F458665

General Info

Members Datasets Scaffolds Average Seq Length
521 259 1042 337

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100171788|Ga0070706_1001717882
Length 410
Sequence VSLTDKFGRSIADLRISITDRCNYKCVYCRTGNEGALYGELPFEDYLRMARILVGMGITKIRLTGGEPLLRRGIVDFVRELAKLKPQGLKSRSSEVPIGTGEAVPFQSLSTGEIFQNSAMSGRELDDRAHTQNAVNASSAGAAELSPGRKRWVGSQFLSSPIGTAQEEAGYPLDLAITTNGHLLADMAQPLKDAGLNRITVSMDAVDPERFARITRVRGGFDRVLAGTRAARRAGLWPLKVNCVLMRGFNEDQIIPFGMFAREEGVIVRFIEFMPLEEDRVWAPSTVVRLDEILERMAEYRPLMEIPRARSETARRYRFDDGIGEIGIIAPVSHPFCGHCSRIRITSDGKIRTCLFSAWDHDLHELMRRGASDDELAEFIRGVVQRKEERHHIGEADFVPASRTMVHIGG

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
174 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
175 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
248 2643221549 Agromyces sp. Root1464 Isolate Unclassified
249 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
250 2687453737 Frankia sp. BMG5.36 Isolate Nodule
251 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
252 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
253 2919395869 Microbacterium resistens 2980 Isolate Unclassified
254 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
255 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
256 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
257 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
258 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
259 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.5
Metatranscriptomes 0.19
Isolates 2.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0.19
Rhizoplane 4.8
Rhizosphere 93.86
Stem 0
Stem Tuber 0
Unclassified 9.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100171788 3300005467 Bacteria 2024
2 MRS1b_contig_8036739 2162886011 Unclassified 1385
3 LJNas_1001086 3300000546 Bacteria 4225
4 Ga0065714_10022930 3300005288 Bacteria 2033
5 Ga0065712_10102223 3300005290 Bacteria 2014
6 Ga0065712_10146520 3300005290 Unclassified 1404
7 Ga0070676_10020696 3300005328 Bacteria 3677
8 Ga0070683_100047483 3300005329 Unclassified 3967
9 Ga0070690_100237387 3300005330 Bacteria 1284
10 Ga0070690_100368664 3300005330 Bacteria 1047
11 Ga0070670_100041015 3300005331 Unclassified 3978
12 Ga0068869_100002638 3300005334 Bacteria 10837
13 Ga0068869_100010377 3300005334 Bacteria 6074
14 Ga0070680_100032355 3300005336 Bacteria 4210
15 Ga0068868_100001549 3300005338 Bacteria 15707
16 Ga0068868_100002974 3300005338 Bacteria 11766
17 Ga0068868_100009306 3300005338 Bacteria 7063
18 Ga0068868_100041709 3300005338 Bacteria 3577
19 Ga0070689_100180151 3300005340 Bacteria 1716
20 Ga0070661_100024001 3300005344 Unclassified 4375
21 Ga0070668_100003009 3300005347 Bacteria 12460
22 Ga0070673_100036920 3300005364 Bacteria 3719
23 Ga0070673_100171672 3300005364 Bacteria 1851
24 Ga0070667_100055099 3300005367 Bacteria 3358
25 Ga0070709_10014535 3300005434 Bacteria 4453
26 Ga0070714_100000183 3300005435 Bacteria 49970
27 Ga0070713_100013761 3300005436 Bacteria 5984
28 Ga0070713_100014383 3300005436 Bacteria 5876
29 Ga0070713_100019701 3300005436 Bacteria 5159
30 Ga0070713_100028513 3300005436 Bacteria 4409
31 Ga0070713_100109749 3300005436 Unclassified 2404
32 Ga0070710_10020114 3300005437 Bacteria 3459
33 Ga0070710_10059703 3300005437 Bacteria 2167
34 Ga0070711_100001220 3300005439 Bacteria 13868
35 Ga0070711_100075071 3300005439 Bacteria 2393
36 Ga0070705_100080528 3300005440 Bacteria 1998
37 Ga0070708_100050193 3300005445 Bacteria 3693
38 Ga0070662_100015549 3300005457 Bacteria 5100
39 Ga0070662_100025038 3300005457 Unclassified 4118
40 Ga0070681_10000692 3300005458 Bacteria 27984
41 Ga0070681_10010622 3300005458 Bacteria 9099
42 Ga0070681_10046007 3300005458 Bacteria 4364
43 Ga0070681_10095896 3300005458 Bacteria 2915
44 Ga0070681_10106362 3300005458 Bacteria 2747
45 Ga0070681_10300678 3300005458 Bacteria 1514
46 Ga0068867_100026405 3300005459 Bacteria 4170
47 Ga0068867_100147563 3300005459 Unclassified 1845
48 Ga0068867_100180868 3300005459 Bacteria 1676
49 Ga0070706_100000381 3300005467 Bacteria 53192
50 Ga0070706_100006382 3300005467 Bacteria 11139
51 Ga0070706_100009726 3300005467 Bacteria 8937
52 Ga0070706_100009945 3300005467 Bacteria 8833
53 Ga0070706_100048625 3300005467 Bacteria 3913
54 Ga0070707_100007539 3300005468 Bacteria 10110
55 Ga0070707_100025325 3300005468 Bacteria 5627
56 Ga0070707_100036415 3300005468 Bacteria 4695
57 Ga0070707_100284948 3300005468 Bacteria 1605
58 Ga0070698_100000015 3300005471 Bacteria 111813
59 Ga0070698_100000067 3300005471 Bacteria 77303
60 Ga0070698_100007031 3300005471 Bacteria 12189
61 Ga0070698_100057419 3300005471 Bacteria 3938
62 Ga0070699_100010708 3300005518 Bacteria 7935
63 Ga0070679_100004420 3300005530 Bacteria 12992
64 Ga0070679_100081967 3300005530 Unclassified 3216
65 Ga0070684_100002625 3300005535 Bacteria 13279
66 Ga0070684_100102595 3300005535 Bacteria 2557
67 Ga0070684_100226053 3300005535 Unclassified 1708
68 Ga0070697_100000195 3300005536 Bacteria 49351
69 Ga0070697_100001021 3300005536 Bacteria 21127
70 Ga0070697_100010873 3300005536 Bacteria 7108
71 Ga0070697_100183715 3300005536 Bacteria 1773
72 Ga0070697_100224700 3300005536 Bacteria 1600
73 Ga0068853_100004456 3300005539 Bacteria 10852
74 Ga0070696_100075862 3300005546 Bacteria 2372
75 Ga0070665_100051073 3300005548 Bacteria 4148
76 Ga0070665_100154797 3300005548 Bacteria 2294
77 Ga0068855_100002064 3300005563 Bacteria 24891
78 Ga0068855_100004921 3300005563 Bacteria 16303
79 Ga0068855_100007219 3300005563 Bacteria 13483
80 Ga0068855_100013622 3300005563 Bacteria 9806
81 Ga0068857_100003570 3300005577 Bacteria 13007
82 Ga0068857_100005453 3300005577 Bacteria 10848
83 Ga0068857_100042142 3300005577 Bacteria 4048
84 Ga0068857_100199716 3300005577 Bacteria 1823
85 Ga0068854_100001103 3300005578 Bacteria 16246
86 Ga0068854_100039075 3300005578 Bacteria 3341
87 Ga0068854_100046806 3300005578 Unclassified 3081
88 Ga0068854_100077172 3300005578 Bacteria 2451
89 Ga0068856_100000065 3300005614 Bacteria 98683
90 Ga0068856_100000989 3300005614 Bacteria 30332
91 Ga0068856_100002496 3300005614 Bacteria 18932
92 Ga0068852_100000026 3300005616 Bacteria 114548
93 Ga0068852_100052563 3300005616 Unclassified 3502
94 Ga0068852_100135408 3300005616 Bacteria 2274
95 Ga0068859_100000939 3300005617 Bacteria 29832
96 Ga0068859_100032378 3300005617 Bacteria 5252
97 Ga0068859_100215099 3300005617 Bacteria 2009
98 Ga0068864_100000369 3300005618 Bacteria 39200
99 Ga0068866_10011636 3300005718 Bacteria 3814
100 Ga0068866_10020804 3300005718 Bacteria 3012
101 Ga0068861_100027486 3300005719 Bacteria 4144
102 Ga0068851_10007689 3300005834 Bacteria 4956
103 Ga0068870_10078127 3300005840 Bacteria 1822
104 Ga0068870_10086250 3300005840 Bacteria 1746
105 Ga0068863_100006532 3300005841 Bacteria 11443
106 Ga0068863_100036070 3300005841 Bacteria 4709
107 Ga0068858_100002175 3300005842 Bacteria 19870
108 Ga0068858_100024516 3300005842 Bacteria 5620
109 Ga0068858_100124477 3300005842 Unclassified 2413
110 Ga0068860_100009639 3300005843 Bacteria 9598
111 Ga0068860_100023242 3300005843 Bacteria 5990
112 Ga0068862_100131317 3300005844 Bacteria 2215
113 Ga0070717_10001855 3300006028 Bacteria 14762
114 Ga0070717_10021569 3300006028 Bacteria 5078
115 Ga0070717_10038409 3300006028 Unclassified 3891
116 Ga0070717_10050869 3300006028 Bacteria 3408
117 Ga0070717_10152486 3300006028 Bacteria 2000
118 Ga0070715_10016107 3300006163 Bacteria 2801
119 Ga0070715_10028317 3300006163 Bacteria 2246
120 Ga0070716_100008820 3300006173 Bacteria 5011
121 Ga0070716_100013647 3300006173 Bacteria 4145
122 Ga0070716_100275968 3300006173 Bacteria 1158
123 Ga0070712_100001229 3300006175 Bacteria 15482
124 Ga0070712_100005202 3300006175 Bacteria 8045
125 Ga0070712_100017222 3300006175 Unclassified 4675
126 Ga0070712_100020300 3300006175 Unclassified 4347
127 Ga0070712_100069706 3300006175 Bacteria 2509
128 Ga0070712_100258053 3300006175 Bacteria 1396
129 Ga0097621_100000034 3300006237 Bacteria 69159
130 Ga0097621_100000908 3300006237 Bacteria 20694
131 Ga0097621_100000922 3300006237 Bacteria 20562
132 Ga0097621_100018520 3300006237 Bacteria 5323
133 Ga0068871_100000233 3300006358 Bacteria 39441
134 Ga0068871_100000444 3300006358 Bacteria 28514
135 Ga0068871_100005759 3300006358 Bacteria 8700
136 Ga0068871_100069895 3300006358 Bacteria 2884
137 Ga0068871_100078958 3300006358 Unclassified 2722
138 Ga0075428_100355151 3300006844 Bacteria 1573
139 Ga0075434_100000144 3300006871 Bacteria 43403
140 Ga0075434_100424207 3300006871 Bacteria 1351
141 Ga0068865_100002230 3300006881 Bacteria 11411
142 Ga0068865_100011207 3300006881 Bacteria 5604
143 Ga0068865_100114296 3300006881 Unclassified 1996
144 Ga0068865_100129974 3300006881 Bacteria 1885
145 Ga0068865_100144080 3300006881 Bacteria 1800
146 Ga0075436_100003577 3300006914 Bacteria 10648
147 Ga0075436_100008409 3300006914 Bacteria 7057
148 Ga0097620_100000939 3300006931 Bacteria 29832
149 Ga0097620_100032378 3300006931 Bacteria 5252
150 Ga0097620_100215096 3300006931 Bacteria 2009
151 Ga0075435_100000208 3300007076 Bacteria 35592
152 Ga0075435_100008767 3300007076 Bacteria 7280
153 Ga0075435_100280158 3300007076 Bacteria 1423
154 Ga0105240_10000038 3300009093 Bacteria 270341
155 Ga0105240_10016462 3300009093 Bacteria 10007
156 Ga0105240_10049700 3300009093 Bacteria 5291
157 Ga0105240_10077581 3300009093 Bacteria 4092
158 Ga0105240_10178172 3300009093 Bacteria 2511
159 Ga0105245_10021241 3300009098 Bacteria 5692
160 Ga0105245_10138306 3300009098 Unclassified 2291
161 Ga0105245_10288654 3300009098 Bacteria 1606
162 Ga0105247_10183298 3300009101 Bacteria 1398
163 Ga0105243_10022840 3300009148 Bacteria 4755
164 Ga0105242_10002524 3300009176 Bacteria 14358
165 Ga0105248_10005836 3300009177 Bacteria 13532
166 Ga0105248_10541452 3300009177 Bacteria 1313
167 Ga0105237_10119033 3300009545 Bacteria 2635
168 Ga0105238_10000464 3300009551 Bacteria 42663
169 Ga0105238_10175360 3300009551 Bacteria 2121
170 Ga0105238_10498214 3300009551 Bacteria 1219
171 Ga0105249_10004737 3300009553 Bacteria 11742
172 Ga0105249_10479450 3300009553 Bacteria 1286
173 Ga0105239_10025725 3300010375 Bacteria 6482
174 Ga0105239_10279713 3300010375 Bacteria 1878
175 Ga0105239_10663078 3300010375 Bacteria 1192
176 Ga0105246_10004638 3300011119 Bacteria 8363
177 Ga0105246_10121280 3300011119 Unclassified 1938
178 Ga0157373_10021011 3300013100 Unclassified 4739
179 Ga0157373_10149649 3300013100 Bacteria 1642
180 Ga0157371_10022675 3300013102 Bacteria 4595
181 Ga0157371_10248542 3300013102 Unclassified 1280
182 Ga0157370_10000011 3300013104 Bacteria 212362
183 Ga0157370_10016212 3300013104 Bacteria 7552
184 Ga0157369_10000060 3300013105 Bacteria 152332
185 Ga0157369_10000264 3300013105 Bacteria 70855
186 Ga0157369_10016872 3300013105 Bacteria 8205
187 Ga0157369_10047833 3300013105 Bacteria 4642
188 Ga0157369_10105658 3300013105 Bacteria 2997
189 Ga0157369_10114205 3300013105 Bacteria 2868
190 Ga0157374_10000249 3300013296 Bacteria 49808
191 Ga0157374_10000496 3300013296 Bacteria 35685
192 Ga0157374_10001107 3300013296 Bacteria 23202
193 Ga0157374_10005920 3300013296 Bacteria 10330
194 Ga0157374_10006804 3300013296 Bacteria 9723
195 Ga0157374_10031887 3300013296 Bacteria 4794
196 Ga0157378_10000008 3300013297 Bacteria 162605
197 Ga0157378_10000145 3300013297 Bacteria 66719
198 Ga0157378_10002765 3300013297 Bacteria 15636
199 Ga0157378_10003358 3300013297 Bacteria 14239
200 Ga0157378_10359197 3300013297 Bacteria 1425
201 Ga0163162_10069071 3300013306 Bacteria 3585
202 Ga0163162_10098345 3300013306 Bacteria 3016
203 Ga0163162_10116585 3300013306 Bacteria 2771
204 Ga0157372_10000240 3300013307 Bacteria 60611
205 Ga0157372_10000611 3300013307 Bacteria 39068
206 Ga0157372_10001696 3300013307 Bacteria 23852
207 Ga0157372_10004250 3300013307 Bacteria 15312
208 Ga0157372_10055445 3300013307 Bacteria 4427
209 Ga0157372_10058312 3300013307 Bacteria 4315
210 Ga0157372_10128254 3300013307 Bacteria 2917
211 Ga0157372_10234752 3300013307 Bacteria 2127
212 Ga0157375_10003580 3300013308 Bacteria 13482
213 Ga0182008_10000757 3300014497 Bacteria 22706
214 Ga0157376_10004063 3300014969 Bacteria 10125
215 Ga0157376_10007857 3300014969 Bacteria 7650
216 Ga0213872_10000077 3300021361 Bacteria 90250
217 Ga0224572_1008610 3300024225 Unclassified 1890
218 Ga0207692_10027834 3300025898 Bacteria 2667
219 Ga0207692_10098538 3300025898 Bacteria 1600
220 Ga0207642_10006703 3300025899 Bacteria 3846
221 Ga0207680_10175701 3300025903 Bacteria 1445
222 Ga0207647_10010857 3300025904 Bacteria 6412
223 Ga0207685_10001286 3300025905 Bacteria 5140
224 Ga0207685_10027015 3300025905 Bacteria 2003
225 Ga0207699_10023253 3300025906 Unclassified 3371
226 Ga0207699_10043249 3300025906 Bacteria 2615
227 Ga0207699_10247864 3300025906 Bacteria 1226
228 Ga0207645_10037785 3300025907 Bacteria 3099
229 Ga0207684_10000258 3300025910 Bacteria 78672
230 Ga0207684_10005976 3300025910 Bacteria 11136
231 Ga0207684_10210132 3300025910 Bacteria 1679
232 Ga0207707_10000266 3300025912 Bacteria 56336
233 Ga0207707_10003379 3300025912 Bacteria 14162
234 Ga0207707_10083743 3300025912 Bacteria 2785
235 Ga0207695_10000070 3300025913 Bacteria 318111
236 Ga0207695_10007402 3300025913 Bacteria 13995
237 Ga0207695_10036839 3300025913 Bacteria 5283
238 Ga0207695_10062091 3300025913 Bacteria 3859
239 Ga0207695_10065234 3300025913 Bacteria 3744
240 Ga0207695_10197861 3300025913 Bacteria 1925
241 Ga0207671_10040250 3300025914 Bacteria 3460
242 Ga0207671_10249773 3300025914 Unclassified 1394
243 Ga0207693_10000098 3300025915 Bacteria 77389
244 Ga0207693_10001517 3300025915 Bacteria 20489
245 Ga0207693_10008033 3300025915 Bacteria 8664
246 Ga0207693_10010852 3300025915 Bacteria 7391
247 Ga0207693_10012621 3300025915 Bacteria 6827
248 Ga0207693_10021165 3300025915 Bacteria 5169
249 Ga0207693_10023849 3300025915 Bacteria 4856
250 Ga0207693_10339639 3300025915 Bacteria 1175
251 Ga0207657_10002292 3300025919 Bacteria 20729
252 Ga0207652_10003545 3300025921 Bacteria 12882
253 Ga0207652_10028009 3300025921 Bacteria 4698
254 Ga0207652_10044578 3300025921 Bacteria 3779
255 Ga0207652_10049831 3300025921 Bacteria 3586
256 Ga0207646_10002621 3300025922 Bacteria 21128
257 Ga0207646_10247886 3300025922 Bacteria 1609
258 Ga0207681_10070137 3300025923 Bacteria 2440
259 Ga0207694_10002762 3300025924 Bacteria 14177
260 Ga0207694_10089852 3300025924 Unclassified 2423
261 Ga0207694_10192254 3300025924 Bacteria 1658
262 Ga0207694_10394578 3300025924 Bacteria 1150
263 Ga0207687_10014502 3300025927 Bacteria 5158
264 Ga0207700_10003658 3300025928 Bacteria 8963
265 Ga0207700_10008041 3300025928 Bacteria 6502
266 Ga0207700_10042048 3300025928 Unclassified 3348
267 Ga0207700_10106477 3300025928 Unclassified 2248
268 Ga0207700_10139704 3300025928 Unclassified 1989
269 Ga0207700_10291582 3300025928 Bacteria 1406
270 Ga0207664_10000212 3300025929 Bacteria 44097
271 Ga0207664_10002213 3300025929 Bacteria 12815
272 Ga0207664_10192340 3300025929 Bacteria 1757
273 Ga0207706_10000098 3300025933 Bacteria 91173
274 Ga0207706_10070357 3300025933 Unclassified 3078
275 Ga0207686_10050727 3300025934 Bacteria 2581
276 Ga0207709_10026545 3300025935 Bacteria 3328
277 Ga0207704_10006057 3300025938 Bacteria 5606
278 Ga0207704_10022694 3300025938 Bacteria 3368
279 Ga0207704_10128789 3300025938 Bacteria 1748
280 Ga0207665_10000526 3300025939 Bacteria 25799
281 Ga0207665_10012563 3300025939 Bacteria 5565
282 Ga0207665_10061622 3300025939 Bacteria 2543
283 Ga0207665_10157304 3300025939 Bacteria 1632
284 Ga0207665_10199276 3300025939 Unclassified 1458
285 Ga0207711_10004346 3300025941 Bacteria 12093
286 Ga0207689_10000353 3300025942 Bacteria 43010
287 Ga0207661_10019007 3300025944 Bacteria 5114
288 Ga0207679_10070237 3300025945 Bacteria 2638
289 Ga0207667_10000413 3300025949 Bacteria 57875
290 Ga0207667_10006238 3300025949 Bacteria 14469
291 Ga0207667_10013818 3300025949 Bacteria 9223
292 Ga0207667_10025838 3300025949 Bacteria 6424
293 Ga0207667_10041481 3300025949 Bacteria 4894
294 Ga0207667_10044393 3300025949 Bacteria 4710
295 Ga0207667_10056626 3300025949 Bacteria 4118
296 Ga0207651_10140062 3300025960 Bacteria 1867
297 Ga0207668_10193867 3300025972 Bacteria 1612
298 Ga0207640_10012829 3300025981 Bacteria 4787
299 Ga0207640_10184604 3300025981 Bacteria 1567
300 Ga0207658_10010427 3300025986 Bacteria 6311
301 Ga0207677_10001543 3300026023 Bacteria 12182
302 Ga0207677_10001745 3300026023 Bacteria 11515
303 Ga0207677_10019500 3300026023 Bacteria 4097
304 Ga0207703_10007234 3300026035 Bacteria 8827
305 Ga0207703_10022635 3300026035 Bacteria 4933
306 Ga0207678_10003005 3300026067 Bacteria 15256
307 Ga0207702_10000209 3300026078 Bacteria 69358
308 Ga0207702_10001199 3300026078 Bacteria 26302
309 Ga0207702_10003037 3300026078 Bacteria 15597
310 Ga0207702_10018622 3300026078 Bacteria 5745
311 Ga0207702_10093348 3300026078 Bacteria 2639
312 Ga0207702_10244105 3300026078 Bacteria 1684
313 Ga0207702_10277013 3300026078 Bacteria 1584
314 Ga0207641_10008027 3300026088 Bacteria 8749
315 Ga0207641_10022846 3300026088 Bacteria 5151
316 Ga0207641_10023277 3300026088 Bacteria 5104
317 Ga0207648_10050218 3300026089 Bacteria 3648
318 Ga0207648_10112568 3300026089 Bacteria 2390
319 Ga0207676_10002695 3300026095 Bacteria 12631
320 Ga0207674_10007510 3300026116 Bacteria 12711
321 Ga0207674_10012986 3300026116 Bacteria 9283
322 Ga0207675_100048846 3300026118 Bacteria 3949
323 Ga0207683_10075938 3300026121 Bacteria 2975
324 Ga0207698_10000010 3300026142 Bacteria 270583
325 Ga0268266_10163534 3300028379 Bacteria 2015
326 Ga0268266_10302268 3300028379 Bacteria 1493
327 Ga0265318_10015038 3300028577 Bacteria 3231
328 Ga0265338_10004251 3300028800 Bacteria 19463
329 Ga0265338_10018230 3300028800 Bacteria 7524
330 Ga0265338_10129878 3300028800 Unclassified 1992
331 Ga0265338_10170973 3300028800 Bacteria 1667
332 Ga0265338_10189349 3300028800 Bacteria 1561
333 Ga0265762_1000116 3300030760 Bacteria 11753
334 Ga0265330_10010766 3300031235 Bacteria 4303
335 Ga0265328_10003017 3300031239 Bacteria 7514
336 Ga0265320_10040079 3300031240 Bacteria 2338
337 Ga0265325_10011788 3300031241 Bacteria 5015
338 Ga0265325_10030984 3300031241 Bacteria 2865
339 Ga0265340_10009581 3300031247 Bacteria 5193
340 Ga0265340_10010780 3300031247 Unclassified 4882
341 Ga0265339_10000657 3300031249 Bacteria 26712
342 Ga0265339_10024673 3300031249 Bacteria 3461
343 Ga0265339_10047370 3300031249 Unclassified 2360
344 Ga0265331_10015220 3300031250 Bacteria 4069
345 Ga0265316_10006565 3300031344 Bacteria 11096
346 Ga0265316_10022848 3300031344 Bacteria 5262
347 Ga0265316_10040340 3300031344 Bacteria 3743
348 Ga0265314_10009021 3300031711 Bacteria 8477
349 Ga0265314_10016962 3300031711 Bacteria 5732
350 Ga0265342_10006269 3300031712 Bacteria 8878
351 Ga0265342_10038948 3300031712 Unclassified 2891
352 Ga0265342_10128397 3300031712 Bacteria 1422
353 Ga0316576_10019665 3300031727 Bacteria 4630
354 Ga0316578_10000883 3300031728 Bacteria 11297
355 Ga0316577_10003068 3300031733 Bacteria 8383
356 Ga0307414_10150081 3300032004 Bacteria 1838
357 Ga0316580_10007715 3300032139 Bacteria 3212
358 Ga0373934_0048099 3300035086 Bacteria 1688
359 Ga0373944_0068642 3300035089 Bacteria 1151
360 Ga0373923_0001653 3300035111 Bacteria 6511
361 Ga0373936_0000319 3300035113 Bacteria 16274
362 Ga0373943_0000016 3300035170 Bacteria 58099
363 Ga0373943_0014968 3300035170 Bacteria 3521
364 Ga0373943_0015330 3300035170 Bacteria 3479
365 Ga0373943_0052216 3300035170 Unclassified 2015
366 Ga0373946_0002138 3300035171 Bacteria 6930
367 Ga0373946_0050402 3300035171 Bacteria 1739
368 Ga0316574_0006055 3300035398 Bacteria 6501
369 Ga0373935_0013172 3300035692 Unclassified 4985
370 Ga0373935_0042839 3300035692 Bacteria 2847
371 Ga0373935_0277897 3300035692 Unclassified 1178
372 Ga0373927_0000034 3300035695 Bacteria 103921
373 Ga0373927_0162470 3300035695 Bacteria 1463
374 Ga0373933_0025665 3300035724 Bacteria 3380
375 Ga0373933_0030135 3300035724 Bacteria 3141
376 Ga0373947_0000035 3300035725 Bacteria 68883
377 Ga0373947_0009483 3300035725 Bacteria 5591
378 Ga0373937_0050410 3300036401 Bacteria 3813
379 Ga0373937_0054134 3300036401 Unclassified 3681
380 Ga0373937_0067041 3300036401 Bacteria 3307
381 Ga0373937_0082770 3300036401 Bacteria 2969
382 Ga0316582_0005769 3300036647 Bacteria 6424
383 Ga0316584_0020467 3300036712 Bacteria 4797
384 Ga0373925_0000714 3300037068 Bacteria 31008
385 Ga0373925_0003441 3300037068 Bacteria 12238
386 Ga0373925_0042171 3300037068 Unclassified 3385
387 Ga0373925_0167769 3300037068 Bacteria 1732
388 Ga0395900_0019930 3300037418 Bacteria 6837
389 Ga0395898_0444815 3300037466 Bacteria 1235
390 Ga0395901_0022117 3300038443 Bacteria 6515
391 Ga0436361_0888723 3300039447 Bacteria 8847
392 Ga0436361_1007413 3300039447 Bacteria 98457
393 Ga0436363_0683583 3300039450 Unclassified 1878
394 Ga0439465_0008336 3300041413 Bacteria 3271
395 Ga0451793_0607467 3300041452 Bacteria 2798
396 Ga0451797_0555088 3300041453 Bacteria 1688
397 Ga0451807_1271362 3300041486 Bacteria 3466
398 Ga0439448_0020302 3300042005 Bacteria 2054
399 Ga0466969_0009685 3300044656 Bacteria 5107
400 Ga0466965_0002194 3300044683 Bacteria 8212
401 Ga0466961_0049764 3300044693 Bacteria 2678
402 Ga0466961_0108591 3300044693 Bacteria 1746
403 Ga0466971_0002945 3300044719 Bacteria 7223
404 Ga0466971_0095473 3300044719 Unclassified 1363
405 Ga0466970_0084004 3300044765 Bacteria 1723
406 Ga0466959_0013406 3300045049 Bacteria 5941
407 Ga0466959_0131177 3300045049 Unclassified 1776
408 Ga0466959_0185218 3300045049 Bacteria 1455
409 Ga0466958_0079919 3300045836 Bacteria 2011
410 Ga0466958_0190800 3300045836 Bacteria 1302
411 Ga0466967_0119952 3300045976 Bacteria 2428
412 Ga0495653_0114238 3300046463 Bacteria 1935
413 Ga0495580_0001606 3300046472 Bacteria 19867
414 Ga0495580_0004478 3300046472 Bacteria 11736
415 Ga0495580_0015596 3300046472 Bacteria 5727
416 Ga0495580_0026951 3300046472 Bacteria 4185
417 Ga0495580_0041525 3300046472 Unclassified 3281
418 Ga0495580_0043738 3300046472 Bacteria 3186
419 Ga0495580_0044773 3300046472 Bacteria 3146
420 Ga0495580_0067990 3300046472 Unclassified 2492
421 Ga0495580_0081561 3300046472 Bacteria 2254
422 Ga0495582_0005195 3300046473 Bacteria 7283
423 Ga0495664_0033303 3300046477 Unclassified 3028
424 Ga0495584_0084892 3300046491 Bacteria 1595
425 Ga0495585_0007022 3300046492 Bacteria 6933
426 Ga0495594_0018866 3300046499 Bacteria 3660
427 Ga0495583_0000344 3300046506 Bacteria 73346
428 Ga0495630_0038786 3300046517 Bacteria 3564
429 Ga0495665_0007171 3300046531 Bacteria 6017
430 Ga0495665_0080468 3300046531 Bacteria 1714
431 Ga0495586_0078008 3300046535 Bacteria 1817
432 Ga0495645_0099512 3300046543 Bacteria 2069
433 Ga0495668_0123449 3300046616 Bacteria 1417
434 Ga0495599_0084539 3300046678 Bacteria 1982
435 Ga0495658_0017161 3300046683 Bacteria 3736
436 Ga0495674_0101377 3300047319 Bacteria 2449
437 Ga0495674_0192004 3300047319 Bacteria 1697
438 Ga0495674_0231872 3300047319 Bacteria 1523
439 Ga0495674_0258342 3300047319 Unclassified 1432
440 Ga0495687_114890 3300047443 Bacteria 982
441 Ga0495675_0144090 3300047444 Bacteria 1475
442 Ga0495684_0173861 3300047471 Bacteria 1600
443 Ga0495626_0000003 3300048091 Bacteria 427774
444 Ga0496101_0055932 3300048904 Bacteria 2851
445 Ga0496102_0007913 3300048905 Bacteria 9085
446 Ga0496103_0012057 3300048906 Bacteria 5134
447 Ga0496103_0068199 3300048906 Bacteria 2222
448 Ga0496104_0057473 3300048907 Bacteria 3681
449 Ga0496104_0061994 3300048907 Bacteria 3545
450 Ga0496104_0266686 3300048907 Bacteria 1625
451 Ga0496104_0505754 3300048907 Bacteria 1119
452 Ga0496105_0123762 3300048908 Bacteria 2132
453 Ga0496107_0033647 3300048910 Bacteria 3668
454 Ga0496108_0086984 3300048911 Bacteria 2654
455 Ga0496109_0041746 3300048912 Bacteria 4155
456 Ga0496112_0006190 3300048915 Bacteria 10470
457 Ga0496112_0010297 3300048915 Bacteria 8479
458 Ga0496112_0018853 3300048915 Bacteria 6500
459 Ga0496112_0049183 3300048915 Bacteria 4133
460 Ga0496112_0256813 3300048915 Bacteria 1698
461 Ga0496113_0139380 3300048916 Bacteria 1907
462 Ga0496113_0201736 3300048916 Unclassified 1581
463 Ga0496113_0326258 3300048916 Unclassified 1231
464 Ga0496114_0076394 3300048917 Bacteria 2822
465 Ga0496114_0079573 3300048917 Bacteria 2767
466 Ga0501034_0000590 3300049571 Bacteria 57381
467 Ga0501036_0198107 3300049572 Bacteria 1689
468 Ga0501040_0025246 3300049576 Bacteria 3996
469 Ga0501040_0039516 3300049576 Bacteria 3208
470 Ga0501041_0002695 3300049577 Bacteria 10133
471 Ga0501042_0024929 3300049578 Bacteria 4197
472 Ga0501046_0003482 3300049580 Bacteria 14436
473 Ga0501048_0023331 3300049582 Bacteria 4522
474 Ga0501068_0021656 3300049584 Bacteria 3755
475 Ga0501069_0058401 3300049585 Bacteria 2151
476 Ga0501070_0182628 3300049586 Bacteria 1726
477 Ga0501071_0036664 3300049587 Bacteria 3497
478 Ga0501072_0007442 3300049588 Bacteria 8305
479 Ga0501072_0273490 3300049588 Bacteria 1344
480 Ga0501073_0052550 3300049589 Bacteria 2853
481 Ga0501074_0071267 3300049590 Bacteria 2498
482 Ga0501075_0013817 3300049591 Bacteria 5773
483 Ga0501075_0097866 3300049591 Bacteria 2227
484 Ga0501076_0094076 3300049592 Bacteria 2413
485 Ga0501077_0009934 3300049593 Bacteria 5922
486 Ga0501079_0007790 3300049741 Bacteria 8108
487 Ga0501080_0026348 3300049742 Bacteria 5402
488 Ga0501080_0320665 3300049742 Bacteria 1403
489 Ga0501081_0107373 3300049743 Bacteria 1979
490 Ga0501083_0018144 3300049744 Bacteria 4905
491 Ga0501045_0039333 3300049824 Bacteria 3441
492 nmdc:mga0k408_27316_c1 3300050493 Bacteria 3241
493 nmdc:mga0n895_156393_c1 3300050512 Bacteria 2310
494 nmdc:mga0n895_430460_c1 3300050512 Bacteria 1333
495 nmdc:mga0n895_576538_c1 3300050512 Unclassified 1129
496 nmdc:mga0rr50_2693_c1 3300050513 Bacteria 10072
497 nmdc:mga0rr50_461292_c1 3300050513 Bacteria 1078
498 nmdc:mga0rr50_85608_c1 3300050513 Bacteria 2443
499 nmdc:mga08x19_12027_c1 3300050514 Bacteria 5208
500 nmdc:mga08x19_2727_c1 3300050514 Bacteria 10669
501 nmdc:mga08x19_3787_c1 3300050514 Bacteria 9001
502 nmdc:mga08x19_4266_c1 3300050514 Bacteria 8477
503 nmdc:mga0a205_2420_c1 3300050515 Bacteria 9021
504 Ga0500590_080186 3300053148 Bacteria 1605
505 Ga0501084_0023151 3300054114 Bacteria 5185
506 Ga0501082_0007886 3300060353 Bacteria 9192
507 Ga0501082_0215609 3300060353 Bacteria 1670
508 Ga0466962_0003437 3300061719 Bacteria 7540
509 Ga0530510_0026895 3300061734 Bacteria 4121
510 2643768421 2643221549 Bacteria 4042819
511 2644181130 2643221632 Bacteria 3406696
512 2689963577 2687453737 Bacteria 11203906
513 2723641106 2721755702 Bacteria 4373124
514 2852649202 2852646457 Bacteria 3408613
515 2919398220 2919395869 Bacteria 3704152
516 2935410535 2935409751 Bacteria 4179611
517 2945969641 2945968032 Bacteria 4111363
518 2946041778 2946041624 Bacteria 4191385
519 8004025219 8004021418 Bacteria 4313954
520 8004026786 8004025490 Bacteria 4327753
521 8055035513 8055034563 Bacteria 3562128
522 Ga0070706_100171788
523 MRS1b_contig_8036739
524 LJNas_1001086
525 Ga0065714_10022930
526 Ga0065712_10102223
527 Ga0065712_10146520
528 Ga0070676_10020696
529 Ga0070683_100047483
530 Ga0070690_100237387
531 Ga0070690_100368664
532 Ga0070670_100041015
533 Ga0068869_100002638
534 Ga0068869_100010377
535 Ga0070680_100032355
536 Ga0068868_100001549
537 Ga0068868_100002974
538 Ga0068868_100009306
539 Ga0068868_100041709
540 Ga0070689_100180151
541 Ga0070661_100024001
542 Ga0070668_100003009
543 Ga0070673_100036920
544 Ga0070673_100171672
545 Ga0070667_100055099
546 Ga0070709_10014535
547 Ga0070714_100000183
548 Ga0070713_100013761
549 Ga0070713_100014383
550 Ga0070713_100019701
551 Ga0070713_100028513
552 Ga0070713_100109749
553 Ga0070710_10020114
554 Ga0070710_10059703
555 Ga0070711_100001220
556 Ga0070711_100075071
557 Ga0070705_100080528
558 Ga0070708_100050193
559 Ga0070662_100015549
560 Ga0070662_100025038
561 Ga0070681_10000692
562 Ga0070681_10010622
563 Ga0070681_10046007
564 Ga0070681_10095896
565 Ga0070681_10106362
566 Ga0070681_10300678
567 Ga0068867_100026405
568 Ga0068867_100147563
569 Ga0068867_100180868
570 Ga0070706_100000381
571 Ga0070706_100006382
572 Ga0070706_100009726
573 Ga0070706_100009945
574 Ga0070706_100048625
575 Ga0070707_100007539
576 Ga0070707_100025325
577 Ga0070707_100036415
578 Ga0070707_100284948
579 Ga0070698_100000015
580 Ga0070698_100000067
581 Ga0070698_100007031
582 Ga0070698_100057419
583 Ga0070699_100010708
584 Ga0070679_100004420
585 Ga0070679_100081967
586 Ga0070684_100002625
587 Ga0070684_100102595
588 Ga0070684_100226053
589 Ga0070697_100000195
590 Ga0070697_100001021
591 Ga0070697_100010873
592 Ga0070697_100183715
593 Ga0070697_100224700
594 Ga0068853_100004456
595 Ga0070696_100075862
596 Ga0070665_100051073
597 Ga0070665_100154797
598 Ga0068855_100002064
599 Ga0068855_100004921
600 Ga0068855_100007219
601 Ga0068855_100013622
602 Ga0068857_100003570
603 Ga0068857_100005453
604 Ga0068857_100042142
605 Ga0068857_100199716
606 Ga0068854_100001103
607 Ga0068854_100039075
608 Ga0068854_100046806
609 Ga0068854_100077172
610 Ga0068856_100000065
611 Ga0068856_100000989
612 Ga0068856_100002496
613 Ga0068852_100000026
614 Ga0068852_100052563
615 Ga0068852_100135408
616 Ga0068859_100000939
617 Ga0068859_100032378
618 Ga0068859_100215099
619 Ga0068864_100000369
620 Ga0068866_10011636
621 Ga0068866_10020804
622 Ga0068861_100027486
623 Ga0068851_10007689
624 Ga0068870_10078127
625 Ga0068870_10086250
626 Ga0068863_100006532
627 Ga0068863_100036070
628 Ga0068858_100002175
629 Ga0068858_100024516
630 Ga0068858_100124477
631 Ga0068860_100009639
632 Ga0068860_100023242
633 Ga0068862_100131317
634 Ga0070717_10001855
635 Ga0070717_10021569
636 Ga0070717_10038409
637 Ga0070717_10050869
638 Ga0070717_10152486
639 Ga0070715_10016107
640 Ga0070715_10028317
641 Ga0070716_100008820
642 Ga0070716_100013647
643 Ga0070716_100275968
644 Ga0070712_100001229
645 Ga0070712_100005202
646 Ga0070712_100017222
647 Ga0070712_100020300
648 Ga0070712_100069706
649 Ga0070712_100258053
650 Ga0097621_100000034
651 Ga0097621_100000908
652 Ga0097621_100000922
653 Ga0097621_100018520
654 Ga0068871_100000233
655 Ga0068871_100000444
656 Ga0068871_100005759
657 Ga0068871_100069895
658 Ga0068871_100078958
659 Ga0075428_100355151
660 Ga0075434_100000144
661 Ga0075434_100424207
662 Ga0068865_100002230
663 Ga0068865_100011207
664 Ga0068865_100114296
665 Ga0068865_100129974
666 Ga0068865_100144080
667 Ga0075436_100003577
668 Ga0075436_100008409
669 Ga0097620_100000939
670 Ga0097620_100032378
671 Ga0097620_100215096
672 Ga0075435_100000208
673 Ga0075435_100008767
674 Ga0075435_100280158
675 Ga0105240_10000038
676 Ga0105240_10016462
677 Ga0105240_10049700
678 Ga0105240_10077581
679 Ga0105240_10178172
680 Ga0105245_10021241
681 Ga0105245_10138306
682 Ga0105245_10288654
683 Ga0105247_10183298
684 Ga0105243_10022840
685 Ga0105242_10002524
686 Ga0105248_10005836
687 Ga0105248_10541452
688 Ga0105237_10119033
689 Ga0105238_10000464
690 Ga0105238_10175360
691 Ga0105238_10498214
692 Ga0105249_10004737
693 Ga0105249_10479450
694 Ga0105239_10025725
695 Ga0105239_10279713
696 Ga0105239_10663078
697 Ga0105246_10004638
698 Ga0105246_10121280
699 Ga0157373_10021011
700 Ga0157373_10149649
701 Ga0157371_10022675
702 Ga0157371_10248542
703 Ga0157370_10000011
704 Ga0157370_10016212
705 Ga0157369_10000060
706 Ga0157369_10000264
707 Ga0157369_10016872
708 Ga0157369_10047833
709 Ga0157369_10105658
710 Ga0157369_10114205
711 Ga0157374_10000249
712 Ga0157374_10000496
713 Ga0157374_10001107
714 Ga0157374_10005920
715 Ga0157374_10006804
716 Ga0157374_10031887
717 Ga0157378_10000008
718 Ga0157378_10000145
719 Ga0157378_10002765
720 Ga0157378_10003358
721 Ga0157378_10359197
722 Ga0163162_10069071
723 Ga0163162_10098345
724 Ga0163162_10116585
725 Ga0157372_10000240
726 Ga0157372_10000611
727 Ga0157372_10001696
728 Ga0157372_10004250
729 Ga0157372_10055445
730 Ga0157372_10058312
731 Ga0157372_10128254
732 Ga0157372_10234752
733 Ga0157375_10003580
734 Ga0182008_10000757
735 Ga0157376_10004063
736 Ga0157376_10007857
737 Ga0213872_10000077
738 Ga0224572_1008610
739 Ga0207692_10027834
740 Ga0207692_10098538
741 Ga0207642_10006703
742 Ga0207680_10175701
743 Ga0207647_10010857
744 Ga0207685_10001286
745 Ga0207685_10027015
746 Ga0207699_10023253
747 Ga0207699_10043249
748 Ga0207699_10247864
749 Ga0207645_10037785
750 Ga0207684_10000258
751 Ga0207684_10005976
752 Ga0207684_10210132
753 Ga0207707_10000266
754 Ga0207707_10003379
755 Ga0207707_10083743
756 Ga0207695_10000070
757 Ga0207695_10007402
758 Ga0207695_10036839
759 Ga0207695_10062091
760 Ga0207695_10065234
761 Ga0207695_10197861
762 Ga0207671_10040250
763 Ga0207671_10249773
764 Ga0207693_10000098
765 Ga0207693_10001517
766 Ga0207693_10008033
767 Ga0207693_10010852
768 Ga0207693_10012621
769 Ga0207693_10021165
770 Ga0207693_10023849
771 Ga0207693_10339639
772 Ga0207657_10002292
773 Ga0207652_10003545
774 Ga0207652_10028009
775 Ga0207652_10044578
776 Ga0207652_10049831
777 Ga0207646_10002621
778 Ga0207646_10247886
779 Ga0207681_10070137
780 Ga0207694_10002762
781 Ga0207694_10089852
782 Ga0207694_10192254
783 Ga0207694_10394578
784 Ga0207687_10014502
785 Ga0207700_10003658
786 Ga0207700_10008041
787 Ga0207700_10042048
788 Ga0207700_10106477
789 Ga0207700_10139704
790 Ga0207700_10291582
791 Ga0207664_10000212
792 Ga0207664_10002213
793 Ga0207664_10192340
794 Ga0207706_10000098
795 Ga0207706_10070357
796 Ga0207686_10050727
797 Ga0207709_10026545
798 Ga0207704_10006057
799 Ga0207704_10022694
800 Ga0207704_10128789
801 Ga0207665_10000526
802 Ga0207665_10012563
803 Ga0207665_10061622
804 Ga0207665_10157304
805 Ga0207665_10199276
806 Ga0207711_10004346
807 Ga0207689_10000353
808 Ga0207661_10019007
809 Ga0207679_10070237
810 Ga0207667_10000413
811 Ga0207667_10006238
812 Ga0207667_10013818
813 Ga0207667_10025838
814 Ga0207667_10041481
815 Ga0207667_10044393
816 Ga0207667_10056626
817 Ga0207651_10140062
818 Ga0207668_10193867
819 Ga0207640_10012829
820 Ga0207640_10184604
821 Ga0207658_10010427
822 Ga0207677_10001543
823 Ga0207677_10001745
824 Ga0207677_10019500
825 Ga0207703_10007234
826 Ga0207703_10022635
827 Ga0207678_10003005
828 Ga0207702_10000209
829 Ga0207702_10001199
830 Ga0207702_10003037
831 Ga0207702_10018622
832 Ga0207702_10093348
833 Ga0207702_10244105
834 Ga0207702_10277013
835 Ga0207641_10008027
836 Ga0207641_10022846
837 Ga0207641_10023277
838 Ga0207648_10050218
839 Ga0207648_10112568
840 Ga0207676_10002695
841 Ga0207674_10007510
842 Ga0207674_10012986
843 Ga0207675_100048846
844 Ga0207683_10075938
845 Ga0207698_10000010
846 Ga0268266_10163534
847 Ga0268266_10302268
848 Ga0265318_10015038
849 Ga0265338_10004251
850 Ga0265338_10018230
851 Ga0265338_10129878
852 Ga0265338_10170973
853 Ga0265338_10189349
854 Ga0265762_1000116
855 Ga0265330_10010766
856 Ga0265328_10003017
857 Ga0265320_10040079
858 Ga0265325_10011788
859 Ga0265325_10030984
860 Ga0265340_10009581
861 Ga0265340_10010780
862 Ga0265339_10000657
863 Ga0265339_10024673
864 Ga0265339_10047370
865 Ga0265331_10015220
866 Ga0265316_10006565
867 Ga0265316_10022848
868 Ga0265316_10040340
869 Ga0265314_10009021
870 Ga0265314_10016962
871 Ga0265342_10006269
872 Ga0265342_10038948
873 Ga0265342_10128397
874 Ga0316576_10019665
875 Ga0316578_10000883
876 Ga0316577_10003068
877 Ga0307414_10150081
878 Ga0316580_10007715
879 Ga0373934_0048099
880 Ga0373944_0068642
881 Ga0373923_0001653
882 Ga0373936_0000319
883 Ga0373943_0000016
884 Ga0373943_0014968
885 Ga0373943_0015330
886 Ga0373943_0052216
887 Ga0373946_0002138
888 Ga0373946_0050402
889 Ga0316574_0006055
890 Ga0373935_0013172
891 Ga0373935_0042839
892 Ga0373935_0277897
893 Ga0373927_0000034
894 Ga0373927_0162470
895 Ga0373933_0025665
896 Ga0373933_0030135
897 Ga0373947_0000035
898 Ga0373947_0009483
899 Ga0373937_0050410
900 Ga0373937_0054134
901 Ga0373937_0067041
902 Ga0373937_0082770
903 Ga0316582_0005769
904 Ga0316584_0020467
905 Ga0373925_0000714
906 Ga0373925_0003441
907 Ga0373925_0042171
908 Ga0373925_0167769
909 Ga0395900_0019930
910 Ga0395898_0444815
911 Ga0395901_0022117
912 Ga0436361_0888723
913 Ga0436361_1007413
914 Ga0436363_0683583
915 Ga0439465_0008336
916 Ga0451793_0607467
917 Ga0451797_0555088
918 Ga0451807_1271362
919 Ga0439448_0020302
920 Ga0466969_0009685
921 Ga0466965_0002194
922 Ga0466961_0049764
923 Ga0466961_0108591
924 Ga0466971_0002945
925 Ga0466971_0095473
926 Ga0466970_0084004
927 Ga0466959_0013406
928 Ga0466959_0131177
929 Ga0466959_0185218
930 Ga0466958_0079919
931 Ga0466958_0190800
932 Ga0466967_0119952
933 Ga0495653_0114238
934 Ga0495580_0001606
935 Ga0495580_0004478
936 Ga0495580_0015596
937 Ga0495580_0026951
938 Ga0495580_0041525
939 Ga0495580_0043738
940 Ga0495580_0044773
941 Ga0495580_0067990
942 Ga0495580_0081561
943 Ga0495582_0005195
944 Ga0495664_0033303
945 Ga0495584_0084892
946 Ga0495585_0007022
947 Ga0495594_0018866
948 Ga0495583_0000344
949 Ga0495630_0038786
950 Ga0495665_0007171
951 Ga0495665_0080468
952 Ga0495586_0078008
953 Ga0495645_0099512
954 Ga0495668_0123449
955 Ga0495599_0084539
956 Ga0495658_0017161
957 Ga0495674_0101377
958 Ga0495674_0192004
959 Ga0495674_0231872
960 Ga0495674_0258342
961 Ga0495687_114890
962 Ga0495675_0144090
963 Ga0495684_0173861
964 Ga0495626_0000003
965 Ga0496101_0055932
966 Ga0496102_0007913
967 Ga0496103_0012057
968 Ga0496103_0068199
969 Ga0496104_0057473
970 Ga0496104_0061994
971 Ga0496104_0266686
972 Ga0496104_0505754
973 Ga0496105_0123762
974 Ga0496107_0033647
975 Ga0496108_0086984
976 Ga0496109_0041746
977 Ga0496112_0006190
978 Ga0496112_0010297
979 Ga0496112_0018853
980 Ga0496112_0049183
981 Ga0496112_0256813
982 Ga0496113_0139380
983 Ga0496113_0201736
984 Ga0496113_0326258
985 Ga0496114_0076394
986 Ga0496114_0079573
987 Ga0501034_0000590
988 Ga0501036_0198107
989 Ga0501040_0025246
990 Ga0501040_0039516
991 Ga0501041_0002695
992 Ga0501042_0024929
993 Ga0501046_0003482
994 Ga0501048_0023331
995 Ga0501068_0021656
996 Ga0501069_0058401
997 Ga0501070_0182628
998 Ga0501071_0036664
999 Ga0501072_0007442
1000 Ga0501072_0273490
1001 Ga0501073_0052550
1002 Ga0501074_0071267
1003 Ga0501075_0013817
1004 Ga0501075_0097866
1005 Ga0501076_0094076
1006 Ga0501077_0009934
1007 Ga0501079_0007790
1008 Ga0501080_0026348
1009 Ga0501080_0320665
1010 Ga0501081_0107373
1011 Ga0501083_0018144
1012 Ga0501045_0039333
1013 nmdc:mga0k408_27316_c1
1014 nmdc:mga0n895_156393_c1
1015 nmdc:mga0n895_430460_c1
1016 nmdc:mga0n895_576538_c1
1017 nmdc:mga0rr50_2693_c1
1018 nmdc:mga0rr50_461292_c1
1019 nmdc:mga0rr50_85608_c1
1020 nmdc:mga08x19_12027_c1
1021 nmdc:mga08x19_2727_c1
1022 nmdc:mga08x19_3787_c1
1023 nmdc:mga08x19_4266_c1
1024 nmdc:mga0a205_2420_c1
1025 Ga0500590_080186
1026 Ga0501084_0023151
1027 Ga0501082_0007886
1028 Ga0501082_0215609
1029 Ga0466962_0003437
1030 Ga0530510_0026895
1031 2643768421
1032 2644181130
1033 2689963577
1034 2723641106
1035 2852649202
1036 2919398220
1037 2935410535
1038 2945969641
1039 2946041778
1040 8004025219
1041 8004026786
1042 8055035513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06463

Mob_synth_C

Molybdenum Cofactor Synthesis C

266

393

0.98

PF04055

Radical_SAM

Radical SAM superfamily

162

261

0.94

PF04055

Radical_SAM

Radical SAM superfamily

16

105

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.9055 4 311
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.9055 4 311
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.8553 4 311
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.8529 4 311
6q2q-assembly2.cif.gz_B crystal structure of mouse viperin bound to uridine triphosphate and s-adenosylhomocysteine 0.8029 13 219
ID Description Score Start End Superfamily
af_P9WJS3_16_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.926 2 310 3.20.20.70
1tv8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9055 4 311 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8928 4 330 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8797 4 330 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8746 1 330 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3B9VX85-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) 0.9513 4 311 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-T1J5S9-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.948 41 311 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A658A6Q7-F1-model_v4 deleted 0.9465 46 152
AF-A0A382GUG3-F1-model_v4 Radical SAM core domain-containing protein 0.9461 42 186 GO:0006777
GO:0046872
GO:0051536
GO:0061798
GO:0061799
AF-A0A4D6LDM2-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.9448 41 282 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799

Map