F458613

General Info

Members Datasets Scaffolds Average Seq Length
520 200 520 324

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_179439_c1|nmdc:mga05p37_179439_c1_103_1068
Length 321
Sequence MTTISRRELLRSTALASPLLAAPRIVVAQPSVKVGTAVLGDYSLAGPVIVALDKGFFGQEGVKAEFIPFRGGPDLLKAVLSGDVLVGATGSTDILVFREAGSPIKMIATHTEGNHFTLNVAADVGDLKGKAIGITRPGSSTWVFARMMAKQQGWDPDRDVKIVPLGALDAQVAALSRKEIAAFVWGDGGAVTELQGKSKILMRLDRFTPQWISQIDYASEDAIRKEPETIKKSLRAIFRALRFMKEHPDDAAPIAAKRLGWTPEAVLRAHKISSPLFPFDGSISVQALGSMQDVLLEYGMIKKRLPLEEHVAKEFTPVKLV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
153 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
154 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.77
Rhizosphere 99.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10030998 3300003203 Bacteria 2005
2 Ga0065715_10210928 3300005293 Bacteria 1314
3 Ga0065707_10176800 3300005295 Unclassified 1425
4 Ga0070676_10000394 3300005328 Bacteria 20288
5 Ga0070670_100011569 3300005331 Bacteria 7542
6 Ga0068869_100006029 3300005334 Bacteria 7666
7 Ga0070680_100004860 3300005336 Bacteria 10113
8 Ga0070680_100034448 3300005336 Bacteria 4082
9 Ga0070682_100000147 3300005337 Bacteria 55841
10 Ga0068868_100119492 3300005338 Bacteria 2149
11 Ga0070689_100107622 3300005340 Bacteria 2214
12 Ga0070691_10001026 3300005341 Bacteria 11474
13 Ga0070661_100005200 3300005344 Bacteria 8960
14 Ga0070692_10008920 3300005345 Bacteria 4495
15 Ga0070668_100134056 3300005347 Unclassified 1990
16 Ga0070668_100410472 3300005347 Bacteria 1158
17 Ga0070669_100005299 3300005353 Bacteria 9310
18 Ga0070659_100014818 3300005366 Bacteria 5830
19 Ga0070701_10107816 3300005438 Bacteria 1552
20 Ga0070705_100001482 3300005440 Bacteria 12412
21 Ga0070705_100008974 3300005440 Bacteria 4961
22 Ga0070705_100009791 3300005440 Bacteria 4777
23 Ga0070694_100002934 3300005444 Bacteria 10139
24 Ga0070694_100010797 3300005444 Bacteria 5647
25 Ga0070694_100015746 3300005444 Bacteria 4755
26 Ga0070694_100027616 3300005444 Bacteria 3688
27 Ga0070708_100000402 3300005445 Bacteria 32565
28 Ga0070708_100004949 3300005445 Bacteria 10540
29 Ga0070708_100009570 3300005445 Bacteria 7814
30 Ga0070708_100010816 3300005445 Bacteria 7413
31 Ga0070708_100016284 3300005445 Bacteria 6164
32 Ga0070708_100041488 3300005445 Bacteria 4035
33 Ga0070708_100056033 3300005445 Bacteria 3505
34 Ga0070708_100125901 3300005445 Bacteria 2368
35 Ga0070708_100172559 3300005445 Bacteria 2019
36 Ga0070708_100184999 3300005445 Bacteria 1948
37 Ga0070708_100319532 3300005445 Unclassified 1462
38 Ga0070663_100004825 3300005455 Bacteria 7949
39 Ga0070662_100005293 3300005457 Bacteria 8237
40 Ga0070662_100064276 3300005457 Bacteria 2687
41 Ga0070681_10023109 3300005458 Bacteria 6252
42 Ga0068867_100025965 3300005459 Bacteria 4202
43 Ga0070706_100008099 3300005467 Bacteria 9801
44 Ga0070706_100022623 3300005467 Bacteria 5789
45 Ga0070706_100025793 3300005467 Bacteria 5409
46 Ga0070706_100125108 3300005467 Bacteria 2397
47 Ga0070707_100005951 3300005468 Bacteria 11379
48 Ga0070707_100005986 3300005468 Bacteria 11345
49 Ga0070707_100019023 3300005468 Bacteria 6468
50 Ga0070707_100055971 3300005468 Bacteria 3781
51 Ga0070707_100066153 3300005468 Bacteria 3473
52 Ga0070707_100070885 3300005468 Bacteria 3357
53 Ga0070707_100114987 3300005468 Bacteria 2611
54 Ga0070707_100153436 3300005468 Bacteria 2243
55 Ga0070707_100189294 3300005468 Bacteria 2006
56 Ga0070698_100004215 3300005471 Bacteria 15801
57 Ga0070698_100005945 3300005471 Bacteria 13309
58 Ga0070698_100054425 3300005471 Bacteria 4062
59 Ga0070699_100000945 3300005518 Bacteria 27089
60 Ga0070699_100001703 3300005518 Bacteria 20020
61 Ga0070699_100009664 3300005518 Bacteria 8351
62 Ga0070699_100039458 3300005518 Bacteria 4088
63 Ga0070699_100258960 3300005518 Unclassified 1556
64 Ga0070699_100379039 3300005518 Bacteria 1277
65 Ga0070679_100019136 3300005530 Bacteria 6653
66 Ga0070684_100009655 3300005535 Bacteria 7609
67 Ga0070697_100000582 3300005536 Bacteria 27575
68 Ga0070697_100003714 3300005536 Bacteria 11724
69 Ga0070697_100031676 3300005536 Bacteria 4254
70 Ga0070697_100087204 3300005536 Bacteria 2577
71 Ga0070697_100163938 3300005536 Bacteria 1879
72 Ga0070697_100384843 3300005536 Bacteria 1215
73 Ga0068853_100031646 3300005539 Bacteria 4475
74 Ga0070672_100024152 3300005543 Bacteria 4487
75 Ga0070672_100178665 3300005543 Unclassified 1768
76 Ga0070686_100197099 3300005544 Bacteria 1441
77 Ga0070695_100000750 3300005545 Bacteria 17394
78 Ga0070695_100007711 3300005545 Bacteria 6374
79 Ga0070695_100012862 3300005545 Bacteria 5023
80 Ga0070695_100142048 3300005545 Bacteria 1666
81 Ga0070696_100042836 3300005546 Bacteria 3130
82 Ga0070696_100074476 3300005546 Bacteria 2394
83 Ga0070696_100139037 3300005546 Unclassified 1773
84 Ga0070696_100148120 3300005546 Bacteria 1721
85 Ga0070696_100166650 3300005546 Bacteria 1626
86 Ga0070693_100011546 3300005547 Bacteria 4451
87 Ga0070693_100199264 3300005547 Bacteria 1299
88 Ga0070704_100001843 3300005549 Bacteria 11685
89 Ga0070704_100006216 3300005549 Bacteria 7021
90 Ga0070704_100085659 3300005549 Bacteria 2333
91 Ga0070704_100276403 3300005549 Bacteria 1389
92 Ga0068855_100001343 3300005563 Bacteria 30470
93 Ga0070664_100018272 3300005564 Bacteria 5755
94 Ga0068857_100141237 3300005577 Bacteria 2177
95 Ga0068857_100308958 3300005577 Bacteria 1458
96 Ga0068854_100001072 3300005578 Bacteria 16460
97 Ga0068856_100002717 3300005614 Bacteria 18132
98 Ga0070702_100000891 3300005615 Bacteria 11615
99 Ga0068859_100059247 3300005617 Bacteria 3858
100 Ga0068859_100135911 3300005617 Bacteria 2532
101 Ga0068864_100025513 3300005618 Bacteria 4979
102 Ga0068861_100019767 3300005719 Bacteria 4813
103 Ga0068870_10000187 3300005840 Bacteria 22188
104 Ga0068863_100088652 3300005841 Bacteria 2932
105 Ga0068860_100228843 3300005843 Bacteria 1807
106 Ga0068860_100305553 3300005843 Unclassified 1559
107 Ga0068862_100001617 3300005844 Bacteria 20512
108 Ga0068862_100032891 3300005844 Bacteria 4380
109 Ga0068862_100262465 3300005844 Bacteria 1577
110 Ga0081455_10000416 3300005937 Bacteria 56066
111 Ga0081540_1016095 3300005983 Bacteria 4703
112 Ga0081540_1067308 3300005983 Bacteria 1674
113 Ga0081539_10000009 3300005985 Bacteria 509286
114 Ga0070715_10150365 3300006163 Bacteria 1140
115 Ga0068871_100180093 3300006358 Bacteria 1816
116 Ga0075428_100000643 3300006844 Bacteria 35894
117 Ga0075428_100006057 3300006844 Bacteria 13440
118 Ga0075428_100010432 3300006844 Bacteria 10318
119 Ga0075428_100013939 3300006844 Bacteria 8950
120 Ga0075428_100015400 3300006844 Bacteria 8478
121 Ga0075428_100016667 3300006844 Bacteria 8114
122 Ga0075428_100074766 3300006844 Bacteria 3701
123 Ga0075428_100144652 3300006844 Bacteria 2584
124 Ga0075430_100000052 3300006846 Bacteria 60703
125 Ga0075430_100001578 3300006846 Bacteria 18631
126 Ga0075430_100010397 3300006846 Bacteria 7881
127 Ga0075430_100052885 3300006846 Bacteria 3420
128 Ga0075430_100138507 3300006846 Bacteria 2027
129 Ga0075431_100000044 3300006847 Bacteria 65584
130 Ga0075431_100000441 3300006847 Bacteria 33990
131 Ga0075431_100000689 3300006847 Bacteria 29038
132 Ga0075431_100002572 3300006847 Bacteria 17520
133 Ga0075431_100012158 3300006847 Bacteria 8684
134 Ga0075431_100013137 3300006847 Bacteria 8368
135 Ga0075431_100026317 3300006847 Bacteria 5968
136 Ga0075431_100028392 3300006847 Bacteria 5749
137 Ga0075431_100089030 3300006847 Bacteria 3186
138 Ga0075433_10000633 3300006852 Bacteria 23526
139 Ga0075433_10005682 3300006852 Bacteria 9802
140 Ga0075433_10027624 3300006852 Bacteria 4815
141 Ga0075433_10034012 3300006852 Bacteria 4374
142 Ga0075433_10060139 3300006852 Bacteria 3326
143 Ga0075433_10063873 3300006852 Bacteria 3226
144 Ga0075433_10072914 3300006852 Bacteria 3019
145 Ga0075433_10098528 3300006852 Bacteria 2588
146 Ga0075433_10237655 3300006852 Unclassified 1617
147 Ga0075433_10393054 3300006852 Unclassified 1224
148 Ga0075434_100008472 3300006871 Bacteria 9565
149 Ga0075434_100012560 3300006871 Bacteria 8031
150 Ga0075434_100021393 3300006871 Bacteria 6285
151 Ga0075434_100039828 3300006871 Bacteria 4654
152 Ga0075434_100059648 3300006871 Bacteria 3793
153 Ga0075434_100068967 3300006871 Bacteria 3524
154 Ga0075434_100090903 3300006871 Bacteria 3054
155 Ga0075429_100001562 3300006880 Bacteria 18820
156 Ga0075429_100005000 3300006880 Bacteria 11415
157 Ga0075429_100006823 3300006880 Bacteria 9909
158 Ga0075429_100036523 3300006880 Bacteria 4273
159 Ga0075429_100094634 3300006880 Bacteria 2605
160 Ga0075429_100100406 3300006880 Bacteria 2526
161 Ga0075429_100216658 3300006880 Unclassified 1677
162 Ga0075429_100223861 3300006880 Bacteria 1648
163 Ga0075429_100260661 3300006880 Bacteria 1518
164 Ga0075429_100316524 3300006880 Bacteria 1366
165 Ga0075436_100004744 3300006914 Bacteria 9328
166 Ga0075436_100006523 3300006914 Bacteria 7991
167 Ga0075436_100215466 3300006914 Unclassified 1362
168 Ga0097620_100059245 3300006931 Bacteria 3858
169 Ga0097620_100135909 3300006931 Bacteria 2532
170 Ga0075435_100003533 3300007076 Bacteria 10610
171 Ga0075435_100013156 3300007076 Bacteria 6148
172 Ga0075435_100023534 3300007076 Bacteria 4766
173 Ga0075435_100059202 3300007076 Bacteria 3105
174 Ga0075435_100090616 3300007076 Bacteria 2522
175 Ga0075435_100098225 3300007076 Bacteria 2424
176 Ga0075435_100247907 3300007076 Bacteria 1516
177 Ga0099794_10026706 3300007265 Bacteria 2672
178 Ga0105240_10585870 3300009093 Bacteria 1230
179 Ga0111539_10003262 3300009094 Bacteria 21447
180 Ga0111539_10006916 3300009094 Bacteria 14566
181 Ga0111539_10039635 3300009094 Bacteria 5676
182 Ga0111539_10054679 3300009094 Bacteria 4748
183 Ga0111539_10330734 3300009094 Bacteria 1773
184 Ga0111539_10593173 3300009094 Bacteria 1290
185 Ga0111539_10746746 3300009094 Unclassified 1139
186 Ga0114129_10000385 3300009147 Bacteria 51411
187 Ga0114129_10002725 3300009147 Bacteria 24625
188 Ga0114129_10002794 3300009147 Bacteria 24351
189 Ga0114129_10007546 3300009147 Bacteria 15485
190 Ga0114129_10009136 3300009147 Bacteria 14130
191 Ga0114129_10027570 3300009147 Bacteria 8042
192 Ga0114129_10027885 3300009147 Bacteria 7996
193 Ga0114129_10043464 3300009147 Bacteria 6321
194 Ga0114129_10063641 3300009147 Bacteria 5150
195 Ga0114129_10074570 3300009147 Bacteria 4726
196 Ga0114129_10116085 3300009147 Bacteria 3689
197 Ga0114129_10133796 3300009147 Bacteria 3404
198 Ga0114129_10273590 3300009147 Bacteria 2259
199 Ga0105243_10036937 3300009148 Bacteria 3794
200 Ga0105243_10270452 3300009148 Bacteria 1526
201 Ga0105241_10000541 3300009174 Bacteria 28474
202 Ga0105241_10039953 3300009174 Bacteria 3540
203 Ga0105242_10100529 3300009176 Unclassified 2449
204 Ga0105242_10295278 3300009176 Bacteria 1477
205 Ga0105237_10057015 3300009545 Bacteria 3910
206 Ga0105249_10060792 3300009553 Unclassified 3466
207 Ga0105249_10210333 3300009553 Bacteria 1909
208 Ga0105246_10029208 3300011119 Bacteria 3630
209 Ga0157373_10034541 3300013100 Bacteria 3631
210 Ga0157371_10053402 3300013102 Bacteria 2869
211 Ga0157370_10115906 3300013104 Bacteria 2502
212 Ga0157369_10321384 3300013105 Unclassified 1609
213 Ga0157378_10082763 3300013297 Bacteria 2903
214 Ga0157378_10157496 3300013297 Unclassified 2121
215 Ga0163162_10149240 3300013306 Unclassified 2454
216 Ga0163162_10207890 3300013306 Unclassified 2087
217 Ga0157372_10041085 3300013307 Bacteria 5112
218 Ga0157375_10091169 3300013308 Bacteria 3109
219 Ga0157380_10070261 3300014326 Unclassified 2829
220 Ga0206356_11199141 3300020070 Bacteria 2101
221 Ga0207653_10006003 3300025885 Bacteria 3788
222 Ga0207647_10057975 3300025904 Bacteria 2373
223 Ga0207645_10001063 3300025907 Bacteria 22726
224 Ga0207643_10000325 3300025908 Bacteria 32767
225 Ga0207684_10000370 3300025910 Bacteria 60789
226 Ga0207684_10000882 3300025910 Bacteria 34234
227 Ga0207684_10001540 3300025910 Bacteria 24650
228 Ga0207684_10022325 3300025910 Bacteria 5402
229 Ga0207684_10023930 3300025910 Bacteria 5211
230 Ga0207684_10027469 3300025910 Bacteria 4849
231 Ga0207684_10510722 3300025910 Bacteria 1030
232 Ga0207654_10017673 3300025911 Bacteria 3733
233 Ga0207654_10041738 3300025911 Bacteria 2593
234 Ga0207707_10000078 3300025912 Bacteria 99871
235 Ga0207660_10007071 3300025917 Bacteria 7271
236 Ga0207660_10049773 3300025917 Bacteria 2973
237 Ga0207657_10000171 3300025919 Bacteria 66690
238 Ga0207649_10010245 3300025920 Bacteria 5146
239 Ga0207652_10022831 3300025921 Bacteria 5181
240 Ga0207646_10000466 3300025922 Bacteria 54002
241 Ga0207646_10001105 3300025922 Bacteria 34375
242 Ga0207646_10002257 3300025922 Bacteria 22928
243 Ga0207646_10014803 3300025922 Bacteria 7391
244 Ga0207646_10031830 3300025922 Bacteria 4775
245 Ga0207646_10084744 3300025922 Bacteria 2835
246 Ga0207646_10169656 3300025922 Bacteria 1970
247 Ga0207681_10017432 3300025923 Bacteria 4509
248 Ga0207681_10243701 3300025923 Bacteria 1400
249 Ga0207650_10073558 3300025925 Bacteria 2574
250 Ga0207644_10253939 3300025931 Bacteria 1404
251 Ga0207690_10013378 3300025932 Bacteria 4930
252 Ga0207706_10009509 3300025933 Bacteria 8925
253 Ga0207706_10025915 3300025933 Bacteria 5251
254 Ga0207670_10085356 3300025936 Bacteria 2218
255 Ga0207704_10024464 3300025938 Bacteria 3276
256 Ga0207691_10017144 3300025940 Bacteria 6870
257 Ga0207691_10058300 3300025940 Bacteria 3512
258 Ga0207689_10000145 3300025942 Bacteria 61402
259 Ga0207689_10221842 3300025942 Bacteria 1562
260 Ga0207679_10004308 3300025945 Bacteria 8853
261 Ga0207667_10005632 3300025949 Bacteria 15282
262 Ga0207712_10036600 3300025961 Bacteria 3344
263 Ga0207712_10194120 3300025961 Bacteria 1605
264 Ga0207640_10001094 3300025981 Bacteria 14969
265 Ga0207639_10002683 3300026041 Bacteria 11949
266 Ga0207678_10002792 3300026067 Bacteria 15844
267 Ga0207702_10002268 3300026078 Bacteria 18441
268 Ga0207641_10265939 3300026088 Unclassified 1607
269 Ga0207648_10026188 3300026089 Bacteria 5184
270 Ga0207648_10042560 3300026089 Bacteria 3986
271 Ga0207676_10255823 3300026095 Unclassified 1578
272 Ga0207674_10001395 3300026116 Bacteria 31131
273 Ga0207675_100138321 3300026118 Bacteria 2312
274 Ga0207675_100142511 3300026118 Bacteria 2277
275 Ga0209967_1001933 3300027364 Bacteria 2669
276 Ga0209996_1005063 3300027395 Bacteria 1685
277 Ga0209995_1010709 3300027471 Bacteria 1489
278 Ga0209968_1002209 3300027526 Bacteria 2947
279 Ga0209999_1006774 3300027543 Bacteria 2062
280 Ga0209970_1002261 3300027614 Bacteria 3287
281 Ga0209983_1003194 3300027665 Bacteria 3516
282 Ga0209588_1005119 3300027671 Bacteria 3738
283 Ga0209971_1000748 3300027682 Bacteria 8371
284 Ga0209966_1001504 3300027695 Bacteria 4047
285 Ga0209998_10000073 3300027717 Bacteria 40367
286 Ga0209974_10004826 3300027876 Bacteria 4778
287 Ga0207428_10000018 3300027907 Bacteria 293117
288 Ga0207428_10000054 3300027907 Bacteria 175237
289 Ga0207428_10015368 3300027907 Bacteria 6624
290 Ga0268265_10006519 3300028380 Bacteria 7910
291 Ga0268265_10007173 3300028380 Bacteria 7529
292 Ga0268265_10019753 3300028380 Bacteria 4690
293 Ga0268265_10099869 3300028380 Bacteria 2341
294 Ga0307408_100013585 3300031548 Bacteria 5406
295 Ga0307408_100069486 3300031548 Bacteria 2597
296 Ga0307408_100195224 3300031548 Bacteria 1634
297 Ga0307405_10097686 3300031731 Bacteria 1962
298 Ga0307406_10025910 3300031901 Bacteria 3515
299 Ga0307409_100140822 3300031995 Bacteria 2078
300 Ga0307416_100014969 3300032002 Bacteria 5339
301 Ga0307416_100116009 3300032002 Bacteria 2373
302 Ga0307411_10133418 3300032005 Bacteria 1819
303 Ga0373951_0012096 3300035091 Bacteria 1941
304 Ga0373952_0002341 3300035092 Bacteria 3415
305 Ga0373932_0008281 3300035112 Unclassified 2484
306 Ga0373939_0006712 3300035114 Unclassified 2779
307 Ga0373939_0046847 3300035114 Bacteria 1325
308 Ga0373941_0018278 3300035115 Bacteria 1935
309 Ga0373961_0015113 3300035241 Bacteria 1969
310 Ga0373962_0031653 3300035242 Unclassified 1452
311 Ga0373931_0019280 3300035691 Bacteria 3404
312 Ga0395899_0012313 3300037312 Bacteria 6553
313 Ga0395899_0184626 3300037312 Bacteria 1462
314 Ga0395900_0027721 3300037418 Bacteria 5803
315 Ga0395900_0042806 3300037418 Bacteria 4665
316 Ga0395900_0135793 3300037418 Bacteria 2520
317 Ga0395898_0012798 3300037466 Bacteria 8662
318 Ga0395905_0058565 3300037471 Bacteria 3602
319 Ga0395901_0002127 3300038443 Bacteria 20290
320 Ga0395901_0139318 3300038443 Bacteria 2550
321 Ga0395901_0250853 3300038443 Bacteria 1844
322 Ga0439435_0003264 3300042436 Bacteria 3352
323 Ga0439464_0021087 3300042439 Bacteria 1787
324 Ga0439460_0000782 3300042461 Bacteria 7183
325 Ga0451577_0102126 3300042876 Bacteria 2562
326 Ga0451577_0159758 3300042876 Bacteria 2029
327 Ga0453683_0020830 3300044673 Bacteria 4189
328 Ga0453683_0194725 3300044673 Bacteria 1286
329 Ga0453683_0253265 3300044673 Bacteria 1122
330 Ga0453684_0366663 3300044712 Bacteria 1620
331 Ga0453684_0664035 3300044712 Bacteria 1136
332 Ga0451576_0003281 3300045051 Bacteria 22468
333 Ga0451576_0017327 3300045051 Bacteria 7925
334 Ga0451576_0042435 3300045051 Bacteria 4801
335 Ga0495580_0000143 3300046472 Bacteria 51276
336 Ga0496102_0044242 3300048905 Bacteria 4040
337 Ga0496102_0046050 3300048905 Bacteria 3961
338 Ga0496106_0044059 3300048909 Bacteria 3349
339 Ga0496106_0183440 3300048909 Bacteria 1662
340 Ga0501033_0027111 3300049570 Bacteria 4310
341 Ga0501036_0000403 3300049572 Bacteria 30436
342 Ga0501037_0013683 3300049573 Bacteria 5978
343 Ga0501038_0000363 3300049574 Bacteria 39186
344 Ga0501038_0007888 3300049574 Bacteria 9811
345 Ga0501038_0029941 3300049574 Bacteria 4819
346 Ga0501038_0044414 3300049574 Bacteria 3861
347 Ga0501039_0000258 3300049575 Bacteria 38820
348 Ga0501039_0033275 3300049575 Bacteria 3976
349 Ga0501040_0002959 3300049576 Bacteria 10995
350 Ga0501040_0014607 3300049576 Bacteria 5178
351 Ga0501040_0019385 3300049576 Bacteria 4524
352 Ga0501041_0000861 3300049577 Bacteria 16355
353 Ga0501041_0005328 3300049577 Bacteria 7526
354 Ga0501041_0187302 3300049577 Bacteria 1296
355 Ga0501042_0000807 3300049578 Bacteria 17250
356 Ga0501042_0006135 3300049578 Bacteria 7789
357 Ga0501042_0010542 3300049578 Bacteria 6203
358 Ga0501042_0067758 3300049578 Bacteria 2552
359 Ga0501042_0162795 3300049578 Bacteria 1610
360 Ga0501043_0004408 3300049579 Bacteria 11434
361 Ga0501046_0000392 3300049580 Bacteria 43726
362 Ga0501046_0004202 3300049580 Bacteria 13113
363 Ga0501046_0050865 3300049580 Bacteria 3272
364 Ga0501046_0269998 3300049580 Bacteria 1248
365 Ga0501047_0044788 3300049581 Bacteria 4276
366 Ga0501048_0000915 3300049582 Bacteria 21746
367 Ga0501048_0056353 3300049582 Bacteria 2788
368 Ga0501048_0141519 3300049582 Bacteria 1701
369 Ga0501067_0060734 3300049583 Unclassified 2092
370 Ga0501068_0012335 3300049584 Bacteria 4841
371 Ga0501069_0053952 3300049585 Bacteria 2239
372 Ga0501071_0000008 3300049587 Bacteria 70418
373 Ga0501071_0076847 3300049587 Bacteria 2439
374 Ga0501071_0116133 3300049587 Bacteria 1981
375 Ga0501071_0194457 3300049587 Bacteria 1522
376 Ga0501072_0000369 3300049588 Bacteria 32083
377 Ga0501072_0001291 3300049588 Bacteria 18734
378 Ga0501072_0007063 3300049588 Bacteria 8525
379 Ga0501072_0013749 3300049588 Bacteria 6197
380 Ga0501072_0023810 3300049588 Bacteria 4757
381 Ga0501072_0025628 3300049588 Bacteria 4594
382 Ga0501072_0055670 3300049588 Bacteria 3117
383 Ga0501072_0084763 3300049588 Bacteria 2513
384 Ga0501072_0230407 3300049588 Bacteria 1476
385 Ga0501074_0007779 3300049590 Bacteria 7758
386 Ga0501074_0065598 3300049590 Bacteria 2613
387 Ga0501075_0000002 3300049591 Bacteria 202033
388 Ga0501075_0002058 3300049591 Bacteria 13308
389 Ga0501075_0030911 3300049591 Bacteria 3971
390 Ga0501075_0038622 3300049591 Bacteria 3570
391 Ga0501075_0072341 3300049591 Bacteria 2606
392 Ga0501075_0227897 3300049591 Bacteria 1421
393 Ga0501076_0000136 3300049592 Bacteria 41345
394 Ga0501076_0000212 3300049592 Bacteria 35230
395 Ga0501076_0021169 3300049592 Bacteria 4984
396 Ga0501076_0066049 3300049592 Bacteria 2886
397 Ga0501076_0107856 3300049592 Bacteria 2249
398 Ga0501076_0416252 3300049592 Bacteria 1105
399 Ga0501077_0000119 3300049593 Bacteria 42272
400 Ga0501077_0002921 3300049593 Bacteria 10253
401 Ga0501077_0013244 3300049593 Bacteria 5168
402 Ga0501077_0015069 3300049593 Bacteria 4861
403 Ga0501077_0029015 3300049593 Bacteria 3517
404 Ga0501079_0000129 3300049741 Bacteria 40653
405 Ga0501079_0013920 3300049741 Bacteria 6135
406 Ga0501079_0074726 3300049741 Bacteria 2620
407 Ga0501079_0094019 3300049741 Bacteria 2323
408 Ga0501079_0123140 3300049741 Bacteria 2017
409 Ga0501079_0244870 3300049741 Bacteria 1401
410 Ga0501079_0290962 3300049741 Unclassified 1277
411 Ga0501079_0378306 3300049741 Bacteria 1110
412 Ga0501080_0002744 3300049742 Bacteria 15460
413 Ga0501080_0022759 3300049742 Bacteria 5805
414 Ga0501081_0000060 3300049743 Bacteria 42154
415 Ga0501081_0004900 3300049743 Bacteria 8603
416 Ga0501081_0007167 3300049743 Bacteria 7250
417 Ga0501081_0015947 3300049743 Bacteria 4961
418 Ga0501081_0016506 3300049743 Bacteria 4882
419 Ga0501081_0053131 3300049743 Bacteria 2797
420 Ga0501081_0095905 3300049743 Bacteria 2092
421 Ga0501081_0167363 3300049743 Bacteria 1586
422 Ga0501081_0204882 3300049743 Bacteria 1431
423 Ga0501081_0213022 3300049743 Bacteria 1403
424 Ga0501083_0010497 3300049744 Bacteria 6518
425 Ga0501083_0025940 3300049744 Bacteria 4055
426 Ga0501083_0075043 3300049744 Bacteria 2246
427 Ga0501035_0116833 3300049822 Bacteria 2334
428 Ga0501045_0000480 3300049824 Bacteria 24743
429 Ga0501045_0014024 3300049824 Bacteria 5672
430 Ga0501045_0036018 3300049824 Bacteria 3593
431 Ga0501045_0066139 3300049824 Bacteria 2655
432 Ga0501045_0160676 3300049824 Bacteria 1672
433 nmdc:mga05p37_14166_c1 3300050507 Bacteria 9571
434 nmdc:mga05p37_1607_c1 3300050507 Bacteria 26171
435 nmdc:mga05p37_168488_c1 3300050507 Unclassified 2672
436 nmdc:mga05p37_179439_c1 3300050507 Bacteria 2577
437 nmdc:mga05p37_20326_c1 3300050507 Bacteria 8034
438 nmdc:mga05p37_20750_c1 3300050507 Bacteria 7951
439 nmdc:mga05p37_24059_c1 3300050507 Bacteria 7399
440 nmdc:mga05p37_3855_c1 3300050507 Bacteria 17548
441 nmdc:mga05p37_412_c1 3300050507 Bacteria 46171
442 nmdc:mga05p37_47545_c1 3300050507 Bacteria 5276
443 nmdc:mga05p37_522242_c1 3300050507 Unclassified 1358
444 nmdc:mga05p37_59708_c1 3300050507 Bacteria 4696
445 nmdc:mga05p37_763_c1 3300050507 Bacteria 35782
446 nmdc:mga05p37_79304_c1 3300050507 Bacteria 4043
447 nmdc:mga05p37_82664_c1 3300050507 Bacteria 3958
448 nmdc:mga09592_108257_c1 3300050508 Bacteria 2384
449 nmdc:mga09592_171719_c1 3300050508 Bacteria 1875
450 nmdc:mga09592_17173_c1 3300050508 Bacteria 5926
451 nmdc:mga09592_193852_c1 3300050508 Bacteria 1759
452 nmdc:mga09592_257130_c1 3300050508 Bacteria 1514
453 nmdc:mga09592_42587_c1 3300050508 Bacteria 3820
454 nmdc:mga09592_5944_c1 3300050508 Bacteria 9948
455 nmdc:mga09592_8953_c1 3300050508 Bacteria 8139
456 nmdc:mga0qj67_131309_c1 3300050509 Bacteria 2029
457 nmdc:mga0qj67_147262_c1 3300050509 Bacteria 1909
458 nmdc:mga0qj67_3798_c1 3300050509 Bacteria 10908
459 nmdc:mga0qj67_676_c1 3300050509 Bacteria 23252
460 nmdc:mga06r32_102867_c1 3300050510 Bacteria 2804
461 nmdc:mga06r32_11071_c1 3300050510 Bacteria 8122
462 nmdc:mga06r32_115929_c1 3300050510 Bacteria 2639
463 nmdc:mga06r32_1475_c1 3300050510 Bacteria 21176
464 nmdc:mga06r32_217476_c1 3300050510 Unclassified 1898
465 nmdc:mga06r32_229478_c1 3300050510 Bacteria 1844
466 nmdc:mga06r32_2577_c1 3300050510 Bacteria 16178
467 nmdc:mga06r32_258282_c1 3300050510 Bacteria 1730
468 nmdc:mga06r32_2962_c1 3300050510 Bacteria 12463
469 nmdc:mga06r32_703_c1 3300050510 Bacteria 29212
470 nmdc:mga08y16_1251_c1 3300050511 Bacteria 25187
471 nmdc:mga08y16_3110_c1 3300050511 Bacteria 17190
472 nmdc:mga08y16_66665_c1 3300050511 Bacteria 3757
473 nmdc:mga0n895_100148_c1 3300050512 Bacteria 2907
474 nmdc:mga0n895_10658_c1 3300050512 Bacteria 8139
475 nmdc:mga0n895_149134_c1 3300050512 Bacteria 2368
476 nmdc:mga0n895_155573_c1 3300050512 Bacteria 2317
477 nmdc:mga0n895_2213_c1 3300050512 Bacteria 15039
478 nmdc:mga0n895_255505_c1 3300050512 Bacteria 1778
479 nmdc:mga0n895_31196_c1 3300050512 Bacteria 5100
480 nmdc:mga0n895_347_c1 3300050512 Bacteria 31070
481 nmdc:mga0n895_38719_c1 3300050512 Bacteria 4621
482 nmdc:mga0n895_6506_c1 3300050512 Bacteria 9936
483 nmdc:mga0n895_88526_c1 3300050512 Bacteria 3096
484 nmdc:mga0rr50_104556_c1 3300050513 Bacteria 2231
485 nmdc:mga0rr50_185_c1 3300050513 Bacteria 33975
486 nmdc:mga0rr50_2496_c1 3300050513 Bacteria 10402
487 nmdc:mga0rr50_435120_c1 3300050513 Bacteria 1111
488 nmdc:mga0rr50_47612_c1 3300050513 Bacteria 3164
489 nmdc:mga0rr50_58165_c1 3300050513 Bacteria 2896
490 nmdc:mga0rr50_66137_c1 3300050513 Bacteria 2741
491 nmdc:mga08x19_3746_c1 3300050514 Bacteria 9052
492 nmdc:mga08x19_4632_c1 3300050514 Bacteria 8162
493 nmdc:mga0a205_10565_c1 3300050515 Bacteria 8483
494 nmdc:mga0a205_107896_c1 3300050515 Bacteria 2683
495 nmdc:mga0a205_108572_c2 3300050515 Unclassified 2107
496 nmdc:mga0a205_12648_c1 3300050515 Bacteria 7816
497 nmdc:mga0a205_13620_c1 3300050515 Bacteria 7576
498 nmdc:mga0a205_1798_c1 3300050515 Bacteria 18542
499 nmdc:mga0a205_221556_c1 3300050515 Unclassified 1777
500 nmdc:mga0a205_63619_c1 3300050515 Bacteria 3564
501 nmdc:mga0a205_75618_c1 3300050515 Bacteria 3254
502 Ga0501084_0000098 3300054114 Bacteria 64870
503 Ga0501084_0003370 3300054114 Bacteria 12941
504 Ga0501084_0003815 3300054114 Bacteria 12253
505 Ga0501084_0041855 3300054114 Bacteria 3831
506 Ga0501084_0058900 3300054114 Bacteria 3214
507 Ga0501084_0099994 3300054114 Bacteria 2435
508 Ga0501084_0298493 3300054114 Unclassified 1361
509 Ga0501082_0000747 3300060353 Bacteria 28590
510 Ga0501082_0003762 3300060353 Bacteria 13262
511 Ga0501082_0013515 3300060353 Bacteria 7014
512 Ga0501082_0015884 3300060353 Bacteria 6474
513 Ga0501082_0020373 3300060353 Bacteria 5717
514 Ga0501082_0106591 3300060353 Bacteria 2424
515 Ga0530510_0000001 3300061734 Bacteria 285623
516 Ga0530510_0000161 3300061734 Bacteria 40325
517 Ga0530510_0019080 3300061734 Bacteria 4864
518 Ga0530510_0036772 3300061734 Bacteria 3528
519 Ga0530510_0037032 3300061734 Bacteria 3516
520 Ga0530510_0082623 3300061734 Bacteria 2339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0664035 Ga0453684_0664035_19_846 275
2 3300009148 Ga0105243_10270452 Ga0105243_102704521 287
3 3300006846 Ga0075430_100138507 Ga0075430_1001385071 299
4 3300050509 nmdc:mga0qj67_147262_c1 nmdc:mga0qj67_147262_c1_42_941 299
5 3300049588 Ga0501072_0230407 Ga0501072_0230407_253_1233 300
6 3300045051 Ga0451576_0003281 Ga0451576_0003281_4197_5177 304
7 3300005445 Ga0070708_100009570 Ga0070708_1000095705 307
8 3300005445 Ga0070708_100016284 Ga0070708_1000162845 307
9 3300049593 Ga0501077_0015069 Ga0501077_0015069_3802_4737 307
10 3300006844 Ga0075428_100015400 Ga0075428_1000154002 310
11 3300006847 Ga0075431_100000044 Ga0075431_10000004439 310
12 3300009147 Ga0114129_10000385 Ga0114129_1000038536 310
13 3300050507 nmdc:mga05p37_763_c1 nmdc:mga05p37_763_c1_32827_33783 310
14 3300050510 nmdc:mga06r32_2577_c1 nmdc:mga06r32_2577_c1_6334_7290 310
15 3300005577 Ga0068857_100141237 Ga0068857_1001412373 311
16 3300049588 Ga0501072_0084763 Ga0501072_0084763_1421_2374 313
17 3300049592 Ga0501076_0107856 Ga0501076_0107856_302_1255 313
18 3300049743 Ga0501081_0204882 Ga0501081_0204882_308_1261 313
19 3300049588 Ga0501072_0023810 Ga0501072_0023810_1372_2343 315
20 3300049591 Ga0501075_0030911 Ga0501075_0030911_671_1642 315
21 3300049592 Ga0501076_0416252 Ga0501076_0416252_88_1059 315
22 3300049593 Ga0501077_0002921 Ga0501077_0002921_7508_8479 315
23 3300049743 Ga0501081_0015947 Ga0501081_0015947_2243_3214 315
24 3300054114 Ga0501084_0099994 Ga0501084_0099994_1183_2154 315
25 3300060353 Ga0501082_0106591 Ga0501082_0106591_228_1199 315
26 3300005445 Ga0070708_100004949 Ga0070708_10000494910 317
27 3300005468 Ga0070707_100005951 Ga0070707_1000059514 317
28 3300005518 Ga0070699_100001703 Ga0070699_1000017034 317
29 3300006871 Ga0075434_100059648 Ga0075434_1000596482 317
30 3300006880 Ga0075429_100260661 Ga0075429_1002606612 317
31 3300006914 Ga0075436_100006523 Ga0075436_1000065235 317
32 3300007076 Ga0075435_100023534 Ga0075435_1000235344 317
33 3300025910 Ga0207684_10001540 Ga0207684_1000154020 317
34 3300025922 Ga0207646_10002257 Ga0207646_1000225710 317
35 3300050507 nmdc:mga05p37_412_c1 nmdc:mga05p37_412_c1_8534_9490 317
36 3300050508 nmdc:mga09592_257130_c1 nmdc:mga09592_257130_c1_356_1312 317
37 3300050512 nmdc:mga0n895_347_c1 nmdc:mga0n895_347_c1_24905_25861 317
38 3300050513 nmdc:mga0rr50_185_c1 nmdc:mga0rr50_185_c1_12249_13205 317
39 3300050514 nmdc:mga08x19_4632_c1 nmdc:mga08x19_4632_c1_16_972 317
40 3300050515 nmdc:mga0a205_1798_c1 nmdc:mga0a205_1798_c1_12249_13205 317
41 3300037312 Ga0395899_0184626 Ga0395899_0184626_418_1380 318
42 3300037418 Ga0395900_0135793 Ga0395900_0135793_734_1696 318
43 3300038443 Ga0395901_0250853 Ga0395901_0250853_112_1074 318
44 3300050507 nmdc:mga05p37_179439_c1 nmdc:mga05p37_179439_c1_103_1068 319
45 3300005293 Ga0065715_10210928 Ga0065715_102109282 320
46 3300005328 Ga0070676_10000394 Ga0070676_1000039417 320
47 3300005331 Ga0070670_100011569 Ga0070670_1000115699 320
48 3300005334 Ga0068869_100006029 Ga0068869_1000060296 320
49 3300005336 Ga0070680_100004860 Ga0070680_1000048606 320
50 3300005337 Ga0070682_100000147 Ga0070682_10000014741 320
51 3300005338 Ga0068868_100119492 Ga0068868_1001194922 320
52 3300005340 Ga0070689_100107622 Ga0070689_1001076222 320
53 3300005341 Ga0070691_10001026 Ga0070691_100010263 320
54 3300005344 Ga0070661_100005200 Ga0070661_1000052006 320
55 3300005345 Ga0070692_10008920 Ga0070692_100089202 320
56 3300005347 Ga0070668_100410472 Ga0070668_1004104722 320
57 3300005366 Ga0070659_100014818 Ga0070659_1000148186 320
58 3300005440 Ga0070705_100001482 Ga0070705_10000148210 320
59 3300005444 Ga0070694_100010797 Ga0070694_1000107973 320
60 3300005455 Ga0070663_100004825 Ga0070663_1000048258 320
61 3300005457 Ga0070662_100005293 Ga0070662_1000052935 320
62 3300005458 Ga0070681_10023109 Ga0070681_100231092 320
63 3300005459 Ga0068867_100025965 Ga0068867_1000259652 320
64 3300005530 Ga0070679_100019136 Ga0070679_1000191366 320
65 3300005535 Ga0070684_100009655 Ga0070684_1000096555 320
66 3300005539 Ga0068853_100031646 Ga0068853_1000316463 320
67 3300005543 Ga0070672_100178665 Ga0070672_1001786652 320
68 3300005545 Ga0070695_100012862 Ga0070695_1000128625 320
69 3300005546 Ga0070696_100074476 Ga0070696_1000744762 320
70 3300005546 Ga0070696_100166650 Ga0070696_1001666502 320
71 3300005549 Ga0070704_100001843 Ga0070704_1000018439 320
72 3300005563 Ga0068855_100001343 Ga0068855_1000013433 320
73 3300005564 Ga0070664_100018272 Ga0070664_1000182726 320
74 3300005577 Ga0068857_100308958 Ga0068857_1003089582 320
75 3300005578 Ga0068854_100001072 Ga0068854_10000107213 320
76 3300005614 Ga0068856_100002717 Ga0068856_10000271712 320
77 3300005615 Ga0070702_100000891 Ga0070702_1000008912 320
78 3300005617 Ga0068859_100135911 Ga0068859_1001359112 320
79 3300005618 Ga0068864_100025513 Ga0068864_1000255133 320
80 3300005719 Ga0068861_100019767 Ga0068861_1000197675 320
81 3300005840 Ga0068870_10000187 Ga0068870_1000018718 320
82 3300005841 Ga0068863_100088652 Ga0068863_1000886522 320
83 3300005844 Ga0068862_100001617 Ga0068862_10000161713 320
84 3300006358 Ga0068871_100180093 Ga0068871_1001800932 320
85 3300006844 Ga0075428_100144652 Ga0075428_1001446523 320
86 3300006852 Ga0075433_10027624 Ga0075433_100276242 320
87 3300006852 Ga0075433_10060139 Ga0075433_100601395 320
88 3300006852 Ga0075433_10072914 Ga0075433_100729145 320
89 3300006871 Ga0075434_100039828 Ga0075434_1000398285 320
90 3300006931 Ga0097620_100135909 Ga0097620_1001359093 320
91 3300007076 Ga0075435_100059202 Ga0075435_1000592022 320
92 3300009093 Ga0105240_10585870 Ga0105240_105858701 320
93 3300009094 Ga0111539_10003262 Ga0111539_100032627 320
94 3300009094 Ga0111539_10330734 Ga0111539_103307342 320
95 3300009174 Ga0105241_10000541 Ga0105241_100005413 320
96 3300009545 Ga0105237_10057015 Ga0105237_100570154 320
97 3300011119 Ga0105246_10029208 Ga0105246_100292082 320
98 3300013100 Ga0157373_10034541 Ga0157373_100345414 320
99 3300013102 Ga0157371_10053402 Ga0157371_100534022 320
100 3300013104 Ga0157370_10115906 Ga0157370_101159062 320
101 3300013105 Ga0157369_10321384 Ga0157369_103213842 320
102 3300013307 Ga0157372_10041085 Ga0157372_100410853 320
103 3300013308 Ga0157375_10091169 Ga0157375_100911692 320
104 3300020070 Ga0206356_11199141 Ga0206356_111991412 320
105 3300025885 Ga0207653_10006003 Ga0207653_100060032 320
106 3300025904 Ga0207647_10057975 Ga0207647_100579753 320
107 3300025907 Ga0207645_10001063 Ga0207645_1000106318 320
108 3300025908 Ga0207643_10000325 Ga0207643_1000032515 320
109 3300025911 Ga0207654_10017673 Ga0207654_100176733 320
110 3300025912 Ga0207707_10000078 Ga0207707_1000007830 320
111 3300025917 Ga0207660_10007071 Ga0207660_100070714 320
112 3300025919 Ga0207657_10000171 Ga0207657_1000017129 320
113 3300025920 Ga0207649_10010245 Ga0207649_100102451 320
114 3300025921 Ga0207652_10022831 Ga0207652_100228312 320
115 3300025923 Ga0207681_10017432 Ga0207681_100174323 320
116 3300025923 Ga0207681_10243701 Ga0207681_102437011 320
117 3300025925 Ga0207650_10073558 Ga0207650_100735583 320
118 3300025932 Ga0207690_10013378 Ga0207690_100133785 320
119 3300025933 Ga0207706_10009509 Ga0207706_100095096 320
120 3300025936 Ga0207670_10085356 Ga0207670_100853562 320
121 3300025940 Ga0207691_10058300 Ga0207691_100583003 320
122 3300025942 Ga0207689_10000145 Ga0207689_100001456 320
123 3300025945 Ga0207679_10004308 Ga0207679_100043086 320
124 3300025949 Ga0207667_10005632 Ga0207667_100056326 320
125 3300025981 Ga0207640_10001094 Ga0207640_100010942 320
126 3300026041 Ga0207639_10002683 Ga0207639_100026839 320
127 3300026067 Ga0207678_10002792 Ga0207678_1000279216 320
128 3300026078 Ga0207702_10002268 Ga0207702_1000226812 320
129 3300026088 Ga0207641_10265939 Ga0207641_102659391 320
130 3300026089 Ga0207648_10026188 Ga0207648_100261882 320
131 3300026095 Ga0207676_10255823 Ga0207676_102558232 320
132 3300026116 Ga0207674_10001395 Ga0207674_100013957 320
133 3300027907 Ga0207428_10000054 Ga0207428_1000005469 320
134 3300028380 Ga0268265_10007173 Ga0268265_100071735 320
135 3300028380 Ga0268265_10019753 Ga0268265_100197534 320
136 3300035091 Ga0373951_0012096 Ga0373951_0012096_587_1561 320
137 3300035092 Ga0373952_0002341 Ga0373952_0002341_1113_2087 320
138 3300035114 Ga0373939_0046847 Ga0373939_0046847_207_1181 320
139 3300035115 Ga0373941_0018278 Ga0373941_0018278_359_1333 320
140 3300035241 Ga0373961_0015113 Ga0373961_0015113_366_1340 320
141 3300044673 Ga0453683_0020830 Ga0453683_0020830_1156_2130 320
142 3300045051 Ga0451576_0042435 Ga0451576_0042435_2938_3912 320
143 3300048905 Ga0496102_0046050 Ga0496102_0046050_901_1875 320
144 3300048909 Ga0496106_0044059 Ga0496106_0044059_79_1053 320
145 3300050512 nmdc:mga0n895_31196_c1 nmdc:mga0n895_31196_c1_3209_4183 320
146 3300050513 nmdc:mga0rr50_104556_c1 nmdc:mga0rr50_104556_c1_22_996 320
147 3300050513 nmdc:mga0rr50_47612_c1 nmdc:mga0rr50_47612_c1_608_1582 320
148 3300050515 nmdc:mga0a205_13620_c1 nmdc:mga0a205_13620_c1_1815_2789 320
149 3300005445 Ga0070708_100010816 Ga0070708_1000108168 321
150 3300005445 Ga0070708_100184999 Ga0070708_1001849992 321
151 3300005445 Ga0070708_100319532 Ga0070708_1003195322 321
152 3300005468 Ga0070707_100066153 Ga0070707_1000661531 321
153 3300005468 Ga0070707_100114987 Ga0070707_1001149872 321
154 3300005468 Ga0070707_100153436 Ga0070707_1001534363 321
155 3300005471 Ga0070698_100054425 Ga0070698_1000544253 321
156 3300005518 Ga0070699_100009664 Ga0070699_1000096647 321
157 3300005518 Ga0070699_100039458 Ga0070699_1000394583 321
158 3300006871 Ga0075434_100012560 Ga0075434_1000125602 321
159 3300009147 Ga0114129_10116085 Ga0114129_101160854 321
160 3300009553 Ga0105249_10060792 Ga0105249_100607922 321
161 3300025922 Ga0207646_10084744 Ga0207646_100847443 321
162 3300025922 Ga0207646_10169656 Ga0207646_101696562 321
163 3300049570 Ga0501033_0027111 Ga0501033_0027111_1905_2888 321
164 3300049572 Ga0501036_0000403 Ga0501036_0000403_5816_6799 321
165 3300049573 Ga0501037_0013683 Ga0501037_0013683_2822_3805 321
166 3300049574 Ga0501038_0000363 Ga0501038_0000363_31007_31990 321
167 3300049574 Ga0501038_0007888 Ga0501038_0007888_2072_3055 321
168 3300049575 Ga0501039_0000258 Ga0501039_0000258_9596_10579 321
169 3300049578 Ga0501042_0000807 Ga0501042_0000807_3122_4105 321
170 3300049578 Ga0501042_0006135 Ga0501042_0006135_1494_2477 321
171 3300049579 Ga0501043_0004408 Ga0501043_0004408_1124_2107 321
172 3300049580 Ga0501046_0000392 Ga0501046_0000392_30857_31840 321
173 3300049580 Ga0501046_0050865 Ga0501046_0050865_257_1240 321
174 3300049582 Ga0501048_0000915 Ga0501048_0000915_19400_20383 321
175 3300049584 Ga0501068_0012335 Ga0501068_0012335_1903_2886 321
176 3300049587 Ga0501071_0000008 Ga0501071_0000008_41376_42359 321
177 3300049588 Ga0501072_0000369 Ga0501072_0000369_8413_9396 321
178 3300049588 Ga0501072_0001291 Ga0501072_0001291_13288_14271 321
179 3300049588 Ga0501072_0025628 Ga0501072_0025628_3553_4548 321
180 3300049590 Ga0501074_0007779 Ga0501074_0007779_3052_4035 321
181 3300049591 Ga0501075_0000002 Ga0501075_0000002_38284_39267 321
182 3300049591 Ga0501075_0002058 Ga0501075_0002058_1467_2450 321
183 3300049591 Ga0501075_0038622 Ga0501075_0038622_1416_2411 321
184 3300049592 Ga0501076_0000136 Ga0501076_0000136_10738_11721 321
185 3300049592 Ga0501076_0000212 Ga0501076_0000212_22446_23429 321
186 3300049593 Ga0501077_0000119 Ga0501077_0000119_12001_12984 321
187 3300049593 Ga0501077_0029015 Ga0501077_0029015_2325_3308 321
188 3300049741 Ga0501079_0000129 Ga0501079_0000129_30492_31475 321
189 3300049741 Ga0501079_0094019 Ga0501079_0094019_43_1038 321
190 3300049741 Ga0501079_0290962 Ga0501079_0290962_274_1257 321
191 3300049741 Ga0501079_0378306 Ga0501079_0378306_27_1007 321
192 3300049742 Ga0501080_0002744 Ga0501080_0002744_3588_4571 321
193 3300049742 Ga0501080_0022759 Ga0501080_0022759_413_1396 321
194 3300049743 Ga0501081_0000060 Ga0501081_0000060_525_1508 321
195 3300049743 Ga0501081_0004900 Ga0501081_0004900_7076_8059 321
196 3300049743 Ga0501081_0053131 Ga0501081_0053131_28_1023 321
197 3300049744 Ga0501083_0010497 Ga0501083_0010497_101_1084 321
198 3300049822 Ga0501035_0116833 Ga0501035_0116833_1028_2011 321
199 3300049824 Ga0501045_0014024 Ga0501045_0014024_3422_4405 321
200 3300049824 Ga0501045_0160676 Ga0501045_0160676_173_1168 321
201 3300050507 nmdc:mga05p37_1607_c1 nmdc:mga05p37_1607_c1_9608_10591 321
202 3300050507 nmdc:mga05p37_79304_c1 nmdc:mga05p37_79304_c1_1316_2299 321
203 3300050510 nmdc:mga06r32_102867_c1 nmdc:mga06r32_102867_c1_39_1022 321
204 3300050512 nmdc:mga0n895_10658_c1 nmdc:mga0n895_10658_c1_6370_7344 321
205 3300050515 nmdc:mga0a205_75618_c1 nmdc:mga0a205_75618_c1_712_1686 321
206 3300054114 Ga0501084_0000098 Ga0501084_0000098_33637_34620 321
207 3300054114 Ga0501084_0003370 Ga0501084_0003370_1769_2752 321
208 3300054114 Ga0501084_0058900 Ga0501084_0058900_327_1322 321
209 3300060353 Ga0501082_0003762 Ga0501082_0003762_5057_6040 321
210 3300060353 Ga0501082_0013515 Ga0501082_0013515_441_1424 321
211 3300060353 Ga0501082_0020373 Ga0501082_0020373_248_1243 321
212 3300061734 Ga0530510_0000001 Ga0530510_0000001_8062_9045 321
213 3300061734 Ga0530510_0000161 Ga0530510_0000161_12386_13369 321
214 3300061734 Ga0530510_0019080 Ga0530510_0019080_337_1332 321
215 3300061734 Ga0530510_0037032 Ga0530510_0037032_820_1800 321
216 3300005347 Ga0070668_100134056 Ga0070668_1001340562 322
217 3300005353 Ga0070669_100005299 Ga0070669_10000529911 322
218 3300005440 Ga0070705_100008974 Ga0070705_1000089741 322
219 3300005444 Ga0070694_100002934 Ga0070694_1000029345 322
220 3300005444 Ga0070694_100027616 Ga0070694_1000276166 322
221 3300005445 Ga0070708_100041488 Ga0070708_1000414884 322
222 3300005445 Ga0070708_100056033 Ga0070708_1000560332 322
223 3300005445 Ga0070708_100125901 Ga0070708_1001259012 322
224 3300005445 Ga0070708_100172559 Ga0070708_1001725592 322
225 3300005457 Ga0070662_100064276 Ga0070662_1000642763 322
226 3300005467 Ga0070706_100025793 Ga0070706_1000257932 322
227 3300005467 Ga0070706_100125108 Ga0070706_1001251081 322
228 3300005468 Ga0070707_100019023 Ga0070707_1000190233 322
229 3300005468 Ga0070707_100070885 Ga0070707_1000708853 322
230 3300005471 Ga0070698_100005945 Ga0070698_1000059458 322
231 3300005518 Ga0070699_100258960 Ga0070699_1002589601 322
232 3300005518 Ga0070699_100379039 Ga0070699_1003790392 322
233 3300005536 Ga0070697_100003714 Ga0070697_1000037144 322
234 3300005536 Ga0070697_100031676 Ga0070697_1000316764 322
235 3300005543 Ga0070672_100024152 Ga0070672_1000241524 322
236 3300005545 Ga0070695_100000750 Ga0070695_1000007507 322
237 3300005545 Ga0070695_100007711 Ga0070695_1000077115 322
238 3300005546 Ga0070696_100042836 Ga0070696_1000428362 322
239 3300005546 Ga0070696_100139037 Ga0070696_1001390372 322
240 3300005547 Ga0070693_100011546 Ga0070693_1000115462 322
241 3300005547 Ga0070693_100199264 Ga0070693_1001992642 322
242 3300005549 Ga0070704_100276403 Ga0070704_1002764032 322
243 3300005843 Ga0068860_100228843 Ga0068860_1002288432 322
244 3300005844 Ga0068862_100032891 Ga0068862_1000328913 322
245 3300005937 Ga0081455_10000416 Ga0081455_1000041636 322
246 3300005983 Ga0081540_1016095 Ga0081540_10160953 322
247 3300006844 Ga0075428_100000643 Ga0075428_10000064323 322
248 3300006844 Ga0075428_100006057 Ga0075428_1000060577 322
249 3300006846 Ga0075430_100000052 Ga0075430_10000005220 322
250 3300006847 Ga0075431_100000441 Ga0075431_1000004412 322
251 3300006852 Ga0075433_10098528 Ga0075433_100985282 322
252 3300006852 Ga0075433_10237655 Ga0075433_102376551 322
253 3300006871 Ga0075434_100090903 Ga0075434_1000909033 322
254 3300006880 Ga0075429_100005000 Ga0075429_10000500013 322
255 3300006880 Ga0075429_100316524 Ga0075429_1003165242 322
256 3300007076 Ga0075435_100090616 Ga0075435_1000906162 322
257 3300007076 Ga0075435_100098225 Ga0075435_1000982252 322
258 3300009094 Ga0111539_10039635 Ga0111539_100396352 322
259 3300009094 Ga0111539_10593173 Ga0111539_105931732 322
260 3300009094 Ga0111539_10746746 Ga0111539_107467461 322
261 3300009147 Ga0114129_10002725 Ga0114129_1000272518 322
262 3300009147 Ga0114129_10063641 Ga0114129_100636415 322
263 3300009147 Ga0114129_10133796 Ga0114129_101337962 322
264 3300009174 Ga0105241_10039953 Ga0105241_100399532 322
265 3300009176 Ga0105242_10295278 Ga0105242_102952782 322
266 3300025910 Ga0207684_10000882 Ga0207684_100008826 322
267 3300025910 Ga0207684_10022325 Ga0207684_100223253 322
268 3300025910 Ga0207684_10510722 Ga0207684_105107221 322
269 3300025911 Ga0207654_10041738 Ga0207654_100417383 322
270 3300025917 Ga0207660_10049773 Ga0207660_100497733 322
271 3300025922 Ga0207646_10001105 Ga0207646_1000110520 322
272 3300025922 Ga0207646_10014803 Ga0207646_100148036 322
273 3300025933 Ga0207706_10025915 Ga0207706_100259155 322
274 3300025938 Ga0207704_10024464 Ga0207704_100244642 322
275 3300025940 Ga0207691_10017144 Ga0207691_100171443 322
276 3300025942 Ga0207689_10221842 Ga0207689_102218422 322
277 3300025961 Ga0207712_10036600 Ga0207712_100366002 322
278 3300026089 Ga0207648_10042560 Ga0207648_100425606 322
279 3300026118 Ga0207675_100138321 Ga0207675_1001383212 322
280 3300027364 Ga0209967_1001933 Ga0209967_10019332 322
281 3300027395 Ga0209996_1005063 Ga0209996_10050632 322
282 3300027471 Ga0209995_1010709 Ga0209995_10107091 322
283 3300027526 Ga0209968_1002209 Ga0209968_10022093 322
284 3300027543 Ga0209999_1006774 Ga0209999_10067742 322
285 3300027614 Ga0209970_1002261 Ga0209970_10022614 322
286 3300027665 Ga0209983_1003194 Ga0209983_10031943 322
287 3300027682 Ga0209971_1000748 Ga0209971_10007484 322
288 3300027695 Ga0209966_1001504 Ga0209966_10015044 322
289 3300027717 Ga0209998_10000073 Ga0209998_1000007336 322
290 3300027876 Ga0209974_10004826 Ga0209974_100048264 322
291 3300027907 Ga0207428_10015368 Ga0207428_100153688 322
292 3300028380 Ga0268265_10006519 Ga0268265_100065195 322
293 3300037312 Ga0395899_0012313 Ga0395899_0012313_888_1862 322
294 3300037418 Ga0395900_0042806 Ga0395900_0042806_1749_2723 322
295 3300037466 Ga0395898_0012798 Ga0395898_0012798_5576_6550 322
296 3300038443 Ga0395901_0002127 Ga0395901_0002127_11125_12099 322
297 3300042439 Ga0439464_0021087 Ga0439464_0021087_505_1485 322
298 3300042461 Ga0439460_0000782 Ga0439460_0000782_2897_3877 322
299 3300042876 Ga0451577_0102126 Ga0451577_0102126_34_1014 322
300 3300044673 Ga0453683_0194725 Ga0453683_0194725_35_1015 322
301 3300044673 Ga0453683_0253265 Ga0453683_0253265_122_1096 322
302 3300044712 Ga0453684_0366663 Ga0453684_0366663_399_1379 322
303 3300049574 Ga0501038_0044414 Ga0501038_0044414_1643_2623 322
304 3300049576 Ga0501040_0002959 Ga0501040_0002959_50_1030 322
305 3300049576 Ga0501040_0014607 Ga0501040_0014607_3209_4183 322
306 3300049577 Ga0501041_0000861 Ga0501041_0000861_9880_10860 322
307 3300049577 Ga0501041_0187302 Ga0501041_0187302_97_1071 322
308 3300049578 Ga0501042_0010542 Ga0501042_0010542_3161_4141 322
309 3300049578 Ga0501042_0162795 Ga0501042_0162795_310_1284 322
310 3300049580 Ga0501046_0004202 Ga0501046_0004202_12088_13068 322
311 3300049581 Ga0501047_0044788 Ga0501047_0044788_2521_3501 322
312 3300049582 Ga0501048_0056353 Ga0501048_0056353_1655_2635 322
313 3300049582 Ga0501048_0141519 Ga0501048_0141519_475_1449 322
314 3300049587 Ga0501071_0116133 Ga0501071_0116133_252_1226 322
315 3300049587 Ga0501071_0194457 Ga0501071_0194457_416_1396 322
316 3300049588 Ga0501072_0055670 Ga0501072_0055670_1216_2190 322
317 3300049591 Ga0501075_0227897 Ga0501075_0227897_219_1193 322
318 3300049741 Ga0501079_0013920 Ga0501079_0013920_4948_5928 322
319 3300049743 Ga0501081_0007167 Ga0501081_0007167_812_1792 322
320 3300049743 Ga0501081_0213022 Ga0501081_0213022_109_1083 322
321 3300049744 Ga0501083_0025940 Ga0501083_0025940_89_1069 322
322 3300049824 Ga0501045_0000480 Ga0501045_0000480_11439_12419 322
323 3300050507 nmdc:mga05p37_522242_c1 nmdc:mga05p37_522242_c1_73_1044 322
324 3300050507 nmdc:mga05p37_82664_c1 nmdc:mga05p37_82664_c1_525_1499 322
325 3300050508 nmdc:mga09592_193852_c1 nmdc:mga09592_193852_c1_31_1008 322
326 3300050510 nmdc:mga06r32_229478_c1 nmdc:mga06r32_229478_c1_117_1094 322
327 3300050511 nmdc:mga08y16_3110_c1 nmdc:mga08y16_3110_c1_6498_7472 322
328 3300050512 nmdc:mga0n895_255505_c1 nmdc:mga0n895_255505_c1_312_1331 322
329 3300050512 nmdc:mga0n895_38719_c1 nmdc:mga0n895_38719_c1_2813_3790 322
330 3300050512 nmdc:mga0n895_88526_c1 nmdc:mga0n895_88526_c1_1207_2181 322
331 3300050513 nmdc:mga0rr50_66137_c1 nmdc:mga0rr50_66137_c1_132_1106 322
332 3300050515 nmdc:mga0a205_108572_c2 nmdc:mga0a205_108572_c2_1024_1998 322
333 3300054114 Ga0501084_0003815 Ga0501084_0003815_2816_3796 322
334 3300060353 Ga0501082_0000747 Ga0501082_0000747_2572_3552 322
335 3300003203 JGI25406J46586_10030998 JGI25406J46586_100309982 323
336 3300005295 Ga0065707_10176800 Ga0065707_101768002 323
337 3300005336 Ga0070680_100034448 Ga0070680_1000344486 323
338 3300005438 Ga0070701_10107816 Ga0070701_101078161 323
339 3300005440 Ga0070705_100009791 Ga0070705_1000097913 323
340 3300005444 Ga0070694_100015746 Ga0070694_1000157465 323
341 3300005445 Ga0070708_100000402 Ga0070708_10000040216 323
342 3300005467 Ga0070706_100008099 Ga0070706_1000080997 323
343 3300005467 Ga0070706_100022623 Ga0070706_1000226233 323
344 3300005468 Ga0070707_100005986 Ga0070707_1000059869 323
345 3300005468 Ga0070707_100055971 Ga0070707_1000559713 323
346 3300005468 Ga0070707_100189294 Ga0070707_1001892943 323
347 3300005471 Ga0070698_100004215 Ga0070698_1000042159 323
348 3300005518 Ga0070699_100000945 Ga0070699_1000009455 323
349 3300005536 Ga0070697_100000582 Ga0070697_10000058223 323
350 3300005536 Ga0070697_100087204 Ga0070697_1000872042 323
351 3300005536 Ga0070697_100163938 Ga0070697_1001639382 323
352 3300005536 Ga0070697_100384843 Ga0070697_1003848431 323
353 3300005544 Ga0070686_100197099 Ga0070686_1001970991 323
354 3300005545 Ga0070695_100142048 Ga0070695_1001420482 323
355 3300005546 Ga0070696_100148120 Ga0070696_1001481202 323
356 3300005549 Ga0070704_100006216 Ga0070704_1000062166 323
357 3300005549 Ga0070704_100085659 Ga0070704_1000856593 323
358 3300005617 Ga0068859_100059247 Ga0068859_1000592473 323
359 3300005843 Ga0068860_100305553 Ga0068860_1003055532 323
360 3300005844 Ga0068862_100262465 Ga0068862_1002624652 323
361 3300005983 Ga0081540_1067308 Ga0081540_10673082 323
362 3300005985 Ga0081539_10000009 Ga0081539_10000009376 323
363 3300006163 Ga0070715_10150365 Ga0070715_101503652 323
364 3300006844 Ga0075428_100010432 Ga0075428_10001043211 323
365 3300006844 Ga0075428_100013939 Ga0075428_1000139391 323
366 3300006844 Ga0075428_100016667 Ga0075428_1000166676 323
367 3300006844 Ga0075428_100074766 Ga0075428_1000747662 323
368 3300006846 Ga0075430_100001578 Ga0075430_1000015784 323
369 3300006846 Ga0075430_100010397 Ga0075430_1000103972 323
370 3300006846 Ga0075430_100052885 Ga0075430_1000528852 323
371 3300006847 Ga0075431_100000689 Ga0075431_1000006899 323
372 3300006847 Ga0075431_100002572 Ga0075431_10000257213 323
373 3300006847 Ga0075431_100012158 Ga0075431_1000121582 323
374 3300006847 Ga0075431_100013137 Ga0075431_1000131374 323
375 3300006847 Ga0075431_100026317 Ga0075431_1000263177 323
376 3300006847 Ga0075431_100028392 Ga0075431_1000283923 323
377 3300006847 Ga0075431_100089030 Ga0075431_1000890302 323
378 3300006852 Ga0075433_10000633 Ga0075433_1000063316 323
379 3300006852 Ga0075433_10005682 Ga0075433_100056829 323
380 3300006852 Ga0075433_10034012 Ga0075433_100340125 323
381 3300006852 Ga0075433_10063873 Ga0075433_100638734 323
382 3300006852 Ga0075433_10393054 Ga0075433_103930542 323
383 3300006871 Ga0075434_100008472 Ga0075434_1000084723 323
384 3300006871 Ga0075434_100021393 Ga0075434_1000213933 323
385 3300006871 Ga0075434_100068967 Ga0075434_1000689673 323
386 3300006880 Ga0075429_100001562 Ga0075429_10000156215 323
387 3300006880 Ga0075429_100006823 Ga0075429_1000068232 323
388 3300006880 Ga0075429_100036523 Ga0075429_1000365234 323
389 3300006880 Ga0075429_100094634 Ga0075429_1000946343 323
390 3300006880 Ga0075429_100100406 Ga0075429_1001004062 323
391 3300006880 Ga0075429_100216658 Ga0075429_1002166581 323
392 3300006880 Ga0075429_100223861 Ga0075429_1002238612 323
393 3300006914 Ga0075436_100004744 Ga0075436_1000047444 323
394 3300006914 Ga0075436_100215466 Ga0075436_1002154661 323
395 3300006931 Ga0097620_100059245 Ga0097620_1000592453 323
396 3300007076 Ga0075435_100003533 Ga0075435_1000035332 323
397 3300007076 Ga0075435_100013156 Ga0075435_1000131563 323
398 3300007076 Ga0075435_100247907 Ga0075435_1002479072 323
399 3300007265 Ga0099794_10026706 Ga0099794_100267062 323
400 3300009094 Ga0111539_10006916 Ga0111539_100069167 323
401 3300009094 Ga0111539_10054679 Ga0111539_100546792 323
402 3300009147 Ga0114129_10002794 Ga0114129_1000279418 323
403 3300009147 Ga0114129_10007546 Ga0114129_1000754611 323
404 3300009147 Ga0114129_10009136 Ga0114129_100091366 323
405 3300009147 Ga0114129_10027570 Ga0114129_100275704 323
406 3300009147 Ga0114129_10027885 Ga0114129_100278858 323
407 3300009147 Ga0114129_10043464 Ga0114129_100434645 323
408 3300009147 Ga0114129_10074570 Ga0114129_100745703 323
409 3300009147 Ga0114129_10273590 Ga0114129_102735903 323
410 3300009148 Ga0105243_10036937 Ga0105243_100369372 323
411 3300009176 Ga0105242_10100529 Ga0105242_101005292 323
412 3300009553 Ga0105249_10210333 Ga0105249_102103332 323
413 3300013297 Ga0157378_10082763 Ga0157378_100827632 323
414 3300013297 Ga0157378_10157496 Ga0157378_101574962 323
415 3300013306 Ga0163162_10149240 Ga0163162_101492402 323
416 3300013306 Ga0163162_10207890 Ga0163162_102078901 323
417 3300014326 Ga0157380_10070261 Ga0157380_100702612 323
418 3300025910 Ga0207684_10000370 Ga0207684_100003705 323
419 3300025910 Ga0207684_10023930 Ga0207684_100239303 323
420 3300025910 Ga0207684_10027469 Ga0207684_100274691 323
421 3300025922 Ga0207646_10000466 Ga0207646_1000046621 323
422 3300025922 Ga0207646_10031830 Ga0207646_100318305 323
423 3300025931 Ga0207644_10253939 Ga0207644_102539392 323
424 3300025961 Ga0207712_10194120 Ga0207712_101941202 323
425 3300026118 Ga0207675_100142511 Ga0207675_1001425112 323
426 3300027671 Ga0209588_1005119 Ga0209588_10051193 323
427 3300027907 Ga0207428_10000018 Ga0207428_10000018192 323
428 3300028380 Ga0268265_10099869 Ga0268265_100998692 323
429 3300031548 Ga0307408_100013585 Ga0307408_1000135855 323
430 3300031548 Ga0307408_100069486 Ga0307408_1000694862 323
431 3300031548 Ga0307408_100195224 Ga0307408_1001952242 323
432 3300031731 Ga0307405_10097686 Ga0307405_100976862 323
433 3300031901 Ga0307406_10025910 Ga0307406_100259102 323
434 3300031995 Ga0307409_100140822 Ga0307409_1001408222 323
435 3300032002 Ga0307416_100014969 Ga0307416_1000149692 323
436 3300032002 Ga0307416_100116009 Ga0307416_1001160092 323
437 3300032005 Ga0307411_10133418 Ga0307411_101334182 323
438 3300035112 Ga0373932_0008281 Ga0373932_0008281_611_1582 323
439 3300035114 Ga0373939_0006712 Ga0373939_0006712_1765_2736 323
440 3300035242 Ga0373962_0031653 Ga0373962_0031653_158_1129 323
441 3300035691 Ga0373931_0019280 Ga0373931_0019280_663_1634 323
442 3300037418 Ga0395900_0027721 Ga0395900_0027721_2021_2992 323
443 3300037471 Ga0395905_0058565 Ga0395905_0058565_922_1893 323
444 3300038443 Ga0395901_0139318 Ga0395901_0139318_604_1575 323
445 3300042436 Ga0439435_0003264 Ga0439435_0003264_1571_2548 323
446 3300042876 Ga0451577_0159758 Ga0451577_0159758_223_1194 323
447 3300045051 Ga0451576_0017327 Ga0451576_0017327_2347_3330 323
448 3300046472 Ga0495580_0000143 Ga0495580_0000143_30912_31883 323
449 3300048905 Ga0496102_0044242 Ga0496102_0044242_100_1122 323
450 3300048909 Ga0496106_0183440 Ga0496106_0183440_99_1121 323
451 3300049574 Ga0501038_0029941 Ga0501038_0029941_2376_3347 323
452 3300049575 Ga0501039_0033275 Ga0501039_0033275_2485_3456 323
453 3300049576 Ga0501040_0019385 Ga0501040_0019385_1268_2239 323
454 3300049577 Ga0501041_0005328 Ga0501041_0005328_4394_5365 323
455 3300049578 Ga0501042_0067758 Ga0501042_0067758_333_1304 323
456 3300049580 Ga0501046_0269998 Ga0501046_0269998_157_1134 323
457 3300049583 Ga0501067_0060734 Ga0501067_0060734_870_1841 323
458 3300049585 Ga0501069_0053952 Ga0501069_0053952_351_1322 323
459 3300049587 Ga0501071_0076847 Ga0501071_0076847_75_1046 323
460 3300049588 Ga0501072_0007063 Ga0501072_0007063_1914_2885 323
461 3300049588 Ga0501072_0013749 Ga0501072_0013749_5031_6008 323
462 3300049590 Ga0501074_0065598 Ga0501074_0065598_1599_2570 323
463 3300049591 Ga0501075_0072341 Ga0501075_0072341_125_1096 323
464 3300049592 Ga0501076_0021169 Ga0501076_0021169_651_1622 323
465 3300049592 Ga0501076_0066049 Ga0501076_0066049_1859_2836 323
466 3300049593 Ga0501077_0013244 Ga0501077_0013244_1949_2920 323
467 3300049741 Ga0501079_0074726 Ga0501079_0074726_1401_2372 323
468 3300049741 Ga0501079_0123140 Ga0501079_0123140_965_1942 323
469 3300049741 Ga0501079_0244870 Ga0501079_0244870_211_1185 323
470 3300049743 Ga0501081_0016506 Ga0501081_0016506_2197_3168 323
471 3300049743 Ga0501081_0095905 Ga0501081_0095905_521_1492 323
472 3300049743 Ga0501081_0167363 Ga0501081_0167363_20_991 323
473 3300049744 Ga0501083_0075043 Ga0501083_0075043_793_1764 323
474 3300049824 Ga0501045_0036018 Ga0501045_0036018_97_1068 323
475 3300049824 Ga0501045_0066139 Ga0501045_0066139_1303_2274 323
476 3300050507 nmdc:mga05p37_14166_c1 nmdc:mga05p37_14166_c1_2653_3630 323
477 3300050507 nmdc:mga05p37_168488_c1 nmdc:mga05p37_168488_c1_338_1309 323
478 3300050507 nmdc:mga05p37_20326_c1 nmdc:mga05p37_20326_c1_6486_7457 323
479 3300050507 nmdc:mga05p37_20750_c1 nmdc:mga05p37_20750_c1_3356_4327 323
480 3300050507 nmdc:mga05p37_24059_c1 nmdc:mga05p37_24059_c1_6368_7339 323
481 3300050507 nmdc:mga05p37_3855_c1 nmdc:mga05p37_3855_c1_7589_8560 323
482 3300050507 nmdc:mga05p37_47545_c1 nmdc:mga05p37_47545_c1_2390_3361 323
483 3300050507 nmdc:mga05p37_59708_c1 nmdc:mga05p37_59708_c1_375_1346 323
484 3300050508 nmdc:mga09592_108257_c1 nmdc:mga09592_108257_c1_1036_2007 323
485 3300050508 nmdc:mga09592_171719_c1 nmdc:mga09592_171719_c1_76_1050 323
486 3300050508 nmdc:mga09592_17173_c1 nmdc:mga09592_17173_c1_1764_2735 323
487 3300050508 nmdc:mga09592_42587_c1 nmdc:mga09592_42587_c1_1739_2710 323
488 3300050508 nmdc:mga09592_5944_c1 nmdc:mga09592_5944_c1_7585_8556 323
489 3300050508 nmdc:mga09592_8953_c1 nmdc:mga09592_8953_c1_7089_8060 323
490 3300050509 nmdc:mga0qj67_131309_c1 nmdc:mga0qj67_131309_c1_516_1487 323
491 3300050509 nmdc:mga0qj67_3798_c1 nmdc:mga0qj67_3798_c1_7186_8157 323
492 3300050509 nmdc:mga0qj67_676_c1 nmdc:mga0qj67_676_c1_8537_9514 323
493 3300050510 nmdc:mga06r32_11071_c1 nmdc:mga06r32_11071_c1_2127_3098 323
494 3300050510 nmdc:mga06r32_115929_c1 nmdc:mga06r32_115929_c1_39_1010 323
495 3300050510 nmdc:mga06r32_1475_c1 nmdc:mga06r32_1475_c1_4604_5581 323
496 3300050510 nmdc:mga06r32_217476_c1 nmdc:mga06r32_217476_c1_397_1368 323
497 3300050510 nmdc:mga06r32_258282_c1 nmdc:mga06r32_258282_c1_525_1496 323
498 3300050510 nmdc:mga06r32_2962_c1 nmdc:mga06r32_2962_c1_5650_6621 323
499 3300050510 nmdc:mga06r32_703_c1 nmdc:mga06r32_703_c1_2433_3404 323
500 3300050511 nmdc:mga08y16_1251_c1 nmdc:mga08y16_1251_c1_16900_17871 323
501 3300050511 nmdc:mga08y16_66665_c1 nmdc:mga08y16_66665_c1_984_1955 323
502 3300050512 nmdc:mga0n895_100148_c1 nmdc:mga0n895_100148_c1_89_1060 323
503 3300050512 nmdc:mga0n895_149134_c1 nmdc:mga0n895_149134_c1_184_1155 323
504 3300050512 nmdc:mga0n895_155573_c1 nmdc:mga0n895_155573_c1_1093_2157 323
505 3300050512 nmdc:mga0n895_2213_c1 nmdc:mga0n895_2213_c1_5885_6856 323
506 3300050512 nmdc:mga0n895_6506_c1 nmdc:mga0n895_6506_c1_6997_7968 323
507 3300050513 nmdc:mga0rr50_2496_c1 nmdc:mga0rr50_2496_c1_2377_3348 323
508 3300050513 nmdc:mga0rr50_435120_c1 nmdc:mga0rr50_435120_c1_58_1029 323
509 3300050513 nmdc:mga0rr50_58165_c1 nmdc:mga0rr50_58165_c1_624_1595 323
510 3300050514 nmdc:mga08x19_3746_c1 nmdc:mga08x19_3746_c1_6068_7039 323
511 3300050515 nmdc:mga0a205_10565_c1 nmdc:mga0a205_10565_c1_5796_6767 323
512 3300050515 nmdc:mga0a205_107896_c1 nmdc:mga0a205_107896_c1_90_1061 323
513 3300050515 nmdc:mga0a205_12648_c1 nmdc:mga0a205_12648_c1_4029_5000 323
514 3300050515 nmdc:mga0a205_221556_c1 nmdc:mga0a205_221556_c1_627_1598 323
515 3300050515 nmdc:mga0a205_63619_c1 nmdc:mga0a205_63619_c1_854_1825 323
516 3300054114 Ga0501084_0041855 Ga0501084_0041855_237_1208 323
517 3300054114 Ga0501084_0298493 Ga0501084_0298493_111_1088 323
518 3300060353 Ga0501082_0015884 Ga0501082_0015884_2654_3625 323
519 3300061734 Ga0530510_0036772 Ga0530510_0036772_1290_2261 323
520 3300061734 Ga0530510_0082623 Ga0530510_0082623_935_1912 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

44

251

0.89

PF13379

NMT1_2

NMT1-like family

27

260

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8668 29 319
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8513 30 313
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8487 31 323
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8476 29 319
2i49-assembly1.cif.gz_A crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 0.8262 31 270
ID Description Score Start End Superfamily
3qslB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8252 116 203 3.40.190.10
2i4cA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8225 112 207 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8159 116 209 3.40.190.10
2x7qA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8096 31 316 3.40.190.10
2x26A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8031 29 315 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A556AV86-F1-model_v4 ABC transporter substrate-binding protein 0.9056 29 318 GO:0009228
GO:0016740
GO:0046872
AF-A0A7C3NUB1-F1-model_v4 ABC transporter substrate-binding protein 0.9046 28 312
AF-A0A662V9F2-F1-model_v4 ABC transporter substrate-binding protein 0.8987 23 318
AF-A0A2V6NUP2-F1-model_v4 SsuA/THI5-like domain-containing protein 0.8963 13 323
AF-A0A1F9FYR8-F1-model_v4 SsuA/THI5-like domain-containing protein 0.8963 23 318

Feature Viewer

pLDDT pTM Quality
89.75 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map