006178 Bacteria 8203
126 Ga0075367_10047574 3300006178 Bacteria 2524
127 Ga0075367_10062489 3300006178 Bacteria 2224
128 Ga0075367_10408439 3300006178 Bacteria 859
129 Ga0075369_10019554 3300006186 Bacteria 2766
130 Ga0075366_10227561 3300006195 Bacteria 1136
131 Ga0075366_10307071 3300006195 Bacteria 971
132 Ga0075366_10392664 3300006195 Bacteria 854
133 Ga0097621_100016730 3300006237 Bacteria 5554
134 Ga0075370_10016547 3300006353 Bacteria 3969
135 Ga0075370_10145381 3300006353 Bacteria 1387
136 Ga0075370_10368905 3300006353 Bacteria 859
137 Ga0068871_100162887 3300006358 Bacteria 1908
138 Ga0075428_100192152 3300006844 Bacteria 2207
139 Ga0075428_100489679 3300006844 Bacteria 1316
140 Ga0075428_100500713 3300006844 Bacteria 1300
141 Ga0075428_100548645 3300006844 Bacteria 1236
142 Ga0075428_101252789 3300006844 Bacteria 781
143 Ga0075430_100007470 3300006846 Bacteria 9226
144 Ga0075430_100050372 3300006846 Bacteria 3512
145 Ga0075431_100019506 3300006847 Bacteria 6914
146 Ga0075431_100047873 3300006847 Bacteria 4409
147 Ga0075431_101201835 3300006847 Bacteria 721
148 Ga0075429_100829521 3300006880 Bacteria 809
149 Ga0068865_100662564 3300006881 Bacteria 888
150 Ga0097620_100018531 3300006931 Bacteria 6995
151 Ga0097620_100027585 3300006931 Bacteria 5695
152 Ga0097620_100053433 3300006931 Bacteria 4063
153 Ga0097620_100162601 3300006931 Bacteria 2312
154 Ga0097620_100412284 3300006931 Bacteria 1447
155 Ga0097620_100765431 3300006931 Bacteria 1054
156 Ga0111539_10001111 3300009094 Bacteria 35523
157 Ga0105245_10664424 3300009098 Bacteria 1073
158 Ga0114129_10097589 3300009147 Bacteria 4068
159 Ga0114129_10316553 3300009147 Bacteria 2075
160 Ga0105242_10032774 3300009176 Bacteria 4156
161 Ga0105248_10002843 3300009177 Bacteria 19207
162 Ga0105248_10036064 3300009177 Bacteria 5531
163 Ga0105248_10617185 3300009177 Bacteria 1223
164 Ga0105249_10142374 3300009553 Bacteria 2301
165 Ga0157326_1002815 3300012513 Bacteria 1840
166 Ga0157378_10021422 3300013297 Bacteria 5684
167 Ga0157378_10153520 3300013297 Bacteria 2147
168 Ga0163162_10012168 3300013306 Bacteria 8399
169 Ga0163162_10269612 3300013306 Bacteria 1834
170 Ga0157375_10026698 3300013308 Bacteria 5387
171 Ga0157375_10050082 3300013308 Bacteria 4096
172 Ga0157375_10687755 3300013308 Bacteria 1177
173 Ga0157375_11495131 3300013308 Bacteria 797
174 Ga0163163_10029785 3300014325 Bacteria 5253
175 Ga0163163_10973319 3300014325 Bacteria 912
176 Ga0163163_11463252 3300014325 Bacteria 745
177 Ga0157380_10249879 3300014326 Bacteria 1605
178 Ga0157380_10302171 3300014326 Bacteria 1475
179 Ga0157380_10317483 3300014326 Bacteria 1443
180 Ga0157376_10003285 3300014969 Bacteria 11132
181 Ga0157376_10004106 3300014969 Bacteria 10081
182 Ga0157376_10048241 3300014969 Bacteria 3520
183 Ga0157376_10252274 3300014969 Bacteria 1649
184 Ga0163161_10105772 3300017792 Bacteria 2099
185 Ga0163161_10137952 3300017792 Bacteria 1845
186 Ga0209435_100008 3300025206 Bacteria 503644
187 Ga0209436_103471 3300025208 Bacteria 4177
188 Ga0207425_1003333 3300025245 Bacteria 5191
189 Ga0207425_1013375 3300025245 Bacteria 1898
190 Ga0207425_1046228 3300025245 Bacteria 811
191 Ga0209646_1000029 3300025246 Bacteria 386414
192 Ga0209026_1000016 3300025250 Bacteria 386457
193 Ga0209759_1000016 3300025256 Bacteria 386414
194 Ga0209129_1013785 3300025258 Bacteria 1757
195 Ga0209565_1000061 3300025263 Bacteria 185308
196 Ga0209565_1021495 3300025263 Bacteria 1349
197 Ga0209565_1023397 3300025263 Bacteria 1269
198 Ga0209673_1000298 3300025273 Bacteria 91771
199 Ga0209673_1063059 3300025273 Bacteria 915
200 Ga0209130_1000014 3300025284 Bacteria 412039
201 Ga0209130_1003007 3300025284 Bacteria 7626
202 Ga0209130_1003748 3300025284 Bacteria 6208
203 Ga0209675_1000105 3300025291 Bacteria 121013
204 Ga0209675_1001283 3300025291 Bacteria 14924
205 Ga0209675_1002286 3300025291 Bacteria 9963
206 Ga0209676_1000013 3300025292 Bacteria 816080
207 Ga0209676_1019045 3300025292 Bacteria 2372
208 Ga0209676_1030119 3300025292 Bacteria 1664
209 Ga0209676_1061773 3300025292 Bacteria 929
210 Ga0209025_1000700 3300025294 Bacteria 57239
211 Ga0209025_1008844 3300025294 Bacteria 7146
212 Ga0209025_1052918 3300025294 Bacteria 1598
213 Ga0209025_1063710 3300025294 Bacteria 1359
214 Ga0209025_1083202 3300025294 Bacteria 1077
215 Ga0209025_1090416 3300025294 Bacteria 1003
216 Ga0209564_1000181 3300025295 Bacteria 151002
217 Ga0209564_1000247 3300025295 Bacteria 116628
218 Ga0209564_1003300 3300025295 Bacteria 11210
219 Ga0209564_1036181 3300025295 Bacteria 1414
220 Ga0209758_1023994 3300025297 Bacteria 2734
221 Ga0209050_1000008 3300025298 Bacteria 1144179
222 Ga0209050_1004736 3300025298 Bacteria 8994
223 Ga0209050_1036977 3300025298 Bacteria 1417
224 Ga0209256_1000039 3300025299 Bacteria 372337
225 Ga0209256_1067271 3300025299 Bacteria 816
226 Ga0207426_1000242 3300025302 Bacteria 122839
227 Ga0207426_1000816 3300025302 Bacteria 33430
228 Ga0209051_1000005 3300025303 Bacteria 1142353
229 Ga0209051_1023427 3300025303 Bacteria 2567
230 Ga0209257_1000031 3300025304 Bacteria 688770
231 Ga0209257_1011729 3300025304 Bacteria 4170
232 Ga0209257_1025872 3300025304 Bacteria 1994
233 Ga0207697_10040562 3300025315 Bacteria 1912
234 Ga0207682_10044643 3300025893 Bacteria 1817
235 Ga0207682_10075900 3300025893 Bacteria 1432
236 Ga0207642_10069616 3300025899 Bacteria 1669
237 Ga0207680_10043745 3300025903 Bacteria 2629
238 Ga0207680_10233849 3300025903 Bacteria 1264
239 Ga0207645_10000039 3300025907 Bacteria 88205
240 Ga0207645_10039237 3300025907 Bacteria 3034
241 Ga0207645_10164622 3300025907 Bacteria 1452
242 Ga0207643_10003232 3300025908 Bacteria 8789
243 Ga0207684_10160113 3300025910 Bacteria 1938
244 Ga0207662_10038489 3300025918 Bacteria 2803
245 Ga0207681_10452875 3300025923 Bacteria 1044
246 Ga0207650_10009171 3300025925 Bacteria 6761
247 Ga0207650_10197524 3300025925 Bacteria 1610
248 Ga0207650_10351728 3300025925 Bacteria 1212
249 Ga0207659_10009990 3300025926 Bacteria 5945
250 Ga0207659_10298539 3300025926 Bacteria 1322
251 Ga0207644_10310742 3300025931 Bacteria 1272
252 Ga0207706_10372575 3300025933 Bacteria 1240
253 Ga0207686_10083199 3300025934 Bacteria 2094
254 Ga0207670_10089184 3300025936 Bacteria 2176
255 Ga0207669_10568834 3300025937 Bacteria 917
256 Ga0207669_10589888 3300025937 Bacteria 902
257 Ga0207704_10076152 3300025938 Bacteria 2149
258 Ga0207691_10000027 3300025940 Bacteria 126502
259 Ga0207691_10023571 3300025940 Bacteria 5795
260 Ga0207691_10142015 3300025940 Bacteria 2115
261 Ga0207711_10016406 3300025941 Bacteria 6157
262 Ga0207711_10255080 3300025941 Bacteria 1611
263 Ga0207711_10313481 3300025941 Bacteria 1448
264 Ga0207689_10004867 3300025942 Bacteria 12104
265 Ga0207679_10261724 3300025945 Bacteria 1476
266 Ga0207651_10017349 3300025960 Bacteria 4251
267 Ga0207651_10038652 3300025960 Bacteria 3139
268 Ga0207651_10102631 3300025960 Bacteria 2126
269 Ga0207651_10442825 3300025960 Bacteria 1113
270 Ga0207651_10655150 3300025960 Bacteria 922
271 Ga0207712_10336477 3300025961 Bacteria 1250
272 Ga0207668_10143839 3300025972 Bacteria 1837
273 Ga0207668_10678101 3300025972 Bacteria 904
274 Ga0207658_10119505 3300025986 Bacteria 2098
275 Ga0207658_10131896 3300025986 Bacteria 2008
276 Ga0207677_10004447 3300026023 Bacteria 7525
277 Ga0207703_10006662 3300026035 Bacteria 9215
278 Ga0207703_10029920 3300026035 Bacteria 4300
279 Ga0207678_10258758 3300026067 Bacteria 1491
280 Ga0207708_10389673 3300026075 Bacteria 1150
281 Ga0207641_10004919 3300026088 Bacteria 11477
282 Ga0207641_10022297 3300026088 Bacteria 5212
283 Ga0207641_10052083 3300026088 Bacteria 3466
284 Ga0207648_10000149 3300026089 Bacteria 70199
285 Ga0207648_10017067 3300026089 Bacteria 6617
286 Ga0207648_10039562 3300026089 Bacteria 4146
287 Ga0207648_10136066 3300026089 Bacteria 2164
288 Ga0207676_10002262 3300026095 Bacteria 13826
289 Ga0207675_100013332 3300026118 Bacteria 7670
290 Ga0207675_100150885 3300026118 Bacteria 2211
291 Ga0207683_10002286 3300026121 Bacteria 16801
292 Ga0207683_10004270 3300026121 Bacteria 12335
293 Ga0207683_10021957 3300026121 Bacteria 5475
294 Ga0207683_10025542 3300026121 Bacteria 5097
295 Ga0207683_10372036 3300026121 Bacteria 1313
296 Ga0209967_1006794 3300027364 Bacteria 1558
297 Ga0209981_1008749 3300027378 Bacteria 1375
298 Ga0209981_1022461 3300027378 Bacteria 904
299 Ga0210000_1014749 3300027462 Bacteria 1172
300 Ga0209995_1018554 3300027471 Bacteria 1147
301 Ga0209968_1006512 3300027526 Bacteria 1759
302 Ga0209983_1003295 3300027665 Bacteria 3467
303 Ga0209983_1022147 3300027665 Bacteria 1330
304 Ga0209971_1002718 3300027682 Bacteria 4227
305 Ga0209966_1003021 3300027695 Bacteria 2823
306 Ga0209998_10019833 3300027717 Unclassified 1435
307 Ga0209813_10000549 3300027866 Bacteria 8860
308 Ga0209813_10002065 3300027866 Bacteria 4564
309 Ga0209813_10022124 3300027866 Bacteria 1795
310 Ga0209974_10002127 3300027876 Bacteria 7248
311 Ga0209974_10010314 3300027876 Bacteria 3152
312 Ga0209974_10135209 3300027876 Bacteria 881
313 Ga0207428_10111327 3300027907 Bacteria 2107
314 Ga0268266_10016374 3300028379 Bacteria 6339
315 Ga0268265_10106900 3300028380 Bacteria 2274
316 Ga0268264_10011913 3300028381 Bacteria 7163
317 Ga0268264_10052261 3300028381 Bacteria 3407
318 Ga0307513_10000025 3300031456 Bacteria 202918
319 Ga0307513_10000219 3300031456 Bacteria 82663
320 Ga0307408_100001296 3300031548 Bacteria 18710
321 Ga0307408_100031806 3300031548 Bacteria 3676
322 Ga0307408_100487376 3300031548 Bacteria 1077
323 Ga0307516_10250116 3300031730 Bacteria 1467
324 Ga0307516_10408258 3300031730 Bacteria 1017
325 Ga0307405_10131572 3300031731 Bacteria 1730
326 Ga0307405_10326199 3300031731 Bacteria 1175
327 Ga0307410_10904193 3300031852 Bacteria 756
328 Ga0307406_10014417 3300031901 Bacteria 4548
329 Ga0307412_10053930 3300031911 Bacteria 2667
330 Ga0307412_10853789 3300031911 Bacteria 794
331 Ga0307412_10985980 3300031911 Bacteria 744
332 Ga0307416_100115378 3300032002 Bacteria 2378
333 Ga0307416_100641502 3300032002 Bacteria 1146
334 Ga0307416_100877407 3300032002 Bacteria 996
335 Ga0307414_10758602 3300032004 Bacteria 882
336 Ga0307411_10221459 3300032005 Bacteria 1468
337 Ga0307411_10490115 3300032005 Bacteria 1037
338 Ga0307411_10636887 3300032005 Bacteria 921
339 Ga0373945_0147841 3300035116 Bacteria 951
340 Ga0373943_0135933 3300035170 Bacteria 1320
341 Ga0316574_0147280 3300035398 Bacteria 1518
342 Ga0373931_0137303 3300035691 Bacteria 1413
343 Ga0373935_0194888 3300035692 Bacteria 1397
344 Ga0373927_0168605 3300035695 Bacteria 1435
345 Ga0373937_0106028 3300036401 Bacteria 2612
346 Ga0373925_0075364 3300037068 Bacteria 2556
347 Ga0400487_18608 3300039110 Unclassified 1754
348 Ga0439436_0092065 3300041404 Bacteria 844
349 Ga0439439_0006433 3300041406 Bacteria 2717
350 Ga0439453_0020999 3300041408 Bacteria 1174
351 Ga0439466_0006070 3300041411 Bacteria 4600
352 Ga0439465_0030470 3300041413 Bacteria 1716
353 Ga0451791_1055704 3300041451 Bacteria 1264
354 Ga0451795_1209481 3300041456 Bacteria 925
355 Ga0451807_0421197 3300041486 Bacteria 694
356 Ga0451807_2757515 3300041486 Bacteria 1217
357 Ga0439433_0001762 3300041999 Bacteria 4497
358 Ga0439441_002101 3300042001 Bacteria 2748
359 Ga0439441_011604 3300042001 Bacteria 1497
360 Ga0439443_003003 3300042003 Bacteria 2083
361 Ga0439432_002650 3300042006 Bacteria 6701
362 Ga0439449_0061217 3300042007 Bacteria 1388
363 Ga0439452_016752 3300042010 Bacteria 1984
364 Ga0439446_0013447 3300042156 Bacteria 2246
365 Ga0450909_027396 3300042185 Bacteria 860
366 Ga0439434_0017493 3300042435 Bacteria 2145
367 Ga0439434_0040313 3300042435 Bacteria 1434
368 Ga0439435_0001172 3300042436 Bacteria 4712
369 Ga0439435_0004704 3300042436 Bacteria 2957
370 Ga0439444_0011858 3300042437 Bacteria 1419
371 Ga0439460_0002022 3300042461 Bacteria 4861
372 Ga0439460_0002976 3300042461 Bacteria 4086
373 Ga0495638_0000537 3300046460 Bacteria 43749
374 Ga0495638_0138506 3300046460 Bacteria 1423
375 Ga0495606_0336987 3300046507 Bacteria 805
376 Ga0495616_0061701 3300046513 Bacteria 1838
377 Ga0495643_0164804 3300046522 Bacteria 1088
378 Ga0495654_0132723 3300046530 Bacteria 1116
379 Ga0495621_0015339 3300046539 Bacteria 2442
380 Ga0495621_0094750 3300046539 Bacteria 1129
381 Ga0495656_0000171 3300046615 Bacteria 22920
382 Ga0495659_0066121 3300046664 Bacteria 1346
383 Ga0495661_0020840 3300046665 Bacteria 4274
384 Ga0495671_0022764 3300046692 Bacteria 3279
385 Ga0495615_0032298 3300048090 Bacteria 1261
386 Ga0496104_0005000 3300048907 Bacteria 11568
387 Ga0496108_0008177 3300048911 Bacteria 8487
388 Ga0496109_0021121 3300048912 Bacteria 5756
389 Ga0496110_0008905 3300048913 Bacteria 8091
390 Ga0496110_0104435 3300048913 Bacteria 2542
391 Ga0496111_0015258 3300048914 Bacteria 5269
392 Ga0496112_0011242 3300048915 Bacteria 8166
393 Ga0496113_0061147 3300048916 Bacteria 2841
394 Ga0496114_0696949 3300048917 Bacteria 891
395 Ga0496116_0000456 3300048919 Bacteria 56621
396 Ga0496117_0093358 3300048920 Bacteria 1930
397 Ga0496117_0114056 3300048920 Bacteria 1676
398 Ga0496118_0068963 3300048921 Bacteria 2564
399 Ga0496120_0014968 3300048923 Bacteria 5138
400 Ga0496121_0003836 3300048924 Bacteria 20915
401 Ga0496121_0010172 3300048924 Bacteria 10651
402 Ga0496122_0149301 3300048925 Bacteria 1446
403 Ga0496125_0001075 3300048928 Bacteria 42073
404 Ga0496126_0108193 3300048929 Bacteria 2424
405 Ga0501298_033347 3300049521 Bacteria 1020
406 Ga0501034_0111533 3300049571 Bacteria 2726
407 Ga0501036_0039628 3300049572 Bacteria 3987
408 Ga0501036_0110580 3300049572 Bacteria 2322
409 Ga0501037_0097613 3300049573 Bacteria 2123
410 Ga0501039_0027324 3300049575 Bacteria 4388
411 Ga0501039_0356222 3300049575 Bacteria 1150
412 Ga0501040_0027530 3300049576 Bacteria 3828
413 Ga0501040_0381074 3300049576 Bacteria 1012
414 Ga0501041_0070471 3300049577 Bacteria 2146
415 Ga0501042_0427943 3300049578 Bacteria 959
416 Ga0501048_0142595 3300049582 Bacteria 1694
417 Ga0501048_0223162 3300049582 Bacteria 1337
418 Ga0501068_0645337 3300049584 Bacteria 691
419 Ga0501071_0000191 3300049587 Bacteria 27590
420 Ga0501072_0015328 3300049588 Bacteria 5879
421 Ga0501072_0074729 3300049588 Bacteria 2680
422 Ga0501072_0177287 3300049588 Bacteria 1700
423 Ga0501073_0100147 3300049589 Bacteria 2012
424 Ga0501073_0144696 3300049589 Bacteria 1647
425 Ga0501074_0059831 3300049590 Bacteria 2744
426 Ga0501075_0022290 3300049591 Bacteria 4625
427 Ga0501075_0025141 3300049591 Bacteria 4374
428 Ga0501076_0051183 3300049592 Bacteria 3269
429 Ga0501076_0219119 3300049592 Bacteria 1556
430 Ga0501076_0265926 3300049592 Bacteria 1404
431 Ga0501077_0014231 3300049593 Bacteria 4995
432 Ga0501077_0129950 3300049593 Bacteria 1597
433 Ga0501079_0017793 3300049741 Bacteria 5431
434 Ga0501079_0043496 3300049741 Bacteria 3467
435 Ga0501079_0129499 3300049741 Bacteria 1963
436 Ga0501079_0757334 3300049741 Bacteria 764
437 Ga0501080_0001849 3300049742 Bacteria 18173
438 Ga0501080_0037825 3300049742 Bacteria 4506
439 Ga0501080_0179721 3300049742 Bacteria 1948
440 Ga0501080_0322280 3300049742 Bacteria 1399
441 Ga0501081_0002438 3300049743 Bacteria 11741
442 Ga0501081_0003114 3300049743 Bacteria 10535
443 Ga0501283_009799 3300049779 Bacteria 1402
444 Ga0501045_0021545 3300049824 Bacteria 4611
445 nmdc:mga03683_239350_c1 3300050489 Bacteria 841
446 nmdc:mga03n38_283725_c1 3300050490 Bacteria 885
447 nmdc:mga03n38_433941_c1 3300050490 Bacteria 728
448 nmdc:mga03n38_45671_c1 3300050490 Bacteria 1930
449 nmdc:mga03n38_48544_c1 3300050490 Bacteria 1883
450 nmdc:mga03n38_736_c1 3300050490 Bacteria 8647
451 nmdc:mga00v17_248792_c1 3300050491 Bacteria 1153
452 nmdc:mga00v17_28525_c1 3300050491 Bacteria 3269
453 nmdc:mga00v17_663_c1 3300050491 Bacteria 18944
454 nmdc:mga0yw44_20509_c1 3300050492 Bacteria 3669
455 nmdc:mga0yw44_36311_c1 3300050492 Bacteria 2903
456 nmdc:mga0yw44_38506_c1 3300050492 Bacteria 2830
457 nmdc:mga0yw44_418101_c1 3300050492 Bacteria 907
458 nmdc:mga0k408_267892_c1 3300050493 Bacteria 1020
459 nmdc:mga0k408_477881_c1 3300050493 Bacteria 739
460 nmdc:mga06z11_268854_c1 3300050494 Bacteria 1008
461 nmdc:mga06z11_424_c1 3300050494 Bacteria 15838
462 nmdc:mga06z11_4782_c1 3300050494 Bacteria 5357
463 nmdc:mga06z11_7466_c1 3300050494 Bacteria 4500
464 nmdc:mga04h51_2234_c1 3300050495 Bacteria 4564
465 nmdc:mga04h51_579_c1 3300050495 Bacteria 8733
466 nmdc:mga07m45_371769_c1 3300050496 Bacteria 830
467 nmdc:mga07m45_81187_c1 3300050496 Bacteria 1851
468 nmdc:mga05p37_245393_c1 3300050507 Bacteria 2150
469 nmdc:mga05p37_619246_c1 3300050507 Bacteria 1218
470 nmdc:mga09592_222403_c1 3300050508 Bacteria 1635
471 nmdc:mga0qj67_20012_c1 3300050509 Bacteria 5121
472 nmdc:mga0qj67_2592_c1 3300050509 Bacteria 12941
473 nmdc:mga06r32_122860_c1 3300050510 Bacteria 2562
474 nmdc:mga06r32_53619_c1 3300050510 Bacteria 3863
475 nmdc:mga0sz30_43180_c1 3300050516 Bacteria 1897
476 Ga0500644_0143010 3300053088 Bacteria 952
477 Ga0500646_0000553 3300053090 Bacteria 10805
478 Ga0500583_0001275 3300053092 Bacteria 7190
479 Ga0500583_0270198 3300053092 Bacteria 836
480 Ga0500651_0004248 3300053093 Bacteria 8000
481 Ga0500566_0119178 3300053094 Bacteria 1425
482 Ga0500641_0053891 3300053096 Bacteria 1662
483 Ga0500650_0073686 3300053098 Bacteria 1596
484 Ga0500558_191368 3300053106 Bacteria 721
485 Ga0500562_010410 3300053108 Bacteria 2356
486 Ga0500592_000863 3300053116 Bacteria 4937
487 Ga0500593_007975 3300053117 Bacteria 4334
488 Ga0500593_027116 3300053117 Bacteria 2555
489 Ga0500594_0014448 3300053118 Bacteria 1890
490 Ga0500595_001615 3300053119 Bacteria 11872
491 Ga0500595_013762 3300053119 Bacteria 3093
492 Ga0500642_0000005 3300053130 Bacteria 422725
493 Ga0500642_0004587 3300053130 Bacteria 4348
494 Ga0500658_0204946 3300053134 Bacteria 902
495 Ga0500568_0000940 3300053139 Bacteria 20068
496 Ga0500577_0030903 3300053142 Bacteria 1869
497 Ga0500588_0140818 3300053146 Bacteria 866
498 Ga0500604_0000592 3300053151 Bacteria 9938
499 Ga0500604_0001329 3300053151 Bacteria 6877
500 Ga0500604_0046342 3300053151 Bacteria 1330
501 Ga0500616_0075908 3300053153 Bacteria 1700
502 Ga0500622_0000801 3300053156 Bacteria 27022
503 Ga0500622_0039472 3300053156 Bacteria 2461
504 Ga0500622_0095761 3300053156 Bacteria 1468
505 Ga0500645_026807 3300053730 Bacteria 1751
506 Ga0501084_0008621 3300054114 Bacteria 8429
507 Ga0501084_0136915 3300054114 Bacteria 2061
508 Ga0501084_0276500 3300054114 Bacteria 1418
509 Ga0590077_040488 3300059426 Bacteria 1034
510 Ga0501082_0008128 3300060353 Bacteria 9053
511 Ga0501082_0077074 3300060353 Bacteria 2874
512 Ga0501082_0198395 3300060353 Bacteria 1746
513 Ga0530510_0004493 3300061734 Bacteria 9653
514 2511246581 2511231002 Bacteria 5042903
515 2603860332 2602042107 Bacteria 6226103
516 2644744868 2643221736 Bacteria 6608466
517 2739244081 2738543012 Bacteria 7115078
518 2739252127 2738543013 Bacteria 5618633
519 2816472406 2816332133 Bacteria 7249298
520 2844104214 2844104063 Bacteria 6440972
521 2851247202 2851246043 Bacteria 6439203
522 8054567308 8054563764 Bacteria 5592885
523 Ga0070667_100392579
524 RicEn_FSXC84216_b1
525 JGI25155J39150_1000009
526 JGI25156J39149_1000009
527 JGI25154J39366_1000024
528 JGI25157J39369_1000007
529 JGI25150J39212_1006533
530 JGI25151J46595_10015329
531 JGI25151J46595_10082734
532 JGI25161J50226_1000009
533 Ga0055526_1001087
534 Ga0055526_1006267
535 Ga0055537_1000020
536 Ga0055524_1000047
537 Ga0055534_1002308
538 Ga0055534_1009229
539 Ga0055528_1008379
540 Ga0055540_1000027
541 Ga0055531_10022119
542 Ga0055543_1000199
543 Ga0065165_1007480
544 Ga0065165_1011520
545 Ga0065165_1016890
546 Ga0070676_10002086
547 Ga0070676_10202751
548 Ga0070683_100091671
549 Ga0070690_100026013
550 Ga0070690_100026135
551 Ga0070690_100049795
552 Ga0070670_100010516
553 Ga0070670_100028336
554 Ga0070670_100176210
555 Ga0068869_100035954
556 Ga0070666_10028269
557 Ga0070666_10137284
558 Ga0068868_100029831
559 Ga0070689_100802431
560 Ga0070661_100170268
561 Ga0070668_100090835
562 Ga0070668_100201351
563 Ga0070668_100744820
564 Ga0070668_100815221
565 Ga0070669_100089783
566 Ga0070675_100000422
567 Ga0070675_100006740
568 Ga0070671_100006469
569 Ga0070671_100156672
570 Ga0070674_100015653
571 Ga0070673_100001471
572 Ga0070673_100045357
573 Ga0070673_100106383
574 Ga0070673_100116975
575 Ga0070673_100343050
576 Ga0070688_100046517
577 Ga0070667_100007971
578 Ga0070667_100031036
579 Ga0070705_100181830
580 Ga0070705_100554015
581 Ga0070700_100556673
582 Ga0070663_100172237
583 Ga0070678_100000948
584 Ga0070678_100011250
585 Ga0070678_100017620
586 Ga0070678_100083273
587 Ga0068867_100033545
588 Ga0068867_100239920
589 Ga0070685_10035351
590 Ga0070685_10086432
591 Ga0070697_100027349
592 Ga0068853_100155557
593 Ga0070672_100034060
594 Ga0070672_100165879
595 Ga0070686_100120175
596 Ga0070695_100128362
597 Ga0070695_100333978
598 Ga0070696_100223673
599 Ga0070665_100124598
600 Ga0070704_100046174
601 Ga0070704_100239356
602 Ga0070704_100438880
603 Ga0070664_100012425
604 Ga0070664_100746139
605 Ga0070702_100267145
606 Ga0068859_100018531
607 Ga0068859_100027586
608 Ga0068859_100053433
609 Ga0068859_100162600
610 Ga0068859_100412229
611 Ga0068859_100765612
612 Ga0068864_100001444
613 Ga0068864_100035078
614 Ga0068864_100046032
615 Ga0068866_10470690
616 Ga0068861_100140444
617 Ga0068861_100945873
618 Ga0068863_100095896
619 Ga0068858_100006313
620 Ga0068858_100187211
621 Ga0068858_100445159
622 Ga0068858_100767461
623 Ga0068860_100005311
624 Ga0068860_100037442
625 Ga0068860_100109630
626 Ga0068862_100039839
627 Ga0081455_10081810
628 Ga0075365_10002556
629 Ga0075365_10046082
630 Ga0075365_10053623
631 Ga0075365_10080650
632 Ga0075365_10147505
633 Ga0075365_10196182
634 Ga0075368_10000648
635 Ga0075368_10002562
636 Ga0075368_10011396
637 Ga0075368_10012475
638 Ga0075363_100001154
639 Ga0075363_100090079
640 Ga0075363_100114699
641 Ga0075363_100163270
642 Ga0075364_10007934
643 Ga0075364_10074230
644 Ga0075364_10577234
645 Ga0075362_10222094
646 Ga0075367_10000455
647 Ga0075367_10002682
648 Ga0075367_10047574
649 Ga0075367_10062489
650 Ga0075367_10408439
651 Ga0075369_10019554
652 Ga0075366_10227561
653 Ga0075366_10307071
654 Ga0075366_10392664
655 Ga0097621_100016730
656 Ga0075370_10016547
657 Ga0075370_10145381
658 Ga0075370_10368905
659 Ga0068871_100162887
660 Ga0075428_100192152
661 Ga0075428_100489679
662 Ga0075428_100500713
663 Ga0075428_100548645
664 Ga0075428_101252789
665 Ga0075430_100007470
666 Ga0075430_100050372
667 Ga0075431_100019506
668 Ga0075431_100047873
669 Ga0075431_101201835
670 Ga0075429_100829521
671 Ga0068865_100662564
672 Ga0097620_100018531
673 Ga0097620_100027585
674 Ga0097620_100053433
675 Ga0097620_100162601
676 Ga0097620_100412284
677 Ga0097620_100765431
678 Ga0111539_10001111
679 Ga0105245_10664424
680 Ga0114129_10097589
681 Ga0114129_10316553
682 Ga0105242_10032774
683 Ga0105248_10002843
684 Ga0105248_10036064
685 Ga0105248_10617185
686 Ga0105249_10142374
687 Ga0157326_1002815
688 Ga0157378_10021422
689 Ga0157378_10153520
690 Ga0163162_10012168
691 Ga0163162_10269612
692 Ga0157375_10026698
693 Ga0157375_10050082
694 Ga0157375_10687755
695 Ga0157375_11495131
696 Ga0163163_10029785
697 Ga0163163_10973319
698 Ga0163163_11463252
699 Ga0157380_10249879
700 Ga0157380_10302171
701 Ga0157380_10317483
702 Ga0157376_10003285
703 Ga0157376_10004106
704 Ga0157376_10048241
705 Ga0157376_10252274
706 Ga0163161_10105772
707 Ga0163161_10137952
708 Ga0209435_100008
709 Ga0209436_103471
710 Ga0207425_1003333
711 Ga0207425_1013375
712 Ga0207425_1046228
713 Ga0209646_1000029
714 Ga0209026_1000016
715 Ga0209759_1000016
716 Ga0209129_1013785
717 Ga0209565_1000061
718 Ga0209565_1021495
719 Ga0209565_1023397
720 Ga0209673_1000298
721 Ga0209673_1063059
722 Ga0209130_1000014
723 Ga0209130_1003007
724 Ga0209130_1003748
725 Ga0209675_1000105
726 Ga0209675_1001283
727 Ga0209675_1002286
728 Ga0209676_1000013
729 Ga0209676_1019045
730 Ga0209676_1030119
731 Ga0209676_1061773
732 Ga0209025_1000700
733 Ga0209025_1008844
734 Ga0209025_1052918
735 Ga0209025_1063710
736 Ga0209025_1083202
737 Ga0209025_1090416
738 Ga0209564_1000181
739 Ga0209564_1000247
740 Ga0209564_1003300
741 Ga0209564_1036181
742 Ga0209758_1023994
743 Ga0209050_1000008
744 Ga0209050_1004736
745 Ga0209050_1036977
746 Ga0209256_1000039
747 Ga0209256_1067271
748 Ga0207426_1000242
749 Ga0207426_1000816
750 Ga0209051_1000005
751 Ga0209051_1023427
752 Ga0209257_1000031
753 Ga0209257_1011729
754 Ga0209257_1025872
755 Ga0207697_10040562
756 Ga0207682_10044643
757 Ga0207682_10075900
758 Ga0207642_10069616
759 Ga0207680_10043745
760 Ga0207680_10233849
761 Ga0207645_10000039
762 Ga0207645_10039237
763 Ga0207645_10164622
764 Ga0207643_10003232
765 Ga0207684_10160113
766 Ga0207662_10038489
767 Ga0207681_10452875
768 Ga0207650_10009171
769 Ga0207650_10197524
770 Ga0207650_10351728
771 Ga0207659_10009990
772 Ga0207659_10298539
773 Ga0207644_10310742
774 Ga0207706_10372575
775 Ga0207686_10083199
776 Ga0207670_10089184
777 Ga0207669_10568834
778 Ga0207669_10589888
779 Ga0207704_10076152
780 Ga0207691_10000027
781 Ga0207691_10023571
782 Ga0207691_10142015
783 Ga0207711_10016406
784 Ga0207711_10255080
785 Ga0207711_10313481
786 Ga0207689_10004867
787 Ga0207679_10261724
788 Ga0207651_10017349
789 Ga0207651_10038652
790 Ga0207651_10102631
791 Ga0207651_10442825
792 Ga0207651_10655150
793 Ga0207712_10336477
794 Ga0207668_10143839
795 Ga0207668_10678101
796 Ga0207658_10119505
797 Ga0207658_10131896
798 Ga0207677_10004447
799 Ga0207703_10006662
800 Ga0207703_10029920
801 Ga0207678_10258758
802 Ga0207708_10389673
803 Ga0207641_10004919
804 Ga0207641_10022297
805 Ga0207641_10052083
806 Ga0207648_10000149
807 Ga0207648_10017067
808 Ga0207648_10039562
809 Ga0207648_10136066
810 Ga0207676_10002262
811 Ga0207675_100013332
812 Ga0207675_100150885
813 Ga0207683_10002286
814 Ga0207683_10004270
815 Ga0207683_10021957
816 Ga0207683_10025542
817 Ga0207683_10372036
818 Ga0209967_1006794
819 Ga0209981_1008749
820 Ga0209981_1022461
821 Ga0210000_1014749
822 Ga0209995_1018554
823 Ga0209968_1006512
824 Ga0209983_1003295
825 Ga0209983_1022147
826 Ga0209971_1002718
827 Ga0209966_1003021
828 Ga0209998_10019833
829 Ga0209813_10000549
830 Ga0209813_10002065
831 Ga0209813_10022124
832 Ga0209974_10002127
833 Ga0209974_10010314
834 Ga0209974_10135209
835 Ga0207428_10111327
836 Ga0268266_10016374
837 Ga0268265_10106900
838 Ga0268264_10011913
839 Ga0268264_10052261
840 Ga0307513_10000025
841 Ga0307513_10000219
842 Ga0307408_100001296
843 Ga0307408_100031806
844 Ga0307408_100487376
845 Ga0307516_10250116
846 Ga0307516_10408258
847 Ga0307405_10131572
848 Ga0307405_10326199
849 Ga0307410_10904193
850 Ga0307406_10014417
851 Ga0307412_10053930
852 Ga0307412_10853789
853 Ga0307412_10985980
854 Ga0307416_100115378
855 Ga0307416_100641502
856 Ga0307416_100877407
857 Ga0307414_10758602
858 Ga0307411_10221459
859 Ga0307411_10490115
860 Ga0307411_10636887
861 Ga0373945_0147841
862 Ga0373943_0135933
863 Ga0316574_0147280
864 Ga0373931_0137303
865 Ga0373935_0194888
866 Ga0373927_0168605
867 Ga0373937_0106028
868 Ga0373925_0075364
869 Ga0400487_18608
870 Ga0439436_0092065
871 Ga0439439_0006433
872 Ga0439453_0020999
873 Ga0439466_0006070
874 Ga0439465_0030470
875 Ga0451791_1055704
876 Ga0451795_1209481
877 Ga0451807_0421197
878 Ga0451807_2757515
879 Ga0439433_0001762
880 Ga0439441_002101
881 Ga0439441_011604
882 Ga0439443_003003
883 Ga0439432_002650
884 Ga0439449_0061217
885 Ga0439452_016752
886 Ga0439446_0013447
887 Ga0450909_027396
888 Ga0439434_0017493
889 Ga0439434_0040313
890 Ga0439435_0001172
891 Ga0439435_0004704
892 Ga0439444_0011858
893 Ga0439460_0002022
894 Ga0439460_0002976
895 Ga0495638_0000537
896 Ga0495638_0138506
897 Ga0495606_0336987
898 Ga0495616_0061701
899 Ga0495643_0164804
900 Ga0495654_0132723
901 Ga0495621_0015339
902 Ga0495621_0094750
903 Ga0495656_0000171
904 Ga0495659_0066121
905 Ga0495661_0020840
906 Ga0495671_0022764
907 Ga0495615_0032298
908 Ga0496104_0005000
909 Ga0496108_0008177
910 Ga0496109_0021121
911 Ga0496110_0008905
912 Ga0496110_0104435
913 Ga0496111_0015258
914 Ga0496112_0011242
915 Ga0496113_0061147
916 Ga0496114_0696949
917 Ga0496116_0000456
918 Ga0496117_0093358
919 Ga0496117_0114056
920 Ga0496118_0068963
921 Ga0496120_0014968
922 Ga0496121_0003836
923 Ga0496121_0010172
924 Ga0496122_0149301
925 Ga0496125_0001075
926 Ga0496126_0108193
927 Ga0501298_033347
928 Ga0501034_0111533
929 Ga0501036_0039628
930 Ga0501036_0110580
931 Ga0501037_0097613
932 Ga0501039_0027324
933 Ga0501039_0356222
934 Ga0501040_0027530
935 Ga0501040_0381074
936 Ga0501041_0070471
937 Ga0501042_0427943
938 Ga0501048_0142595
939 Ga0501048_0223162
940 Ga0501068_0645337
941 Ga0501071_0000191
942 Ga0501072_0015328
943 Ga0501072_0074729
944 Ga0501072_0177287
945 Ga0501073_0100147
946 Ga0501073_0144696
947 Ga0501074_0059831
948 Ga0501075_0022290
949 Ga0501075_0025141
950 Ga0501076_0051183
951 Ga0501076_0219119
952 Ga0501076_0265926
953 Ga0501077_0014231
954 Ga0501077_0129950
955 Ga0501079_0017793
956 Ga0501079_0043496
957 Ga0501079_0129499
958 Ga0501079_0757334
959 Ga0501080_0001849
960 Ga0501080_0037825
961 Ga0501080_0179721
962 Ga0501080_0322280
963 Ga0501081_0002438
964 Ga0501081_0003114
965 Ga0501283_009799
966 Ga0501045_0021545
967 nmdc:mga03683_239350_c1
968 nmdc:mga03n38_283725_c1
969 nmdc:mga03n38_433941_c1
970 nmdc:mga03n38_45671_c1
971 nmdc:mga03n38_48544_c1
972 nmdc:mga03n38_736_c1
973 nmdc:mga00v17_248792_c1
974 nmdc:mga00v17_28525_c1
975 nmdc:mga00v17_663_c1
976 nmdc:mga0yw44_20509_c1
977 nmdc:mga0yw44_36311_c1
978 nmdc:mga0yw44_38506_c1
979 nmdc:mga0yw44_418101_c1
980 nmdc:mga0k408_267892_c1
981 nmdc:mga0k408_477881_c1
982 nmdc:mga06z11_268854_c1
983 nmdc:mga06z11_424_c1
984 nmdc:mga06z11_4782_c1
985 nmdc:mga06z11_7466_c1
986 nmdc:mga04h51_2234_c1
987 nmdc:mga04h51_579_c1
988 nmdc:mga07m45_371769_c1
989 nmdc:mga07m45_81187_c1
990 nmdc:mga05p37_245393_c1
991 nmdc:mga05p37_619246_c1
992 nmdc:mga09592_222403_c1
993 nmdc:mga0qj67_20012_c1
994 nmdc:mga0qj67_2592_c1
995 nmdc:mga06r32_122860_c1
996 nmdc:mga06r32_53619_c1
997 nmdc:mga0sz30_43180_c1
998 Ga0500644_0143010
999 Ga0500646_0000553
1000 Ga0500583_0001275
1001 Ga0500583_0270198
1002 Ga0500651_0004248
1003 Ga0500566_0119178
1004 Ga0500641_0053891
1005 Ga0500650_0073686
1006 Ga0500558_191368
1007 Ga0500562_010410
1008 Ga0500592_000863
1009 Ga0500593_007975
1010 Ga0500593_027116
1011 Ga0500594_0014448
1012 Ga0500595_001615
1013 Ga0500595_013762
1014 Ga0500642_0000005
1015 Ga0500642_0004587
1016 Ga0500658_0204946
1017 Ga0500568_0000940
1018 Ga0500577_0030903
1019 Ga0500588_0140818
1020 Ga0500604_0000592
1021 Ga0500604_0001329
1022 Ga0500604_0046342
1023 Ga0500616_0075908
1024 Ga0500622_0000801
1025 Ga0500622_0039472
1026 Ga0500622_0095761
1027 Ga0500645_026807
1028 Ga0501084_0008621
1029 Ga0501084_0136915
1030 Ga0501084_0276500
1031 Ga0590077_040488
1032 Ga0501082_0008128
1033 Ga0501082_0077074
1034 Ga0501082_0198395
1035 Ga0530510_0004493
1036 2511246581
1037 2603860332
1038 2644744868
1039 2739244081
1040 2739252127
1041 2816472406
1042 2844104214
1043 2851247202
1044 8054567308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

59

161

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.7521 7 184
6jbj-assembly1.cif.gz_B cryo-em structure of human lysosomal cobalamin exporter abcd4 0.7311 1 71
7tbw-assembly1.cif.gz_A the structure of atp-bound abca1 0.7128 2 175
2ix8-assembly1.cif.gz_A model for eef3 bound to an 80s ribosome 0.7127 1 71
7sh1-assembly1.cif.gz_B-2 class ii uvra protein - ecm16 0.711 119 175
ID Description Score Start End Superfamily
af_Q86B52_426_676_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8212 1 77 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.811 7 77 3.40.50.300
af_A0A0R0IY12_408_566_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7824 2 77 3.40.50.300
af_A0A0P0VBQ7_902_1031_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7813 2 77 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7524 7 186 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1E4CWS3-F1-model_v4 ABC transporter domain-containing protein 0.9701 2 187 GO:0005524
GO:0005886
GO:0016887
AF-A0A846UC79-F1-model_v4 ABC-type Na+ transport system ATPase subunit NatA 0.954 3 187 GO:0005524
GO:0016887
AF-A0A1F4JRG8-F1-model_v4 ABC transporter domain-containing protein 0.9331 1 175 GO:0005524
GO:0016887
AF-A0A1E4CWS3-F1-model_v4 ABC transporter domain-containing protein 0.9302 2 187 GO:0005524
GO:0005886
GO:0016887
AF-A0A2A4U775-F1-model_v4 Uncharacterized protein 0.9289 67 182

Map