F458661

General Info

Members Datasets Scaffolds Average Seq Length
521 273 1042 91

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100627701|Ga0070659_1006277011
Length 106
Sequence MTAARRKVGDDDRLRRSSFMPVSLLCPQLGDAALRLQLFTAAREAIRRWRPGFEKWQLTLFRSQSGDGWDLAISGPRFRRILTLNGPLDDLPGLVTAYVDAVLSNA

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
173 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
189 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 1.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.18
Nodule 0
Rhizoplane 4.41
Rhizosphere 89.83
Stem 0
Stem Tuber 0
Unclassified 27.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100627701 3300005366 Bacteria 925
2 MBSR1b_contig_12931879 2162886012 Unclassified 996
3 JGI24751J29686_10014800 3300002459 Bacteria 1610
4 Ga0058859_11300922 3300004798 Unclassified 529
5 Ga0065712_10077371 3300005290 Unclassified 3507
6 Ga0065712_10089724 3300005290 Bacteria 2456
7 Ga0065715_10030896 3300005293 Bacteria 1796
8 Ga0065715_10120244 3300005293 Bacteria 2263
9 Ga0065715_10175585 3300005293 Bacteria 1513
10 Ga0065715_10567408 3300005293 Bacteria 729
11 Ga0065715_10919867 3300005293 Bacteria 569
12 Ga0065715_10965043 3300005293 Unclassified 555
13 Ga0065707_10083381 3300005295 Bacteria 9382
14 Ga0065707_10221240 3300005295 Bacteria 1224
15 Ga0070676_10064161 3300005328 Bacteria 2189
16 Ga0070676_10150315 3300005328 Bacteria 1490
17 Ga0070676_10187803 3300005328 Bacteria 1347
18 Ga0070676_11274857 3300005328 Unclassified 560
19 Ga0070683_100046723 3300005329 Bacteria 4000
20 Ga0070683_100131555 3300005329 Bacteria 2368
21 Ga0070690_100045965 3300005330 Bacteria 2775
22 Ga0070690_100417332 3300005330 Bacteria 989
23 Ga0070670_100003061 3300005331 Bacteria 13836
24 Ga0070670_100025276 3300005331 Bacteria 5110
25 Ga0070670_100381343 3300005331 Bacteria 1242
26 Ga0070677_10056340 3300005333 Bacteria 1607
27 Ga0070677_10093872 3300005333 Bacteria 1310
28 Ga0070677_10223417 3300005333 Unclassified 921
29 Ga0068869_100566478 3300005334 Unclassified 956
30 Ga0068869_100799717 3300005334 Bacteria 810
31 Ga0068869_101281149 3300005334 Bacteria 646
32 Ga0070666_10057235 3300005335 Bacteria 2634
33 Ga0070666_10131286 3300005335 Unclassified 1741
34 Ga0070680_100034442 3300005336 Bacteria 4082
35 Ga0070680_100459109 3300005336 Unclassified 1088
36 Ga0070682_100289555 3300005337 Bacteria 1197
37 Ga0070682_100589169 3300005337 Bacteria 876
38 Ga0070682_100952091 3300005337 Bacteria 709
39 Ga0068868_100050545 3300005338 Bacteria 3266
40 Ga0070660_100095269 3300005339 Bacteria 2352
41 Ga0070689_100034024 3300005340 Bacteria 3886
42 Ga0070689_100138121 3300005340 Bacteria 1958
43 Ga0070689_100183397 3300005340 Unclassified 1701
44 Ga0070691_10639276 3300005341 Bacteria 632
45 Ga0070661_100076842 3300005344 Bacteria 2461
46 Ga0070661_100078380 3300005344 Bacteria 2437
47 Ga0070661_100779071 3300005344 Unclassified 784
48 Ga0070692_10617397 3300005345 Bacteria 719
49 Ga0070668_101423676 3300005347 Bacteria 632
50 Ga0070669_100000442 3300005353 Bacteria 31705
51 Ga0070669_100124006 3300005353 Bacteria 1975
52 Ga0070675_100045666 3300005354 Bacteria 3585
53 Ga0070675_100108661 3300005354 Unclassified 2343
54 Ga0070675_100176007 3300005354 Bacteria 1848
55 Ga0070675_100182521 3300005354 Unclassified 1815
56 Ga0070671_100208919 3300005355 Unclassified 1656
57 Ga0070671_100716492 3300005355 Unclassified 868
58 Ga0070674_100019394 3300005356 Bacteria 4320
59 Ga0070674_100297525 3300005356 Bacteria 1285
60 Ga0070674_100835850 3300005356 Bacteria 798
61 Ga0070674_101581642 3300005356 Unclassified 591
62 Ga0070674_102201718 3300005356 Bacteria 503
63 Ga0070673_100010028 3300005364 Bacteria 6392
64 Ga0070673_101660270 3300005364 Unclassified 604
65 Ga0070688_100227682 3300005365 Unclassified 1317
66 Ga0070659_100041813 3300005366 Unclassified 3584
67 Ga0070659_100399806 3300005366 Bacteria 1159
68 Ga0070659_101481386 3300005366 Unclassified 604
69 Ga0070659_101917793 3300005366 Bacteria 531
70 Ga0070667_100196004 3300005367 Bacteria 1790
71 Ga0070703_10027779 3300005406 Bacteria 1688
72 Ga0070714_101433729 3300005435 Bacteria 674
73 Ga0070713_100001966 3300005436 Bacteria 13264
74 Ga0070713_100570209 3300005436 Unclassified 1073
75 Ga0070701_10005053 3300005438 Bacteria 5415
76 Ga0070701_10149405 3300005438 Bacteria 1344
77 Ga0070711_100235498 3300005439 Bacteria 1429
78 Ga0070711_101596446 3300005439 Bacteria 570
79 Ga0070700_100016406 3300005441 Bacteria 4219
80 Ga0070700_100343522 3300005441 Bacteria 1104
81 Ga0070694_100408553 3300005444 Unclassified 1064
82 Ga0070694_100473984 3300005444 Bacteria 992
83 Ga0070663_101103401 3300005455 Bacteria 694
84 Ga0070662_100030736 3300005457 Bacteria 3762
85 Ga0070662_100155512 3300005457 Bacteria 1785
86 Ga0070662_100273380 3300005457 Bacteria 1365
87 Ga0070662_101082616 3300005457 Bacteria 687
88 Ga0070681_10140741 3300005458 Bacteria 2342
89 Ga0068867_100019532 3300005459 Bacteria 4829
90 Ga0068867_101343857 3300005459 Unclassified 661
91 Ga0070685_10122804 3300005466 Bacteria 1614
92 Ga0070679_100069441 3300005530 Bacteria 3514
93 Ga0070679_100649869 3300005530 Bacteria 997
94 Ga0070679_100889742 3300005530 Bacteria 834
95 Ga0070684_100019438 3300005535 Bacteria 5619
96 Ga0070684_100136492 3300005535 Bacteria 2216
97 Ga0068853_100529781 3300005539 Bacteria 1114
98 Ga0068853_101137567 3300005539 Bacteria 753
99 Ga0070672_100017793 3300005543 Bacteria 5122
100 Ga0070672_100193131 3300005543 Unclassified 1700
101 Ga0070672_100621138 3300005543 Bacteria 942
102 Ga0070672_101789740 3300005543 Unclassified 552
103 Ga0070686_100726148 3300005544 Unclassified 794
104 Ga0070695_100814782 3300005545 Unclassified 749
105 Ga0070696_100601147 3300005546 Unclassified 887
106 Ga0070693_100041882 3300005547 Bacteria 2578
107 Ga0070693_100445051 3300005547 Unclassified 908
108 Ga0070665_100734788 3300005548 Unclassified 1000
109 Ga0070704_100018664 3300005549 Bacteria 4441
110 Ga0070704_101392466 3300005549 Bacteria 643
111 Ga0070704_101975945 3300005549 Bacteria 541
112 Ga0068855_100125213 3300005563 Bacteria 2939
113 Ga0070664_100001823 3300005564 Bacteria 17069
114 Ga0070664_100271316 3300005564 Bacteria 1528
115 Ga0070664_100516446 3300005564 Bacteria 1102
116 Ga0070664_100584021 3300005564 Unclassified 1035
117 Ga0070664_101897546 3300005564 Bacteria 565
118 Ga0068857_100070105 3300005577 Bacteria 3122
119 Ga0068857_100457489 3300005577 Unclassified 1194
120 Ga0068854_100461280 3300005578 Bacteria 1063
121 Ga0070702_100025892 3300005615 Bacteria 3148
122 Ga0068852_101361842 3300005616 Unclassified 731
123 Ga0068852_101944138 3300005616 Unclassified 610
124 Ga0068859_100228546 3300005617 Bacteria 1948
125 Ga0068859_100313559 3300005617 Unclassified 1662
126 Ga0068864_100074618 3300005618 Unclassified 2959
127 Ga0068864_100564828 3300005618 Bacteria 1101
128 Ga0068864_101105071 3300005618 Bacteria 789
129 Ga0068866_10656135 3300005718 Bacteria 715
130 Ga0068866_10820069 3300005718 Unclassified 648
131 Ga0068861_100311034 3300005719 Bacteria 1369
132 Ga0068861_101682675 3300005719 Bacteria 627
133 Ga0068870_10663365 3300005840 Bacteria 716
134 Ga0068870_10807180 3300005840 Unclassified 656
135 Ga0068863_100188461 3300005841 Bacteria 1982
136 Ga0068863_101258518 3300005841 Bacteria 746
137 Ga0068858_100066974 3300005842 Bacteria 3325
138 Ga0068858_100254549 3300005842 Unclassified 1668
139 Ga0068860_100046400 3300005843 Bacteria 4142
140 Ga0068860_100894251 3300005843 Bacteria 904
141 Ga0068862_100033572 3300005844 Bacteria 4339
142 Ga0068862_100128419 3300005844 Bacteria 2240
143 Ga0081455_10719577 3300005937 Bacteria 634
144 Ga0075365_10060147 3300006038 Bacteria 2534
145 Ga0075365_10358432 3300006038 Bacteria 1028
146 Ga0075368_10136977 3300006042 Bacteria 1019
147 Ga0075368_10201028 3300006042 Unclassified 843
148 Ga0075364_10001115 3300006051 Bacteria 14338
149 Ga0075364_10006443 3300006051 Bacteria 6894
150 Ga0075362_10001884 3300006177 Bacteria 6878
151 Ga0075367_10005997 3300006178 Bacteria 6103
152 Ga0075367_10011739 3300006178 Bacteria 4648
153 Ga0075367_10060764 3300006178 Bacteria 2254
154 Ga0075366_10004835 3300006195 Bacteria 7266
155 Ga0075366_10012346 3300006195 Bacteria 4843
156 Ga0075366_10303245 3300006195 Bacteria 977
157 Ga0075370_10036999 3300006353 Bacteria 2743
158 Ga0068871_100675974 3300006358 Unclassified 944
159 Ga0075428_100011641 3300006844 Bacteria 9787
160 Ga0075430_100565260 3300006846 Bacteria 938
161 Ga0075433_10023467 3300006852 Bacteria 5193
162 Ga0075433_10087164 3300006852 Bacteria 2757
163 Ga0075433_10115737 3300006852 Bacteria 2379
164 Ga0075433_10128410 3300006852 Bacteria 2252
165 Ga0075433_10252841 3300006852 Bacteria 1563
166 Ga0075433_11297584 3300006852 Bacteria 631
167 Ga0075434_100047753 3300006871 Bacteria 4247
168 Ga0075434_100054270 3300006871 Bacteria 3982
169 Ga0075434_100323052 3300006871 Bacteria 1564
170 Ga0075434_100460603 3300006871 Bacteria 1293
171 Ga0075434_100531042 3300006871 Bacteria 1197
172 Ga0075434_100842695 3300006871 Bacteria 932
173 Ga0075434_101661936 3300006871 Unclassified 647
174 Ga0075429_100008601 3300006880 Bacteria 8879
175 Ga0075429_100365497 3300006880 Bacteria 1263
176 Ga0068865_100367552 3300006881 Unclassified 1170
177 Ga0068865_100760698 3300006881 Unclassified 833
178 Ga0075436_100621611 3300006914 Unclassified 797
179 Ga0075436_101508419 3300006914 Unclassified 511
180 Ga0097620_100228571 3300006931 Bacteria 1948
181 Ga0097620_100313535 3300006931 Unclassified 1662
182 Ga0075435_100007011 3300007076 Bacteria 7996
183 Ga0075435_100038716 3300007076 Bacteria 3802
184 Ga0105240_10559414 3300009093 Bacteria 1264
185 Ga0111539_10000973 3300009094 Bacteria 37589
186 Ga0111539_10254257 3300009094 Bacteria 2046
187 Ga0111539_10304596 3300009094 Bacteria 1854
188 Ga0111539_10511434 3300009094 Bacteria 1399
189 Ga0111539_10632848 3300009094 Bacteria 1246
190 Ga0111539_11560944 3300009094 Bacteria 766
191 Ga0105245_10385374 3300009098 Bacteria 1397
192 Ga0105245_11288456 3300009098 Bacteria 780
193 Ga0114129_10002661 3300009147 Bacteria 24853
194 Ga0114129_10055973 3300009147 Bacteria 5527
195 Ga0114129_10414398 3300009147 Bacteria 1773
196 Ga0114129_13304939 3300009147 Unclassified 521
197 Ga0105243_10045682 3300009148 Bacteria 3443
198 Ga0105243_11366255 3300009148 Unclassified 728
199 Ga0105243_11408664 3300009148 Bacteria 718
200 Ga0105242_10110074 3300009176 Bacteria 2346
201 Ga0105248_10158718 3300009177 Bacteria 2552
202 Ga0105248_10430135 3300009177 Unclassified 1487
203 Ga0105248_13431508 3300009177 Unclassified 503
204 Ga0105238_11006082 3300009551 Unclassified 854
205 Ga0105249_10006672 3300009553 Bacteria 10051
206 Ga0105249_10121355 3300009553 Bacteria 2484
207 Ga0105249_10641712 3300009553 Bacteria 1119
208 Ga0105249_10828944 3300009553 Bacteria 990
209 Ga0105249_10831070 3300009553 Bacteria 989
210 Ga0105239_10126941 3300010375 Bacteria 2836
211 Ga0105239_11688260 3300010375 Bacteria 733
212 Ga0105246_10075189 3300011119 Bacteria 2390
213 Ga0157373_10957553 3300013100 Bacteria 637
214 Ga0157378_10061686 3300013297 Bacteria 3347
215 Ga0157378_10453617 3300013297 Unclassified 1273
216 Ga0157378_11835491 3300013297 Unclassified 655
217 Ga0157372_11021154 3300013307 Bacteria 958
218 Ga0157375_10367361 3300013308 Unclassified 1605
219 Ga0163163_10022564 3300014325 Bacteria 5963
220 Ga0163163_10255262 3300014325 Bacteria 1804
221 Ga0163163_12628454 3300014325 Bacteria 561
222 Ga0157380_10231789 3300014326 Bacteria 1659
223 Ga0157380_11412058 3300014326 Bacteria 747
224 Ga0182008_10194924 3300014497 Bacteria 1029
225 Ga0157377_10437678 3300014745 Unclassified 900
226 Ga0157377_10959991 3300014745 Bacteria 644
227 Ga0157376_10307880 3300014969 Unclassified 1502
228 Ga0206356_11525009 3300020070 Bacteria 1227
229 Ga0206354_11598478 3300020081 Bacteria 615
230 Ga0207666_1036645 3300025271 Unclassified 762
231 Ga0207697_10050549 3300025315 Unclassified 1717
232 Ga0207682_10115856 3300025893 Bacteria 1184
233 Ga0207682_10191016 3300025893 Unclassified 938
234 Ga0207688_10163745 3300025901 Unclassified 1320
235 Ga0207688_10172410 3300025901 Bacteria 1287
236 Ga0207680_10022038 3300025903 Bacteria 3459
237 Ga0207645_10020383 3300025907 Bacteria 4340
238 Ga0207645_10658570 3300025907 Unclassified 711
239 Ga0207643_10608034 3300025908 Unclassified 704
240 Ga0207707_10201675 3300025912 Unclassified 1734
241 Ga0207695_10421334 3300025913 Bacteria 1219
242 Ga0207663_10203844 3300025916 Bacteria 1429
243 Ga0207663_11369796 3300025916 Bacteria 570
244 Ga0207660_10359787 3300025917 Bacteria 1167
245 Ga0207649_10075638 3300025920 Unclassified 2165
246 Ga0207649_10290992 3300025920 Unclassified 1191
247 Ga0207649_10445841 3300025920 Bacteria 976
248 Ga0207652_10199339 3300025921 Bacteria 1802
249 Ga0207652_10360346 3300025921 Unclassified 1312
250 Ga0207652_11898944 3300025921 Unclassified 501
251 Ga0207681_10008449 3300025923 Bacteria 6293
252 Ga0207681_10031452 3300025923 Bacteria 3466
253 Ga0207650_10039728 3300025925 Bacteria 3439
254 Ga0207650_10062028 3300025925 Bacteria 2792
255 Ga0207650_10072094 3300025925 Bacteria 2600
256 Ga0207650_10337886 3300025925 Bacteria 1236
257 Ga0207659_10034269 3300025926 Bacteria 3499
258 Ga0207659_10083344 3300025926 Unclassified 2370
259 Ga0207659_10231210 3300025926 Unclassified 1491
260 Ga0207687_10242505 3300025927 Bacteria 1429
261 Ga0207687_10799697 3300025927 Bacteria 804
262 Ga0207700_10047678 3300025928 Bacteria 3177
263 Ga0207644_10102186 3300025931 Bacteria 2155
264 Ga0207690_10087830 3300025932 Bacteria 2189
265 Ga0207690_10544226 3300025932 Bacteria 943
266 Ga0207690_10561552 3300025932 Bacteria 929
267 Ga0207690_10775059 3300025932 Bacteria 792
268 Ga0207706_10188815 3300025933 Bacteria 1809
269 Ga0207706_10192296 3300025933 Bacteria 1791
270 Ga0207706_10328695 3300025933 Unclassified 1330
271 Ga0207706_11289844 3300025933 Unclassified 604
272 Ga0207686_10363303 3300025934 Bacteria 1093
273 Ga0207709_10193466 3300025935 Unclassified 1447
274 Ga0207709_10575073 3300025935 Unclassified 889
275 Ga0207670_10071461 3300025936 Bacteria 2400
276 Ga0207670_11674329 3300025936 Unclassified 541
277 Ga0207669_10531467 3300025937 Bacteria 946
278 Ga0207669_11325417 3300025937 Bacteria 612
279 Ga0207704_10137339 3300025938 Bacteria 1704
280 Ga0207704_10249056 3300025938 Unclassified 1332
281 Ga0207691_10002955 3300025940 Bacteria 16594
282 Ga0207691_10063305 3300025940 Unclassified 3354
283 Ga0207691_10285119 3300025940 Bacteria 1421
284 Ga0207711_10279089 3300025941 Unclassified 1538
285 Ga0207689_10003739 3300025942 Bacteria 13870
286 Ga0207661_10003343 3300025944 Bacteria 11127
287 Ga0207661_10021064 3300025944 Bacteria 4883
288 Ga0207679_10053238 3300025945 Unclassified 2973
289 Ga0207679_10282593 3300025945 Bacteria 1424
290 Ga0207679_10481191 3300025945 Unclassified 1105
291 Ga0207679_10521909 3300025945 Unclassified 1062
292 Ga0207679_10557241 3300025945 Bacteria 1029
293 Ga0207667_11455369 3300025949 Bacteria 657
294 Ga0207651_10059910 3300025960 Bacteria 2639
295 Ga0207651_11512644 3300025960 Unclassified 604
296 Ga0207712_10012893 3300025961 Bacteria 5350
297 Ga0207712_10520307 3300025961 Bacteria 1019
298 Ga0207668_10342323 3300025972 Bacteria 1248
299 Ga0207668_12118404 3300025972 Unclassified 506
300 Ga0207640_10064934 3300025981 Bacteria 2433
301 Ga0207658_10294852 3300025986 Bacteria 1395
302 Ga0207677_10107028 3300026023 Unclassified 2073
303 Ga0207703_10748124 3300026035 Unclassified 931
304 Ga0207639_11085313 3300026041 Unclassified 750
305 Ga0207639_11603063 3300026041 Bacteria 611
306 Ga0207678_10105943 3300026067 Bacteria 2399
307 Ga0207678_10251061 3300026067 Bacteria 1515
308 Ga0207708_10041224 3300026075 Bacteria 3519
309 Ga0207708_10453082 3300026075 Bacteria 1069
310 Ga0207708_10490807 3300026075 Bacteria 1028
311 Ga0207708_11042599 3300026075 Bacteria 712
312 Ga0207641_10175046 3300026088 Bacteria 1962
313 Ga0207641_11613997 3300026088 Unclassified 650
314 Ga0207648_10043176 3300026089 Bacteria 3958
315 Ga0207648_10057489 3300026089 Bacteria 3394
316 Ga0207676_10868043 3300026095 Bacteria 883
317 Ga0207676_11835441 3300026095 Bacteria 605
318 Ga0207674_10148714 3300026116 Bacteria 2300
319 Ga0207674_10578023 3300026116 Unclassified 1085
320 Ga0207675_100010727 3300026118 Bacteria 8583
321 Ga0207675_100225287 3300026118 Bacteria 1807
322 Ga0207675_101608545 3300026118 Bacteria 670
323 Ga0207675_102076758 3300026118 Unclassified 585
324 Ga0207683_10232228 3300026121 Bacteria 1682
325 Ga0207683_10579860 3300026121 Bacteria 1037
326 Ga0207698_10113673 3300026142 Bacteria 2275
327 Ga0207698_10921918 3300026142 Unclassified 882
328 Ga0209970_1033817 3300027614 Bacteria 895
329 Ga0210002_1030227 3300027617 Bacteria 899
330 Ga0207428_10014917 3300027907 Bacteria 6731
331 Ga0207428_10611684 3300027907 Bacteria 784
332 Ga0268265_10015035 3300028380 Bacteria 5286
333 Ga0268265_10133791 3300028380 Bacteria 2065
334 Ga0268264_10188919 3300028381 Bacteria 1876
335 Ga0307408_100064601 3300031548 Unclassified 2681
336 Ga0307405_10174943 3300031731 Unclassified 1535
337 Ga0307405_10572762 3300031731 Bacteria 917
338 Ga0307413_10661115 3300031824 Bacteria 863
339 Ga0307410_10750267 3300031852 Unclassified 826
340 Ga0307406_10475683 3300031901 Bacteria 1008
341 Ga0307406_11958911 3300031901 Unclassified 523
342 Ga0307412_11115641 3300031911 Bacteria 703
343 Ga0307412_11774636 3300031911 Bacteria 567
344 Ga0307409_100977472 3300031995 Unclassified 864
345 Ga0307409_101046155 3300031995 Unclassified 836
346 Ga0307409_101121026 3300031995 Bacteria 808
347 Ga0307416_100054014 3300032002 Bacteria 3227
348 Ga0307416_100060190 3300032002 Bacteria 3091
349 Ga0307416_100879408 3300032002 Unclassified 995
350 Ga0307416_102130559 3300032002 Bacteria 662
351 Ga0307414_11827094 3300032004 Unclassified 567
352 Ga0307411_10246643 3300032005 Unclassified 1402
353 Ga0307411_10396811 3300032005 Bacteria 1139
354 Ga0307411_10420654 3300032005 Bacteria 1110
355 Ga0373958_0067568 3300034819 Bacteria 787
356 Ga0373928_0074786 3300035084 Bacteria 844
357 Ga0373944_0031431 3300035089 Bacteria 1598
358 Ga0373949_0023590 3300035090 Bacteria 1425
359 Ga0373923_0239486 3300035111 Bacteria 847
360 Ga0373945_0061341 3300035116 Bacteria 1404
361 Ga0373956_0468105 3300035119 Bacteria 601
362 Ga0373943_0166325 3300035170 Unclassified 1204
363 Ga0373943_0180463 3300035170 Bacteria 1160
364 Ga0373946_0053788 3300035171 Bacteria 1692
365 Ga0373931_0267379 3300035691 Bacteria 1046
366 Ga0373931_1042052 3300035691 Unclassified 555
367 Ga0373935_0233377 3300035692 Bacteria 1282
368 Ga0373933_0300385 3300035724 Bacteria 1039
369 Ga0373947_0177679 3300035725 Unclassified 1384
370 Ga0373947_1195689 3300035725 Bacteria 518
371 Ga0373937_0001826 3300036401 Bacteria 17866
372 Ga0373937_0676728 3300036401 Bacteria 978
373 Ga0373937_1982423 3300036401 Bacteria 528
374 Ga0373925_0446251 3300037068 Bacteria 1059
375 Ga0436365_1605317 3300039437 Bacteria 843
376 Ga0439439_0194065 3300041406 Bacteria 588
377 Ga0451800_1413744 3300041459 Bacteria 595
378 Ga0451807_0691833 3300041486 Bacteria 1588
379 Ga0451807_0957130 3300041486 Unclassified 557
380 Ga0451853_3341908 3300041512 Unclassified 629
381 Ga0439449_0175762 3300042007 Bacteria 800
382 Ga0439462_0082735 3300042015 Bacteria 877
383 Ga0439446_0008398 3300042156 Bacteria 2740
384 Ga0439434_0100400 3300042435 Bacteria 932
385 Ga0451577_0111700 3300042876 Bacteria 2445
386 Ga0451577_0426021 3300042876 Bacteria 1205
387 Ga0453684_0217495 3300044712 Bacteria 2216
388 Ga0451576_0484568 3300045051 Unclassified 1299
389 Ga0466967_0295999 3300045976 Bacteria 1556
390 Ga0495629_0268659 3300046459 Bacteria 1172
391 Ga0495656_0182771 3300046615 Bacteria 1031
392 Ga0495658_0678613 3300046683 Bacteria 660
393 Ga0495613_0621165 3300046689 Bacteria 717
394 Ga0495600_0710374 3300046809 Bacteria 604
395 Ga0495604_0792605 3300047317 Bacteria 597
396 Ga0495674_0116815 3300047319 Bacteria 2257
397 Ga0496101_1268133 3300048904 Unclassified 577
398 Ga0496102_0307933 3300048905 Unclassified 1493
399 Ga0496103_0468236 3300048906 Unclassified 808
400 Ga0496104_0058188 3300048907 Bacteria 3658
401 Ga0496104_0134418 3300048907 Bacteria 2376
402 Ga0496105_0242109 3300048908 Unclassified 1463
403 Ga0496106_0183223 3300048909 Bacteria 1663
404 Ga0496107_0227700 3300048910 Bacteria 1387
405 Ga0496108_0001541 3300048911 Bacteria 18246
406 Ga0496108_1413825 3300048911 Bacteria 581
407 Ga0496109_0002482 3300048912 Bacteria 15456
408 Ga0496109_0261824 3300048912 Bacteria 1629
409 Ga0496109_0967928 3300048912 Unclassified 789
410 Ga0496109_1418359 3300048912 Unclassified 630
411 Ga0496110_0001637 3300048913 Bacteria 16436
412 Ga0496112_0000511 3300048915 Bacteria 26327
413 Ga0496112_0079307 3300048915 Bacteria 3248
414 Ga0496112_1048571 3300048915 Unclassified 734
415 Ga0496113_0336677 3300048916 Bacteria 1210
416 Ga0496113_1287939 3300048916 Unclassified 569
417 Ga0501292_123181 3300049515 Unclassified 530
418 Ga0501031_0218555 3300049568 Unclassified 1241
419 Ga0501031_0244508 3300049568 Bacteria 1166
420 Ga0501034_0009522 3300049571 Bacteria 10169
421 Ga0501036_0236068 3300049572 Bacteria 1534
422 Ga0501038_1299046 3300049574 Unclassified 525
423 Ga0501039_0636739 3300049575 Bacteria 835
424 Ga0501040_0026538 3300049576 Bacteria 3897
425 Ga0501040_0825656 3300049576 Bacteria 671
426 Ga0501041_0206838 3300049577 Bacteria 1231
427 Ga0501042_0456275 3300049578 Unclassified 927
428 Ga0501042_1143166 3300049578 Unclassified 568
429 Ga0501046_0296366 3300049580 Bacteria 1182
430 Ga0501047_0125082 3300049581 Bacteria 2452
431 Ga0501047_0811667 3300049581 Unclassified 750
432 Ga0501048_0785237 3300049582 Bacteria 684
433 Ga0501048_1007353 3300049582 Bacteria 599
434 Ga0501067_0065044 3300049583 Bacteria 2019
435 Ga0501067_0149000 3300049583 Bacteria 1303
436 Ga0501070_0507844 3300049586 Unclassified 968
437 Ga0501070_1244555 3300049586 Unclassified 570
438 Ga0501070_1527165 3300049586 Bacteria 505
439 Ga0501071_0063307 3300049587 Bacteria 2682
440 Ga0501071_0253697 3300049587 Unclassified 1328
441 Ga0501072_0067480 3300049588 Bacteria 2822
442 Ga0501072_0110817 3300049588 Unclassified 2185
443 Ga0501072_0277138 3300049588 Bacteria 1334
444 Ga0501073_0271595 3300049589 Unclassified 1170
445 Ga0501073_0373597 3300049589 Bacteria 985
446 Ga0501074_0015454 3300049590 Bacteria 5549
447 Ga0501075_0046791 3300049591 Bacteria 3250
448 Ga0501075_0618189 3300049591 Bacteria 826
449 Ga0501076_0004191 3300049592 Bacteria 10210
450 Ga0501076_0984103 3300049592 Bacteria 695
451 Ga0501076_1399619 3300049592 Unclassified 575
452 Ga0501077_0769760 3300049593 Unclassified 619
453 Ga0501077_1039304 3300049593 Unclassified 527
454 Ga0501209_139474 3300049656 Unclassified 726
455 Ga0501080_0285969 3300049742 Bacteria 1498
456 Ga0501080_0500857 3300049742 Unclassified 1085
457 Ga0501081_0028139 3300049743 Unclassified 3792
458 Ga0501081_0897212 3300049743 Unclassified 668
459 Ga0501035_0868172 3300049822 Bacteria 717
460 Ga0501045_0038220 3300049824 Bacteria 3491
461 Ga0501045_0306468 3300049824 Bacteria 1182
462 Ga0501045_0554772 3300049824 Bacteria 852
463 Ga0501045_1409803 3300049824 Bacteria 506
464 nmdc:mga03683_4427_c1 3300050489 Bacteria 4660
465 nmdc:mga00v17_3023_c1 3300050491 Bacteria 8643
466 nmdc:mga00v17_323111_c1 3300050491 Unclassified 1003
467 nmdc:mga00v17_9789_c1 3300050491 Bacteria 5207
468 nmdc:mga0yw44_178946_c1 3300050492 Bacteria 1395
469 nmdc:mga0k408_702_c1 3300050493 Bacteria 18324
470 nmdc:mga0k408_750152_c1 3300050493 Unclassified 570
471 nmdc:mga0k408_8898_c1 3300050493 Bacteria 5401
472 nmdc:mga06z11_1728_c1 3300050494 Bacteria 8212
473 nmdc:mga06z11_179347_c1 3300050494 Unclassified 1220
474 nmdc:mga06z11_57243_c1 3300050494 Bacteria 2019
475 nmdc:mga04h51_24467_c1 3300050495 Bacteria 1849
476 nmdc:mga07m45_76391_c1 3300050496 Bacteria 1910
477 nmdc:mga05p37_44081_c1 3300050507 Bacteria 5489
478 nmdc:mga05p37_46617_c1 3300050507 Bacteria 5329
479 nmdc:mga09592_1029728_c1 3300050508 Unclassified 687
480 nmdc:mga09592_39672_c1 3300050508 Bacteria 3955
481 nmdc:mga09592_962407_c1 3300050508 Bacteria 715
482 nmdc:mga0qj67_244439_c1 3300050509 Bacteria 1456
483 nmdc:mga0qj67_480873_c1 3300050509 Bacteria 999
484 nmdc:mga06r32_1268757_c1 3300050510 Bacteria 681
485 nmdc:mga08y16_1712664_c1 3300050511 Bacteria 584
486 nmdc:mga08y16_2077564_c1 3300050511 Bacteria 516
487 nmdc:mga08y16_262536_c1 3300050511 Bacteria 1783
488 nmdc:mga08y16_359418_c1 3300050511 Bacteria 1495
489 nmdc:mga08y16_487057_c1 3300050511 Bacteria 1254
490 nmdc:mga08y16_9075_c1 3300050511 Bacteria 10439
491 nmdc:mga0n895_2230789_c1 3300050512 Bacteria 503
492 nmdc:mga0n895_2257_c1 3300050512 Bacteria 14931
493 nmdc:mga0n895_291108_c1 3300050512 Bacteria 1656
494 nmdc:mga0n895_310473_c1 3300050512 Unclassified 681
495 nmdc:mga0n895_486689_c1 3300050512 Bacteria 1244
496 nmdc:mga0n895_660790_c1 3300050512 Bacteria 1043
497 nmdc:mga0n895_903196_c1 3300050512 Bacteria 869
498 nmdc:mga0rr50_137726_c1 3300050513 Bacteria 1961
499 nmdc:mga08x19_607476_c1 3300050514 Unclassified 775
500 nmdc:mga08x19_937008_c1 3300050514 Unclassified 615
501 nmdc:mga0a205_140522_c1 3300050515 Bacteria 2315
502 nmdc:mga0a205_1491837_c1 3300050515 Unclassified 524
503 nmdc:mga0a205_21745_c1 3300050515 Bacteria 6065
504 nmdc:mga0a205_73995_c1 3300050515 Bacteria 3291
505 nmdc:mga0a205_95722_c1 3300050515 Bacteria 2868
506 Ga0495601_0050673 3300053077 Unclassified 2619
507 Ga0495595_0083533 3300053084 Bacteria 1525
508 Ga0495619_0299403 3300053085 Bacteria 1114
509 Ga0501084_0276367 3300054114 Bacteria 1418
510 Ga0590071_006285 3300059421 Bacteria 2828
511 Ga0590074_004047 3300059423 Bacteria 2423
512 Ga0590074_032431 3300059423 Bacteria 925
513 Ga0587088_018316 3300059508 Bacteria 1138
514 Ga0587094_047949 3300059513 Bacteria 715
515 Ga0587113_007690 3300059625 Unclassified 944
516 Ga0587075_020261 3300059644 Bacteria 981
517 Ga0587114_062485 3300059655 Bacteria 657
518 Ga0501082_0559996 3300060353 Bacteria 1000
519 Ga0501082_0768860 3300060353 Unclassified 843
520 Ga0501082_1193654 3300060353 Unclassified 665
521 Ga0530510_0164798 3300061734 Bacteria 1640
522 Ga0070659_100627701
523 MBSR1b_contig_12931879
524 JGI24751J29686_10014800
525 Ga0058859_11300922
526 Ga0065712_10077371
527 Ga0065712_10089724
528 Ga0065715_10030896
529 Ga0065715_10120244
530 Ga0065715_10175585
531 Ga0065715_10567408
532 Ga0065715_10919867
533 Ga0065715_10965043
534 Ga0065707_10083381
535 Ga0065707_10221240
536 Ga0070676_10064161
537 Ga0070676_10150315
538 Ga0070676_10187803
539 Ga0070676_11274857
540 Ga0070683_100046723
541 Ga0070683_100131555
542 Ga0070690_100045965
543 Ga0070690_100417332
544 Ga0070670_100003061
545 Ga0070670_100025276
546 Ga0070670_100381343
547 Ga0070677_10056340
548 Ga0070677_10093872
549 Ga0070677_10223417
550 Ga0068869_100566478
551 Ga0068869_100799717
552 Ga0068869_101281149
553 Ga0070666_10057235
554 Ga0070666_10131286
555 Ga0070680_100034442
556 Ga0070680_100459109
557 Ga0070682_100289555
558 Ga0070682_100589169
559 Ga0070682_100952091
560 Ga0068868_100050545
561 Ga0070660_100095269
562 Ga0070689_100034024
563 Ga0070689_100138121
564 Ga0070689_100183397
565 Ga0070691_10639276
566 Ga0070661_100076842
567 Ga0070661_100078380
568 Ga0070661_100779071
569 Ga0070692_10617397
570 Ga0070668_101423676
571 Ga0070669_100000442
572 Ga0070669_100124006
573 Ga0070675_100045666
574 Ga0070675_100108661
575 Ga0070675_100176007
576 Ga0070675_100182521
577 Ga0070671_100208919
578 Ga0070671_100716492
579 Ga0070674_100019394
580 Ga0070674_100297525
581 Ga0070674_100835850
582 Ga0070674_101581642
583 Ga0070674_102201718
584 Ga0070673_100010028
585 Ga0070673_101660270
586 Ga0070688_100227682
587 Ga0070659_100041813
588 Ga0070659_100399806
589 Ga0070659_101481386
590 Ga0070659_101917793
591 Ga0070667_100196004
592 Ga0070703_10027779
593 Ga0070714_101433729
594 Ga0070713_100001966
595 Ga0070713_100570209
596 Ga0070701_10005053
597 Ga0070701_10149405
598 Ga0070711_100235498
599 Ga0070711_101596446
600 Ga0070700_100016406
601 Ga0070700_100343522
602 Ga0070694_100408553
603 Ga0070694_100473984
604 Ga0070663_101103401
605 Ga0070662_100030736
606 Ga0070662_100155512
607 Ga0070662_100273380
608 Ga0070662_101082616
609 Ga0070681_10140741
610 Ga0068867_100019532
611 Ga0068867_101343857
612 Ga0070685_10122804
613 Ga0070679_100069441
614 Ga0070679_100649869
615 Ga0070679_100889742
616 Ga0070684_100019438
617 Ga0070684_100136492
618 Ga0068853_100529781
619 Ga0068853_101137567
620 Ga0070672_100017793
621 Ga0070672_100193131
622 Ga0070672_100621138
623 Ga0070672_101789740
624 Ga0070686_100726148
625 Ga0070695_100814782
626 Ga0070696_100601147
627 Ga0070693_100041882
628 Ga0070693_100445051
629 Ga0070665_100734788
630 Ga0070704_100018664
631 Ga0070704_101392466
632 Ga0070704_101975945
633 Ga0068855_100125213
634 Ga0070664_100001823
635 Ga0070664_100271316
636 Ga0070664_100516446
637 Ga0070664_100584021
638 Ga0070664_101897546
639 Ga0068857_100070105
640 Ga0068857_100457489
641 Ga0068854_100461280
642 Ga0070702_100025892
643 Ga0068852_101361842
644 Ga0068852_101944138
645 Ga0068859_100228546
646 Ga0068859_100313559
647 Ga0068864_100074618
648 Ga0068864_100564828
649 Ga0068864_101105071
650 Ga0068866_10656135
651 Ga0068866_10820069
652 Ga0068861_100311034
653 Ga0068861_101682675
654 Ga0068870_10663365
655 Ga0068870_10807180
656 Ga0068863_100188461
657 Ga0068863_101258518
658 Ga0068858_100066974
659 Ga0068858_100254549
660 Ga0068860_100046400
661 Ga0068860_100894251
662 Ga0068862_100033572
663 Ga0068862_100128419
664 Ga0081455_10719577
665 Ga0075365_10060147
666 Ga0075365_10358432
667 Ga0075368_10136977
668 Ga0075368_10201028
669 Ga0075364_10001115
670 Ga0075364_10006443
671 Ga0075362_10001884
672 Ga0075367_10005997
673 Ga0075367_10011739
674 Ga0075367_10060764
675 Ga0075366_10004835
676 Ga0075366_10012346
677 Ga0075366_10303245
678 Ga0075370_10036999
679 Ga0068871_100675974
680 Ga0075428_100011641
681 Ga0075430_100565260
682 Ga0075433_10023467
683 Ga0075433_10087164
684 Ga0075433_10115737
685 Ga0075433_10128410
686 Ga0075433_10252841
687 Ga0075433_11297584
688 Ga0075434_100047753
689 Ga0075434_100054270
690 Ga0075434_100323052
691 Ga0075434_100460603
692 Ga0075434_100531042
693 Ga0075434_100842695
694 Ga0075434_101661936
695 Ga0075429_100008601
696 Ga0075429_100365497
697 Ga0068865_100367552
698 Ga0068865_100760698
699 Ga0075436_100621611
700 Ga0075436_101508419
701 Ga0097620_100228571
702 Ga0097620_100313535
703 Ga0075435_100007011
704 Ga0075435_100038716
705 Ga0105240_10559414
706 Ga0111539_10000973
707 Ga0111539_10254257
708 Ga0111539_10304596
709 Ga0111539_10511434
710 Ga0111539_10632848
711 Ga0111539_11560944
712 Ga0105245_10385374
713 Ga0105245_11288456
714 Ga0114129_10002661
715 Ga0114129_10055973
716 Ga0114129_10414398
717 Ga0114129_13304939
718 Ga0105243_10045682
719 Ga0105243_11366255
720 Ga0105243_11408664
721 Ga0105242_10110074
722 Ga0105248_10158718
723 Ga0105248_10430135
724 Ga0105248_13431508
725 Ga0105238_11006082
726 Ga0105249_10006672
727 Ga0105249_10121355
728 Ga0105249_10641712
729 Ga0105249_10828944
730 Ga0105249_10831070
731 Ga0105239_10126941
732 Ga0105239_11688260
733 Ga0105246_10075189
734 Ga0157373_10957553
735 Ga0157378_10061686
736 Ga0157378_10453617
737 Ga0157378_11835491
738 Ga0157372_11021154
739 Ga0157375_10367361
740 Ga0163163_10022564
741 Ga0163163_10255262
742 Ga0163163_12628454
743 Ga0157380_10231789
744 Ga0157380_11412058
745 Ga0182008_10194924
746 Ga0157377_10437678
747 Ga0157377_10959991
748 Ga0157376_10307880
749 Ga0206356_11525009
750 Ga0206354_11598478
751 Ga0207666_1036645
752 Ga0207697_10050549
753 Ga0207682_10115856
754 Ga0207682_10191016
755 Ga0207688_10163745
756 Ga0207688_10172410
757 Ga0207680_10022038
758 Ga0207645_10020383
759 Ga0207645_10658570
760 Ga0207643_10608034
761 Ga0207707_10201675
762 Ga0207695_10421334
763 Ga0207663_10203844
764 Ga0207663_11369796
765 Ga0207660_10359787
766 Ga0207649_10075638
767 Ga0207649_10290992
768 Ga0207649_10445841
769 Ga0207652_10199339
770 Ga0207652_10360346
771 Ga0207652_11898944
772 Ga0207681_10008449
773 Ga0207681_10031452
774 Ga0207650_10039728
775 Ga0207650_10062028
776 Ga0207650_10072094
777 Ga0207650_10337886
778 Ga0207659_10034269
779 Ga0207659_10083344
780 Ga0207659_10231210
781 Ga0207687_10242505
782 Ga0207687_10799697
783 Ga0207700_10047678
784 Ga0207644_10102186
785 Ga0207690_10087830
786 Ga0207690_10544226
787 Ga0207690_10561552
788 Ga0207690_10775059
789 Ga0207706_10188815
790 Ga0207706_10192296
791 Ga0207706_10328695
792 Ga0207706_11289844
793 Ga0207686_10363303
794 Ga0207709_10193466
795 Ga0207709_10575073
796 Ga0207670_10071461
797 Ga0207670_11674329
798 Ga0207669_10531467
799 Ga0207669_11325417
800 Ga0207704_10137339
801 Ga0207704_10249056
802 Ga0207691_10002955
803 Ga0207691_10063305
804 Ga0207691_10285119
805 Ga0207711_10279089
806 Ga0207689_10003739
807 Ga0207661_10003343
808 Ga0207661_10021064
809 Ga0207679_10053238
810 Ga0207679_10282593
811 Ga0207679_10481191
812 Ga0207679_10521909
813 Ga0207679_10557241
814 Ga0207667_11455369
815 Ga0207651_10059910
816 Ga0207651_11512644
817 Ga0207712_10012893
818 Ga0207712_10520307
819 Ga0207668_10342323
820 Ga0207668_12118404
821 Ga0207640_10064934
822 Ga0207658_10294852
823 Ga0207677_10107028
824 Ga0207703_10748124
825 Ga0207639_11085313
826 Ga0207639_11603063
827 Ga0207678_10105943
828 Ga0207678_10251061
829 Ga0207708_10041224
830 Ga0207708_10453082
831 Ga0207708_10490807
832 Ga0207708_11042599
833 Ga0207641_10175046
834 Ga0207641_11613997
835 Ga0207648_10043176
836 Ga0207648_10057489
837 Ga0207676_10868043
838 Ga0207676_11835441
839 Ga0207674_10148714
840 Ga0207674_10578023
841 Ga0207675_100010727
842 Ga0207675_100225287
843 Ga0207675_101608545
844 Ga0207675_102076758
845 Ga0207683_10232228
846 Ga0207683_10579860
847 Ga0207698_10113673
848 Ga0207698_10921918
849 Ga0209970_1033817
850 Ga0210002_1030227
851 Ga0207428_10014917
852 Ga0207428_10611684
853 Ga0268265_10015035
854 Ga0268265_10133791
855 Ga0268264_10188919
856 Ga0307408_100064601
857 Ga0307405_10174943
858 Ga0307405_10572762
859 Ga0307413_10661115
860 Ga0307410_10750267
861 Ga0307406_10475683
862 Ga0307406_11958911
863 Ga0307412_11115641
864 Ga0307412_11774636
865 Ga0307409_100977472
866 Ga0307409_101046155
867 Ga0307409_101121026
868 Ga0307416_100054014
869 Ga0307416_100060190
870 Ga0307416_100879408
871 Ga0307416_102130559
872 Ga0307414_11827094
873 Ga0307411_10246643
874 Ga0307411_10396811
875 Ga0307411_10420654
876 Ga0373958_0067568
877 Ga0373928_0074786
878 Ga0373944_0031431
879 Ga0373949_0023590
880 Ga0373923_0239486
881 Ga0373945_0061341
882 Ga0373956_0468105
883 Ga0373943_0166325
884 Ga0373943_0180463
885 Ga0373946_0053788
886 Ga0373931_0267379
887 Ga0373931_1042052
888 Ga0373935_0233377
889 Ga0373933_0300385
890 Ga0373947_0177679
891 Ga0373947_1195689
892 Ga0373937_0001826
893 Ga0373937_0676728
894 Ga0373937_1982423
895 Ga0373925_0446251
896 Ga0436365_1605317
897 Ga0439439_0194065
898 Ga0451800_1413744
899 Ga0451807_0691833
900 Ga0451807_0957130
901 Ga0451853_3341908
902 Ga0439449_0175762
903 Ga0439462_0082735
904 Ga0439446_0008398
905 Ga0439434_0100400
906 Ga0451577_0111700
907 Ga0451577_0426021
908 Ga0453684_0217495
909 Ga0451576_0484568
910 Ga0466967_0295999
911 Ga0495629_0268659
912 Ga0495656_0182771
913 Ga0495658_0678613
914 Ga0495613_0621165
915 Ga0495600_0710374
916 Ga0495604_0792605
917 Ga0495674_0116815
918 Ga0496101_1268133
919 Ga0496102_0307933
920 Ga0496103_0468236
921 Ga0496104_0058188
922 Ga0496104_0134418
923 Ga0496105_0242109
924 Ga0496106_0183223
925 Ga0496107_0227700
926 Ga0496108_0001541
927 Ga0496108_1413825
928 Ga0496109_0002482
929 Ga0496109_0261824
930 Ga0496109_0967928
931 Ga0496109_1418359
932 Ga0496110_0001637
933 Ga0496112_0000511
934 Ga0496112_0079307
935 Ga0496112_1048571
936 Ga0496113_0336677
937 Ga0496113_1287939
938 Ga0501292_123181
939 Ga0501031_0218555
940 Ga0501031_0244508
941 Ga0501034_0009522
942 Ga0501036_0236068
943 Ga0501038_1299046
944 Ga0501039_0636739
945 Ga0501040_0026538
946 Ga0501040_0825656
947 Ga0501041_0206838
948 Ga0501042_0456275
949 Ga0501042_1143166
950 Ga0501046_0296366
951 Ga0501047_0125082
952 Ga0501047_0811667
953 Ga0501048_0785237
954 Ga0501048_1007353
955 Ga0501067_0065044
956 Ga0501067_0149000
957 Ga0501070_0507844
958 Ga0501070_1244555
959 Ga0501070_1527165
960 Ga0501071_0063307
961 Ga0501071_0253697
962 Ga0501072_0067480
963 Ga0501072_0110817
964 Ga0501072_0277138
965 Ga0501073_0271595
966 Ga0501073_0373597
967 Ga0501074_0015454
968 Ga0501075_0046791
969 Ga0501075_0618189
970 Ga0501076_0004191
971 Ga0501076_0984103
972 Ga0501076_1399619
973 Ga0501077_0769760
974 Ga0501077_1039304
975 Ga0501209_139474
976 Ga0501080_0285969
977 Ga0501080_0500857
978 Ga0501081_0028139
979 Ga0501081_0897212
980 Ga0501035_0868172
981 Ga0501045_0038220
982 Ga0501045_0306468
983 Ga0501045_0554772
984 Ga0501045_1409803
985 nmdc:mga03683_4427_c1
986 nmdc:mga00v17_3023_c1
987 nmdc:mga00v17_323111_c1
988 nmdc:mga00v17_9789_c1
989 nmdc:mga0yw44_178946_c1
990 nmdc:mga0k408_702_c1
991 nmdc:mga0k408_750152_c1
992 nmdc:mga0k408_8898_c1
993 nmdc:mga06z11_1728_c1
994 nmdc:mga06z11_179347_c1
995 nmdc:mga06z11_57243_c1
996 nmdc:mga04h51_24467_c1
997 nmdc:mga07m45_76391_c1
998 nmdc:mga05p37_44081_c1
999 nmdc:mga05p37_46617_c1
1000 nmdc:mga09592_1029728_c1
1001 nmdc:mga09592_39672_c1
1002 nmdc:mga09592_962407_c1
1003 nmdc:mga0qj67_244439_c1
1004 nmdc:mga0qj67_480873_c1
1005 nmdc:mga06r32_1268757_c1
1006 nmdc:mga08y16_1712664_c1
1007 nmdc:mga08y16_2077564_c1
1008 nmdc:mga08y16_262536_c1
1009 nmdc:mga08y16_359418_c1
1010 nmdc:mga08y16_487057_c1
1011 nmdc:mga08y16_9075_c1
1012 nmdc:mga0n895_2230789_c1
1013 nmdc:mga0n895_2257_c1
1014 nmdc:mga0n895_291108_c1
1015 nmdc:mga0n895_310473_c1
1016 nmdc:mga0n895_486689_c1
1017 nmdc:mga0n895_660790_c1
1018 nmdc:mga0n895_903196_c1
1019 nmdc:mga0rr50_137726_c1
1020 nmdc:mga08x19_607476_c1
1021 nmdc:mga08x19_937008_c1
1022 nmdc:mga0a205_140522_c1
1023 nmdc:mga0a205_1491837_c1
1024 nmdc:mga0a205_21745_c1
1025 nmdc:mga0a205_73995_c1
1026 nmdc:mga0a205_95722_c1
1027 Ga0495601_0050673
1028 Ga0495595_0083533
1029 Ga0495619_0299403
1030 Ga0501084_0276367
1031 Ga0590071_006285
1032 Ga0590074_004047
1033 Ga0590074_032431
1034 Ga0587088_018316
1035 Ga0587094_047949
1036 Ga0587113_007690
1037 Ga0587075_020261
1038 Ga0587114_062485
1039 Ga0501082_0559996
1040 Ga0501082_0768860
1041 Ga0501082_1193654
1042 Ga0530510_0164798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r81-assembly1.cif.gz_K1 structure of the translating neurospora crassa ribosome arrested by cycloheximide 0.7655 33 66
5c0n-assembly1.cif.gz_A development of a monoclonal antibody targeting secreted ap2 to treat diabetes and fatty liver disease 0.7552 39 64
5b29-assembly1.cif.gz_A the 1.28a structure of human fabp3 f16v mutant complexed with palmitic acid at room temperature 0.7526 39 64
2ddm-assembly1.cif.gz_B crystal structure of pyridoxal kinase from the escherichia coli pdxk gene at 2.1 a resolution 0.7522 37 64
6cbi-assembly2.cif.gz_B pcna in complex with inhibitor 0.7354 39 64
ID Description Score Start End Superfamily
af_O62228_44_250_3.10.450.700 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8104 34 70 3.10.450.700
af_A0A1D8PDN2_421_663_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7985 38 67 2.130.10.10
af_Q23092_3_141_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7951 39 64 2.40.128.20
af_O62123_289_355_1.20.5.2050 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.7758 39 64 1.20.5.2050
af_Q1AMT3_1_127_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7491 39 64 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A2V8J9Z9-F1-model_v4 Uncharacterized protein 1.002 1 86
AF-A0A2V8HFI2-F1-model_v4 Uncharacterized protein 0.9894 1 85
AF-A0A2V8J9Z9-F1-model_v4 Uncharacterized protein 0.979 1 86
AF-A0A7V8XSD6-F1-model_v4 Uncharacterized protein 0.9379 1 88
AF-A0A2V8HFI2-F1-model_v4 Uncharacterized protein 0.8592 1 85

Map