F458560

General Info

Members Datasets Scaffolds Average Seq Length
520 216 1040 179

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0001306|Ga0373934_0001306_1429_2055
Length 208
Sequence MAILKVARMGHPVLRAKAKPIPPKEIGSVPVQHLIDDMFETMGEYSGIGLAAPQVHESLRVFVAGVRNIPIPAVLDNDEEMPFIVLVNPEVTPIGRVAEEGWEGCLSVPDIRGLVPRPLEVQVKAYDRTGRRVELIAKGLSARVIQHETDHLDGILFFDRMASYESLTFMDEYRRYWAKDDEDETDADGPDAQKTAPAEKAGKARTGR

Samples

Sample ID Description Type Environment
1 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
146 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
147 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
148 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.58
Rhizosphere 99.42
Stem 0
Stem Tuber 0
Unclassified 4.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373934_0001306 3300035086 Bacteria 9080
2 JGI24742J22300_10072337 3300002244 Bacteria 644
3 JGI25406J46586_10000491 3300003203 Bacteria 18498
4 JGI25406J46586_10003383 3300003203 Bacteria 7508
5 Ga0065714_10109336 3300005288 Bacteria 1494
6 Ga0065704_10110482 3300005289 Bacteria 1979
7 Ga0065712_10002431 3300005290 Bacteria 4494
8 Ga0065712_10086475 3300005290 Bacteria 2634
9 Ga0065712_10422076 3300005290 Bacteria 711
10 Ga0065715_10131923 3300005293 Bacteria 1993
11 Ga0065715_10166413 3300005293 Bacteria 1583
12 Ga0065715_10230196 3300005293 Bacteria 1237
13 Ga0065715_10377712 3300005293 Bacteria 863
14 Ga0065707_10017477 3300005295 Bacteria 2759
15 Ga0065707_10093714 3300005295 Bacteria 3588
16 Ga0065707_10131741 3300005295 Bacteria 1908
17 Ga0070676_10236680 3300005328 Bacteria 1213
18 Ga0070690_100051338 3300005330 Bacteria 2632
19 Ga0070670_100017979 3300005331 Bacteria 6067
20 Ga0070677_10003940 3300005333 Bacteria 4818
21 Ga0068869_100383299 3300005334 Bacteria 1153
22 Ga0070666_10042221 3300005335 Bacteria 3050
23 Ga0068868_100730461 3300005338 Bacteria 888
24 Ga0070689_100029481 3300005340 Bacteria 4154
25 Ga0070689_100513436 3300005340 Bacteria 1028
26 Ga0070689_100802929 3300005340 Bacteria 827
27 Ga0070687_100110159 3300005343 Bacteria 1557
28 Ga0070687_100442370 3300005343 Bacteria 863
29 Ga0070692_10456152 3300005345 Bacteria 819
30 Ga0070668_100004968 3300005347 Bacteria 9847
31 Ga0070668_100312773 3300005347 Bacteria 1320
32 Ga0070669_100004537 3300005353 Bacteria 10025
33 Ga0070669_100152028 3300005353 Bacteria 1792
34 Ga0070669_100762932 3300005353 Bacteria 820
35 Ga0070675_100099004 3300005354 Bacteria 2453
36 Ga0070675_100163378 3300005354 Bacteria 1916
37 Ga0070675_100353791 3300005354 Bacteria 1303
38 Ga0070675_100483504 3300005354 Bacteria 1114
39 Ga0070673_100014477 3300005364 Bacteria 5497
40 Ga0070673_100299859 3300005364 Bacteria 1414
41 Ga0070673_100947143 3300005364 Unclassified 800
42 Ga0070673_101097631 3300005364 Bacteria 743
43 Ga0070688_100110059 3300005365 Bacteria 1831
44 Ga0070688_100283254 3300005365 Bacteria 1192
45 Ga0070688_100336557 3300005365 Unclassified 1101
46 Ga0070667_100020205 3300005367 Bacteria 5529
47 Ga0070701_10275301 3300005438 Bacteria 1026
48 Ga0070700_100014032 3300005441 Bacteria 4517
49 Ga0070700_100161529 3300005441 Bacteria 1543
50 Ga0070708_100306765 3300005445 Bacteria 1495
51 Ga0070678_100540554 3300005456 Bacteria 1033
52 Ga0070662_100037566 3300005457 Bacteria 3434
53 Ga0068867_100010452 3300005459 Bacteria 6550
54 Ga0068867_100419479 3300005459 Bacteria 1133
55 Ga0068867_100700076 3300005459 Bacteria 894
56 Ga0070685_10165109 3300005466 Bacteria 1414
57 Ga0070685_10192448 3300005466 Bacteria 1321
58 Ga0070707_100191039 3300005468 Unclassified 1997
59 Ga0070698_100002805 3300005471 Bacteria 19173
60 Ga0070698_100159043 3300005471 Unclassified 2204
61 Ga0070698_100254066 3300005471 Bacteria 1690
62 Ga0070699_100003987 3300005518 Bacteria 13044
63 Ga0070699_100195674 3300005518 Bacteria 1797
64 Ga0070672_100031936 3300005543 Bacteria 3969
65 Ga0070672_100037878 3300005543 Bacteria 3682
66 Ga0070672_100162518 3300005543 Bacteria 1853
67 Ga0070686_100140580 3300005544 Bacteria 1680
68 Ga0070686_100909099 3300005544 Bacteria 716
69 Ga0070695_101183822 3300005545 Bacteria 628
70 Ga0070696_100246737 3300005546 Bacteria 1349
71 Ga0070665_100065728 3300005548 Bacteria 3638
72 Ga0070704_100064505 3300005549 Bacteria 2633
73 Ga0070704_100911998 3300005549 Bacteria 791
74 Ga0068857_100328217 3300005577 Bacteria 1414
75 Ga0070702_100106708 3300005615 Bacteria 1728
76 Ga0070702_100197108 3300005615 Bacteria 1330
77 Ga0068852_100407796 3300005616 Bacteria 1338
78 Ga0068859_100025178 3300005617 Bacteria 5971
79 Ga0068859_100104077 3300005617 Bacteria 2897
80 Ga0068864_100034502 3300005618 Bacteria 4304
81 Ga0068866_10500975 3300005718 Bacteria 803
82 Ga0068861_100077217 3300005719 Bacteria 2597
83 Ga0068861_100152278 3300005719 Bacteria 1899
84 Ga0068861_100379867 3300005719 Bacteria 1248
85 Ga0068870_10003781 3300005840 Bacteria 6440
86 Ga0068863_100275682 3300005841 Bacteria 1629
87 Ga0068858_100073975 3300005842 Bacteria 3163
88 Ga0068858_100083688 3300005842 Bacteria 2967
89 Ga0068858_100563095 3300005842 Bacteria 1104
90 Ga0068860_100040744 3300005843 Bacteria 4438
91 Ga0068860_101612261 3300005843 Bacteria 671
92 Ga0068862_100009631 3300005844 Bacteria 7985
93 Ga0068862_100381317 3300005844 Bacteria 1315
94 Ga0068862_100874235 3300005844 Bacteria 882
95 Ga0068862_101091391 3300005844 Bacteria 793
96 Ga0081538_10047963 3300005981 Bacteria 2612
97 Ga0081539_10000093 3300005985 Bacteria 207314
98 Ga0081539_10001136 3300005985 Bacteria 48290
99 Ga0081539_10012179 3300005985 Bacteria 6673
100 Ga0081539_10066481 3300005985 Bacteria 1954
101 Ga0070712_100257471 3300006175 Bacteria 1397
102 Ga0068871_100070149 3300006358 Bacteria 2880
103 Ga0075428_100083744 3300006844 Bacteria 3480
104 Ga0075428_100267164 3300006844 Bacteria 1841
105 Ga0075428_100656141 3300006844 Bacteria 1119
106 Ga0075428_100923846 3300006844 Bacteria 925
107 Ga0075430_100227552 3300006846 Bacteria 1547
108 Ga0075430_100330344 3300006846 Bacteria 1260
109 Ga0075430_100997052 3300006846 Bacteria 690
110 Ga0075431_100128363 3300006847 Bacteria 2616
111 Ga0075433_10002779 3300006852 Bacteria 13391
112 Ga0075433_10815626 3300006852 Bacteria 815
113 Ga0075434_100014738 3300006871 Bacteria 7480
114 Ga0075434_100070493 3300006871 Bacteria 3486
115 Ga0075434_100703174 3300006871 Bacteria 1028
116 Ga0075429_100042637 3300006880 Bacteria 3948
117 Ga0075429_100125563 3300006880 Bacteria 2244
118 Ga0075429_100172844 3300006880 Bacteria 1893
119 Ga0075429_100322208 3300006880 Bacteria 1353
120 Ga0075429_100613523 3300006880 Bacteria 953
121 Ga0068865_100174639 3300006881 Bacteria 1650
122 Ga0097620_100025178 3300006931 Bacteria 5971
123 Ga0097620_100104068 3300006931 Bacteria 2897
124 Ga0075435_100283164 3300007076 Bacteria 1415
125 Ga0111539_10000126 3300009094 Bacteria 86123
126 Ga0111539_10004218 3300009094 Bacteria 18846
127 Ga0111539_10037923 3300009094 Bacteria 5814
128 Ga0111539_10041823 3300009094 Bacteria 5507
129 Ga0111539_10047336 3300009094 Bacteria 5139
130 Ga0111539_10116185 3300009094 Bacteria 3138
131 Ga0111539_10157260 3300009094 Bacteria 2659
132 Ga0111539_10174817 3300009094 Bacteria 2508
133 Ga0111539_10220856 3300009094 Bacteria 2207
134 Ga0111539_10386123 3300009094 Bacteria 1630
135 Ga0111539_10523556 3300009094 Bacteria 1381
136 Ga0111539_11396956 3300009094 Bacteria 812
137 Ga0105245_10353912 3300009098 Bacteria 1456
138 Ga0105247_10212226 3300009101 Bacteria 1306
139 Ga0114129_10000113 3300009147 Bacteria 80752
140 Ga0114129_10009011 3300009147 Bacteria 14229
141 Ga0114129_10036699 3300009147 Bacteria 6920
142 Ga0114129_10039490 3300009147 Bacteria 6654
143 Ga0114129_10651585 3300009147 Unclassified 1359
144 Ga0114129_10925390 3300009147 Unclassified 1103
145 Ga0105242_10232106 3300009176 Bacteria 1654
146 Ga0105242_10299448 3300009176 Bacteria 1467
147 Ga0105248_10061265 3300009177 Bacteria 4224
148 Ga0105249_10055901 3300009553 Bacteria 3613
149 Ga0105249_10147802 3300009553 Bacteria 2259
150 Ga0105249_10578642 3300009553 Bacteria 1176
151 Ga0105249_10876780 3300009553 Bacteria 964
152 Ga0105246_10194553 3300011119 Bacteria 1572
153 Ga0157371_10894196 3300013102 Bacteria 673
154 Ga0157378_10579419 3300013297 Bacteria 1131
155 Ga0163162_10032776 3300013306 Bacteria 5159
156 Ga0163162_10033720 3300013306 Bacteria 5089
157 Ga0157375_10709719 3300013308 Bacteria 1159
158 Ga0157375_11317344 3300013308 Bacteria 849
159 Ga0163163_10000047 3300014325 Bacteria 131685
160 Ga0163163_10002902 3300014325 Bacteria 14505
161 Ga0163163_10301540 3300014325 Bacteria 1655
162 Ga0163163_10385081 3300014325 Bacteria 1460
163 Ga0157380_10061941 3300014326 Bacteria 2995
164 Ga0157380_10077373 3300014326 Bacteria 2711
165 Ga0157380_10182034 3300014326 Bacteria 1847
166 Ga0157380_10207554 3300014326 Bacteria 1743
167 Ga0157380_10253881 3300014326 Bacteria 1593
168 Ga0157380_10413432 3300014326 Bacteria 1284
169 Ga0157380_10507095 3300014326 Bacteria 1173
170 Ga0157380_10531243 3300014326 Bacteria 1150
171 Ga0157377_10142369 3300014745 Bacteria 1475
172 Ga0157379_10066688 3300014968 Bacteria 3218
173 Ga0163161_10041169 3300017792 Bacteria 3319
174 Ga0207697_10068710 3300025315 Bacteria 1482
175 Ga0207688_10453028 3300025901 Bacteria 800
176 Ga0207680_10070771 3300025903 Bacteria 2160
177 Ga0207643_10003442 3300025908 Bacteria 8511
178 Ga0207643_10105254 3300025908 Bacteria 1658
179 Ga0207684_10561780 3300025910 Bacteria 976
180 Ga0207662_10144836 3300025918 Bacteria 1507
181 Ga0207646_10288555 3300025922 Unclassified 1483
182 Ga0207681_10022294 3300025923 Bacteria 4038
183 Ga0207681_10169006 3300025923 Bacteria 1656
184 Ga0207650_10007401 3300025925 Bacteria 7476
185 Ga0207650_10221067 3300025925 Bacteria 1524
186 Ga0207650_10335641 3300025925 Bacteria 1240
187 Ga0207659_10011028 3300025926 Bacteria 5695
188 Ga0207659_10011848 3300025926 Bacteria 5522
189 Ga0207659_10024579 3300025926 Bacteria 4039
190 Ga0207659_10188093 3300025926 Bacteria 1641
191 Ga0207659_10415455 3300025926 Bacteria 1127
192 Ga0207644_10392411 3300025931 Bacteria 1133
193 Ga0207706_10260509 3300025933 Bacteria 1514
194 Ga0207670_10020926 3300025936 Bacteria 4026
195 Ga0207670_10245657 3300025936 Bacteria 1381
196 Ga0207670_10482434 3300025936 Bacteria 1004
197 Ga0207670_10756008 3300025936 Bacteria 808
198 Ga0207704_10214249 3300025938 Bacteria 1420
199 Ga0207691_10047085 3300025940 Bacteria 3960
200 Ga0207689_10387383 3300025942 Bacteria 1164
201 Ga0207679_10977894 3300025945 Bacteria 775
202 Ga0207651_10010376 3300025960 Bacteria 5160
203 Ga0207651_10181608 3300025960 Bacteria 1669
204 Ga0207651_10840825 3300025960 Unclassified 815
205 Ga0207712_10002016 3300025961 Bacteria 13325
206 Ga0207712_10087838 3300025961 Bacteria 2281
207 Ga0207712_10283294 3300025961 Bacteria 1353
208 Ga0207712_10753107 3300025961 Bacteria 853
209 Ga0207712_10777261 3300025961 Bacteria 840
210 Ga0207668_10112122 3300025972 Bacteria 2048
211 Ga0207668_10146801 3300025972 Bacteria 1821
212 Ga0207677_10190777 3300026023 Bacteria 1621
213 Ga0207703_10205645 3300026035 Bacteria 1752
214 Ga0207703_10665862 3300026035 Bacteria 988
215 Ga0207678_10065237 3300026067 Bacteria 3127
216 Ga0207708_10090319 3300026075 Bacteria 2361
217 Ga0207641_10519421 3300026088 Bacteria 1158
218 Ga0207648_10452266 3300026089 Bacteria 1170
219 Ga0207648_10674414 3300026089 Bacteria 957
220 Ga0207676_10019635 3300026095 Bacteria 4933
221 Ga0207674_10106248 3300026116 Bacteria 2785
222 Ga0207675_100132307 3300026118 Bacteria 2365
223 Ga0207675_100226621 3300026118 Bacteria 1802
224 Ga0207675_100410627 3300026118 Bacteria 1336
225 Ga0207683_10275978 3300026121 Bacteria 1536
226 Ga0207698_10466916 3300026142 Bacteria 1221
227 Ga0209968_1034482 3300027526 Bacteria 853
228 Ga0209999_1038830 3300027543 Bacteria 891
229 Ga0209970_1054624 3300027614 Unclassified 726
230 Ga0209966_1062523 3300027695 Bacteria 806
231 Ga0209998_10042221 3300027717 Bacteria 1038
232 Ga0209974_10073922 3300027876 Bacteria 1166
233 Ga0207428_10001071 3300027907 Bacteria 29876
234 Ga0207428_10001447 3300027907 Bacteria 24864
235 Ga0207428_10105645 3300027907 Bacteria 2171
236 Ga0207428_10119616 3300027907 Bacteria 2021
237 Ga0207428_10230484 3300027907 Bacteria 1386
238 Ga0207428_10328112 3300027907 Bacteria 1129
239 Ga0207428_10425844 3300027907 Bacteria 970
240 Ga0268265_10162288 3300028380 Bacteria 1900
241 Ga0268265_10406487 3300028380 Bacteria 1260
242 Ga0268264_10704920 3300028381 Bacteria 1003
243 Ga0307405_10070497 3300031731 Bacteria 2245
244 Ga0307413_10298606 3300031824 Bacteria 1220
245 Ga0307413_10828782 3300031824 Bacteria 780
246 Ga0307410_10018463 3300031852 Bacteria 4215
247 Ga0307406_10033965 3300031901 Bacteria 3126
248 Ga0307407_10044990 3300031903 Bacteria 2491
249 Ga0307407_11086440 3300031903 Bacteria 621
250 Ga0307412_10095564 3300031911 Bacteria 2089
251 Ga0307409_100002287 3300031995 Bacteria 9927
252 Ga0307409_100165521 3300031995 Bacteria 1940
253 Ga0307416_100007674 3300032002 Bacteria 6887
254 Ga0307414_10196693 3300032004 Unclassified 1636
255 Ga0307414_10360134 3300032004 Bacteria 1251
256 Ga0307411_10009810 3300032005 Bacteria 5062
257 Ga0307411_10025739 3300032005 Bacteria 3531
258 Ga0307415_100014449 3300032126 Bacteria 4642
259 Ga0307415_100210480 3300032126 Bacteria 1551
260 Ga0307415_101581240 3300032126 Unclassified 629
261 Ga0373951_0089131 3300035091 Bacteria 808
262 Ga0373939_0133962 3300035114 Unclassified 887
263 Ga0373941_0050068 3300035115 Bacteria 1325
264 Ga0373956_0002925 3300035119 Bacteria 6909
265 Ga0373956_0245592 3300035119 Bacteria 851
266 Ga0373957_0005735 3300035120 Bacteria 3869
267 Ga0373946_0072293 3300035171 Bacteria 1493
268 Ga0373955_0003346 3300035172 Bacteria 7045
269 Ga0373942_0026287 3300035207 Bacteria 1506
270 Ga0373933_0003860 3300035724 Bacteria 8268
271 Ga0373937_0000267 3300036401 Bacteria 50314
272 Ga0373925_1550903 3300037068 Unclassified 542
273 Ga0439461_0042627 3300041410 Bacteria 985
274 Ga0439441_151123 3300042001 Bacteria 547
275 Ga0450896_016284 3300042133 Bacteria 1068
276 Ga0439446_0068819 3300042156 Bacteria 1080
277 Ga0439434_0120605 3300042435 Bacteria 855
278 Ga0451576_0016692 3300045051 Bacteria 8099
279 Ga0451576_0063304 3300045051 Bacteria 3855
280 Ga0466967_1224721 3300045976 Unclassified 748
281 Ga0495592_0147744 3300046454 Bacteria 1628
282 Ga0495592_0459548 3300046454 Bacteria 796
283 Ga0495629_0011113 3300046459 Bacteria 6541
284 Ga0495580_0194994 3300046472 Bacteria 1397
285 Ga0495582_0485600 3300046473 Bacteria 714
286 Ga0495596_0282588 3300046500 Bacteria 645
287 Ga0495665_0273267 3300046531 Bacteria 868
288 Ga0495640_0503621 3300046533 Bacteria 737
289 Ga0495598_0010744 3300046537 Bacteria 2201
290 Ga0495598_0067308 3300046537 Bacteria 1120
291 Ga0495621_0005756 3300046539 Bacteria 3582
292 Ga0495656_0615113 3300046615 Unclassified 582
293 Ga0495599_0116572 3300046678 Bacteria 1661
294 Ga0495658_0105345 3300046683 Bacteria 1689
295 Ga0495613_0517583 3300046689 Bacteria 802
296 Ga0495600_0084523 3300046809 Bacteria 2071
297 Ga0495676_0021144 3300047321 Bacteria 5694
298 Ga0495675_0380327 3300047444 Bacteria 826
299 Ga0496109_0348185 3300048912 Bacteria 1400
300 Ga0496114_0122053 3300048917 Bacteria 2242
301 Ga0496114_0166528 3300048917 Bacteria 1919
302 Ga0501031_0006365 3300049568 Bacteria 7701
303 Ga0501031_0023290 3300049568 Bacteria 4038
304 Ga0501031_0026104 3300049568 Bacteria 3810
305 Ga0501031_0109787 3300049568 Bacteria 1801
306 Ga0501032_0002733 3300049569 Bacteria 13742
307 Ga0501032_0008738 3300049569 Bacteria 7377
308 Ga0501032_0028355 3300049569 Bacteria 3847
309 Ga0501032_0093367 3300049569 Bacteria 1995
310 Ga0501033_0002191 3300049570 Bacteria 16869
311 Ga0501033_0008397 3300049570 Bacteria 8000
312 Ga0501033_0008748 3300049570 Bacteria 7827
313 Ga0501033_0010716 3300049570 Bacteria 7027
314 Ga0501034_0002358 3300049571 Bacteria 23001
315 Ga0501034_0070418 3300049571 Bacteria 3508
316 Ga0501034_0073511 3300049571 Bacteria 3427
317 Ga0501034_0146031 3300049571 Bacteria 2342
318 Ga0501034_0146939 3300049571 Bacteria 2334
319 Ga0501034_0166398 3300049571 Bacteria 2173
320 Ga0501034_0461822 3300049571 Bacteria 1186
321 Ga0501034_0507874 3300049571 Bacteria 1118
322 Ga0501036_0004417 3300049572 Bacteria 11353
323 Ga0501036_0006425 3300049572 Bacteria 9542
324 Ga0501036_0048559 3300049572 Bacteria 3593
325 Ga0501036_0068482 3300049572 Bacteria 3004
326 Ga0501036_0136993 3300049572 Bacteria 2066
327 Ga0501036_0151967 3300049572 Bacteria 1952
328 Ga0501037_0001691 3300049573 Bacteria 16037
329 Ga0501037_0011556 3300049573 Bacteria 6498
330 Ga0501037_0114915 3300049573 Bacteria 1937
331 Ga0501037_0185097 3300049573 Bacteria 1476
332 Ga0501037_0187054 3300049573 Bacteria 1467
333 Ga0501038_0003782 3300049574 Bacteria 14083
334 Ga0501038_0013272 3300049574 Bacteria 7513
335 Ga0501038_0039029 3300049574 Bacteria 4155
336 Ga0501038_0067000 3300049574 Bacteria 3055
337 Ga0501038_0149173 3300049574 Bacteria 1907
338 Ga0501038_0166515 3300049574 Bacteria 1787
339 Ga0501038_0237942 3300049574 Bacteria 1446
340 Ga0501039_0004274 3300049575 Bacteria 10763
341 Ga0501039_0011592 3300049575 Bacteria 6712
342 Ga0501039_0029235 3300049575 Bacteria 4244
343 Ga0501039_0037170 3300049575 Bacteria 3758
344 Ga0501039_0054497 3300049575 Bacteria 3095
345 Ga0501040_0012845 3300049576 Bacteria 5500
346 Ga0501040_0181521 3300049576 Bacteria 1492
347 Ga0501040_0222234 3300049576 Bacteria 1344
348 Ga0501040_0553769 3300049576 Bacteria 830
349 Ga0501041_0010672 3300049577 Bacteria 5419
350 Ga0501041_0139572 3300049577 Unclassified 1511
351 Ga0501041_0358219 3300049577 Bacteria 922
352 Ga0501041_0745761 3300049577 Bacteria 627
353 Ga0501042_0004409 3300049578 Bacteria 8978
354 Ga0501042_0194009 3300049578 Bacteria 1465
355 Ga0501042_0309124 3300049578 Bacteria 1142
356 Ga0501043_0001353 3300049579 Bacteria 21475
357 Ga0501043_0007529 3300049579 Bacteria 8641
358 Ga0501043_0009877 3300049579 Bacteria 7482
359 Ga0501043_0016812 3300049579 Bacteria 5733
360 Ga0501043_0059587 3300049579 Bacteria 2996
361 Ga0501043_0192947 3300049579 Bacteria 1584
362 Ga0501046_0001568 3300049580 Bacteria 21836
363 Ga0501046_0016815 3300049580 Bacteria 6116
364 Ga0501046_0029403 3300049580 Bacteria 4466
365 Ga0501046_0075351 3300049580 Bacteria 2616
366 Ga0501046_0077487 3300049580 Bacteria 2573
367 Ga0501046_0086550 3300049580 Unclassified 2416
368 Ga0501046_0094907 3300049580 Bacteria 2292
369 Ga0501046_0224542 3300049580 Bacteria 1389
370 Ga0501046_0233369 3300049580 Bacteria 1358
371 Ga0501047_0000683 3300049581 Bacteria 35386
372 Ga0501047_0005239 3300049581 Bacteria 12174
373 Ga0501047_0005505 3300049581 Bacteria 11916
374 Ga0501047_0203937 3300049581 Bacteria 1837
375 Ga0501047_0224348 3300049581 Bacteria 1734
376 Ga0501047_0310521 3300049581 Bacteria 1417
377 Ga0501047_0450746 3300049581 Bacteria 1116
378 Ga0501047_0467863 3300049581 Bacteria 1089
379 Ga0501048_0003910 3300049582 Bacteria 11316
380 Ga0501048_0010647 3300049582 Bacteria 6860
381 Ga0501048_0027308 3300049582 Bacteria 4150
382 Ga0501048_0054763 3300049582 Bacteria 2833
383 Ga0501048_0061424 3300049582 Bacteria 2661
384 Ga0501048_0147572 3300049582 Bacteria 1663
385 Ga0501067_0018019 3300049583 Bacteria 3910
386 Ga0501067_0035324 3300049583 Bacteria 2775
387 Ga0501067_0119241 3300049583 Bacteria 1467
388 Ga0501067_0119775 3300049583 Bacteria 1464
389 Ga0501067_0291618 3300049583 Bacteria 908
390 Ga0501068_0007457 3300049584 Bacteria 6060
391 Ga0501068_0032407 3300049584 Bacteria 3108
392 Ga0501068_0032433 3300049584 Bacteria 3107
393 Ga0501068_0179740 3300049584 Bacteria 1337
394 Ga0501068_0601927 3300049584 Bacteria 716
395 Ga0501069_0000864 3300049585 Bacteria 14389
396 Ga0501069_0004193 3300049585 Bacteria 7450
397 Ga0501069_0227797 3300049585 Bacteria 1084
398 Ga0501070_0051579 3300049586 Bacteria 3414
399 Ga0501070_0084252 3300049586 Bacteria 2632
400 Ga0501070_0166009 3300049586 Bacteria 1819
401 Ga0501070_0423846 3300049586 Bacteria 1074
402 Ga0501071_0006155 3300049587 Bacteria 7776
403 Ga0501071_0016609 3300049587 Bacteria 5064
404 Ga0501071_0405899 3300049587 Bacteria 1040
405 Ga0501071_0745626 3300049587 Bacteria 754
406 Ga0501072_0012375 3300049588 Bacteria 6521
407 Ga0501072_0013122 3300049588 Bacteria 6341
408 Ga0501072_0347934 3300049588 Bacteria 1177
409 Ga0501072_1064950 3300049588 Bacteria 630
410 Ga0501073_0003170 3300049589 Bacteria 12341
411 Ga0501073_0004841 3300049589 Bacteria 10106
412 Ga0501073_0004865 3300049589 Bacteria 10084
413 Ga0501073_0025150 3300049589 Bacteria 4272
414 Ga0501073_0033531 3300049589 Bacteria 3656
415 Ga0501073_0044909 3300049589 Bacteria 3113
416 Ga0501073_0354907 3300049589 Bacteria 1012
417 Ga0501073_0364836 3300049589 Bacteria 997
418 Ga0501074_0000197 3300049590 Bacteria 32785
419 Ga0501074_0009925 3300049590 Bacteria 6918
420 Ga0501074_0137574 3300049590 Bacteria 1747
421 Ga0501074_0239546 3300049590 Bacteria 1290
422 Ga0501074_0623049 3300049590 Unclassified 763
423 Ga0501075_0002785 3300049591 Bacteria 11705
424 Ga0501075_0040563 3300049591 Bacteria 3487
425 Ga0501075_0071251 3300049591 Bacteria 2627
426 Ga0501075_0097751 3300049591 Unclassified 2228
427 Ga0501075_0112214 3300049591 Bacteria 2073
428 Ga0501075_0298687 3300049591 Bacteria 1227
429 Ga0501076_0010093 3300049592 Bacteria 6991
430 Ga0501076_0101523 3300049592 Bacteria 2319
431 Ga0501076_0110790 3300049592 Bacteria 2219
432 Ga0501076_0167522 3300049592 Bacteria 1791
433 Ga0501076_0375713 3300049592 Bacteria 1168
434 Ga0501076_0629221 3300049592 Bacteria 885
435 Ga0501077_0058319 3300049593 Bacteria 2451
436 Ga0501077_0790773 3300049593 Bacteria 610
437 Ga0501079_0000786 3300049741 Bacteria 21668
438 Ga0501079_0004503 3300049741 Bacteria 10336
439 Ga0501079_0132129 3300049741 Bacteria 1942
440 Ga0501079_0638812 3300049741 Bacteria 838
441 Ga0501080_0003320 3300049742 Bacteria 14203
442 Ga0501080_0018631 3300049742 Bacteria 6424
443 Ga0501080_0019086 3300049742 Bacteria 6347
444 Ga0501080_0035865 3300049742 Bacteria 4629
445 Ga0501080_0377130 3300049742 Bacteria 1278
446 Ga0501080_0401803 3300049742 Bacteria 1232
447 Ga0501080_0499265 3300049742 Bacteria 1087
448 Ga0501081_0005266 3300049743 Bacteria 8336
449 Ga0501083_0004174 3300049744 Bacteria 10171
450 Ga0501083_0013636 3300049744 Bacteria 5683
451 Ga0501083_0068991 3300049744 Bacteria 2352
452 Ga0501083_0179721 3300049744 Bacteria 1382
453 Ga0501083_0202797 3300049744 Bacteria 1293
454 Ga0501035_0001894 3300049822 Bacteria 21036
455 Ga0501035_0002454 3300049822 Bacteria 18092
456 Ga0501035_0024859 3300049822 Bacteria 5492
457 Ga0501035_0158748 3300049822 Bacteria 1958
458 Ga0501035_0322982 3300049822 Bacteria 1296
459 Ga0501044_0001407 3300049823 Bacteria 28211
460 Ga0501044_0008686 3300049823 Bacteria 11119
461 Ga0501044_0120220 3300049823 Bacteria 2628
462 Ga0501044_0193905 3300049823 Bacteria 1992
463 Ga0501044_0228028 3300049823 Bacteria 1811
464 Ga0501045_0003372 3300049824 Bacteria 10932
465 Ga0501045_0015683 3300049824 Bacteria 5375
466 Ga0501045_0036608 3300049824 Bacteria 3564
467 Ga0501045_0075015 3300049824 Bacteria 2491
468 Ga0501045_0171025 3300049824 Bacteria 1618
469 Ga0501045_0798992 3300049824 Bacteria 695
470 nmdc:mga05p37_1194901_c1 3300050507 Unclassified 786
471 nmdc:mga05p37_28099_c1 3300050507 Bacteria 6855
472 nmdc:mga05p37_33636_c1 3300050507 Bacteria 6279
473 nmdc:mga05p37_37_c1 3300050507 Bacteria 110157
474 nmdc:mga05p37_408491_c1 3300050507 Unclassified 1583
475 nmdc:mga05p37_59771_c1 3300050507 Unclassified 4189
476 nmdc:mga09592_180189_c1 3300050508 Bacteria 1828
477 nmdc:mga09592_346581_c1 3300050508 Bacteria 1286
478 nmdc:mga09592_41882_c1 3300050508 Bacteria 3852
479 nmdc:mga09592_56968_c1 3300050508 Bacteria 3302
480 nmdc:mga0qj67_138134_c1 3300050509 Bacteria 1975
481 nmdc:mga0qj67_190763_c1 3300050509 Bacteria 1665
482 nmdc:mga06r32_1276102_c1 3300050510 Bacteria 679
483 nmdc:mga06r32_332993_c1 3300050510 Bacteria 1503
484 nmdc:mga08y16_12647_c1 3300050511 Bacteria 8879
485 nmdc:mga08y16_127135_c1 3300050511 Bacteria 2651
486 nmdc:mga08y16_142279_c1 3300050511 Bacteria 2494
487 nmdc:mga08y16_1431_c1 3300050511 Bacteria 23934
488 nmdc:mga08y16_151980_c1 3300050511 Bacteria 2406
489 nmdc:mga08y16_221602_c1 3300050511 Bacteria 1958
490 nmdc:mga08y16_384351_c1 3300050511 Bacteria 1439
491 nmdc:mga08y16_428964_c1 3300050511 Bacteria 1350
492 nmdc:mga08y16_67553_c1 3300050511 Bacteria 3728
493 nmdc:mga08y16_78252_c1 3300050511 Bacteria 2103
494 nmdc:mga0n895_11067_c1 3300050512 Bacteria 8024
495 nmdc:mga0n895_1630197_c1 3300050512 Bacteria 609
496 nmdc:mga0n895_24828_c1 3300050512 Bacteria 5654
497 nmdc:mga0n895_911719_c1 3300050512 Bacteria 864
498 nmdc:mga0rr50_270055_c1 3300050513 Bacteria 1417
499 nmdc:mga0a205_326149_c1 3300050515 Bacteria 1406
500 nmdc:mga0a205_41527_c1 3300050515 Bacteria 4429
501 nmdc:mga0a205_905729_c1 3300050515 Bacteria 729
502 Ga0495601_0076732 3300053077 Bacteria 2140
503 Ga0495595_0366728 3300053084 Bacteria 728
504 Ga0495619_0712631 3300053085 Bacteria 682
505 Ga0501084_0003286 3300054114 Bacteria 13087
506 Ga0501084_0004916 3300054114 Bacteria 10921
507 Ga0501084_0006673 3300054114 Bacteria 9490
508 Ga0501084_0016834 3300054114 Bacteria 6074
509 Ga0501084_0374410 3300054114 Bacteria 1203
510 Ga0501084_0592050 3300054114 Bacteria 937
511 Ga0501082_0003801 3300060353 Bacteria 13202
512 Ga0501082_0006436 3300060353 Bacteria 10189
513 Ga0501082_0011268 3300060353 Bacteria 7686
514 Ga0501082_0052348 3300060353 Bacteria 3519
515 Ga0501082_0095173 3300060353 Bacteria 2573
516 Ga0501082_0104069 3300060353 Bacteria 2456
517 Ga0501082_0169395 3300060353 Bacteria 1898
518 Ga0501082_0262842 3300060353 Bacteria 1501
519 Ga0530510_0008079 3300061734 Bacteria 7338
520 Ga0530510_0543530 3300061734 Bacteria 882
521 Ga0373934_0001306
522 JGI24742J22300_10072337
523 JGI25406J46586_10000491
524 JGI25406J46586_10003383
525 Ga0065714_10109336
526 Ga0065704_10110482
527 Ga0065712_10002431
528 Ga0065712_10086475
529 Ga0065712_10422076
530 Ga0065715_10131923
531 Ga0065715_10166413
532 Ga0065715_10230196
533 Ga0065715_10377712
534 Ga0065707_10017477
535 Ga0065707_10093714
536 Ga0065707_10131741
537 Ga0070676_10236680
538 Ga0070690_100051338
539 Ga0070670_100017979
540 Ga0070677_10003940
541 Ga0068869_100383299
542 Ga0070666_10042221
543 Ga0068868_100730461
544 Ga0070689_100029481
545 Ga0070689_100513436
546 Ga0070689_100802929
547 Ga0070687_100110159
548 Ga0070687_100442370
549 Ga0070692_10456152
550 Ga0070668_100004968
551 Ga0070668_100312773
552 Ga0070669_100004537
553 Ga0070669_100152028
554 Ga0070669_100762932
555 Ga0070675_100099004
556 Ga0070675_100163378
557 Ga0070675_100353791
558 Ga0070675_100483504
559 Ga0070673_100014477
560 Ga0070673_100299859
561 Ga0070673_100947143
562 Ga0070673_101097631
563 Ga0070688_100110059
564 Ga0070688_100283254
565 Ga0070688_100336557
566 Ga0070667_100020205
567 Ga0070701_10275301
568 Ga0070700_100014032
569 Ga0070700_100161529
570 Ga0070708_100306765
571 Ga0070678_100540554
572 Ga0070662_100037566
573 Ga0068867_100010452
574 Ga0068867_100419479
575 Ga0068867_100700076
576 Ga0070685_10165109
577 Ga0070685_10192448
578 Ga0070707_100191039
579 Ga0070698_100002805
580 Ga0070698_100159043
581 Ga0070698_100254066
582 Ga0070699_100003987
583 Ga0070699_100195674
584 Ga0070672_100031936
585 Ga0070672_100037878
586 Ga0070672_100162518
587 Ga0070686_100140580
588 Ga0070686_100909099
589 Ga0070695_101183822
590 Ga0070696_100246737
591 Ga0070665_100065728
592 Ga0070704_100064505
593 Ga0070704_100911998
594 Ga0068857_100328217
595 Ga0070702_100106708
596 Ga0070702_100197108
597 Ga0068852_100407796
598 Ga0068859_100025178
599 Ga0068859_100104077
600 Ga0068864_100034502
601 Ga0068866_10500975
602 Ga0068861_100077217
603 Ga0068861_100152278
604 Ga0068861_100379867
605 Ga0068870_10003781
606 Ga0068863_100275682
607 Ga0068858_100073975
608 Ga0068858_100083688
609 Ga0068858_100563095
610 Ga0068860_100040744
611 Ga0068860_101612261
612 Ga0068862_100009631
613 Ga0068862_100381317
614 Ga0068862_100874235
615 Ga0068862_101091391
616 Ga0081538_10047963
617 Ga0081539_10000093
618 Ga0081539_10001136
619 Ga0081539_10012179
620 Ga0081539_10066481
621 Ga0070712_100257471
622 Ga0068871_100070149
623 Ga0075428_100083744
624 Ga0075428_100267164
625 Ga0075428_100656141
626 Ga0075428_100923846
627 Ga0075430_100227552
628 Ga0075430_100330344
629 Ga0075430_100997052
630 Ga0075431_100128363
631 Ga0075433_10002779
632 Ga0075433_10815626
633 Ga0075434_100014738
634 Ga0075434_100070493
635 Ga0075434_100703174
636 Ga0075429_100042637
637 Ga0075429_100125563
638 Ga0075429_100172844
639 Ga0075429_100322208
640 Ga0075429_100613523
641 Ga0068865_100174639
642 Ga0097620_100025178
643 Ga0097620_100104068
644 Ga0075435_100283164
645 Ga0111539_10000126
646 Ga0111539_10004218
647 Ga0111539_10037923
648 Ga0111539_10041823
649 Ga0111539_10047336
650 Ga0111539_10116185
651 Ga0111539_10157260
652 Ga0111539_10174817
653 Ga0111539_10220856
654 Ga0111539_10386123
655 Ga0111539_10523556
656 Ga0111539_11396956
657 Ga0105245_10353912
658 Ga0105247_10212226
659 Ga0114129_10000113
660 Ga0114129_10009011
661 Ga0114129_10036699
662 Ga0114129_10039490
663 Ga0114129_10651585
664 Ga0114129_10925390
665 Ga0105242_10232106
666 Ga0105242_10299448
667 Ga0105248_10061265
668 Ga0105249_10055901
669 Ga0105249_10147802
670 Ga0105249_10578642
671 Ga0105249_10876780
672 Ga0105246_10194553
673 Ga0157371_10894196
674 Ga0157378_10579419
675 Ga0163162_10032776
676 Ga0163162_10033720
677 Ga0157375_10709719
678 Ga0157375_11317344
679 Ga0163163_10000047
680 Ga0163163_10002902
681 Ga0163163_10301540
682 Ga0163163_10385081
683 Ga0157380_10061941
684 Ga0157380_10077373
685 Ga0157380_10182034
686 Ga0157380_10207554
687 Ga0157380_10253881
688 Ga0157380_10413432
689 Ga0157380_10507095
690 Ga0157380_10531243
691 Ga0157377_10142369
692 Ga0157379_10066688
693 Ga0163161_10041169
694 Ga0207697_10068710
695 Ga0207688_10453028
696 Ga0207680_10070771
697 Ga0207643_10003442
698 Ga0207643_10105254
699 Ga0207684_10561780
700 Ga0207662_10144836
701 Ga0207646_10288555
702 Ga0207681_10022294
703 Ga0207681_10169006
704 Ga0207650_10007401
705 Ga0207650_10221067
706 Ga0207650_10335641
707 Ga0207659_10011028
708 Ga0207659_10011848
709 Ga0207659_10024579
710 Ga0207659_10188093
711 Ga0207659_10415455
712 Ga0207644_10392411
713 Ga0207706_10260509
714 Ga0207670_10020926
715 Ga0207670_10245657
716 Ga0207670_10482434
717 Ga0207670_10756008
718 Ga0207704_10214249
719 Ga0207691_10047085
720 Ga0207689_10387383
721 Ga0207679_10977894
722 Ga0207651_10010376
723 Ga0207651_10181608
724 Ga0207651_10840825
725 Ga0207712_10002016
726 Ga0207712_10087838
727 Ga0207712_10283294
728 Ga0207712_10753107
729 Ga0207712_10777261
730 Ga0207668_10112122
731 Ga0207668_10146801
732 Ga0207677_10190777
733 Ga0207703_10205645
734 Ga0207703_10665862
735 Ga0207678_10065237
736 Ga0207708_10090319
737 Ga0207641_10519421
738 Ga0207648_10452266
739 Ga0207648_10674414
740 Ga0207676_10019635
741 Ga0207674_10106248
742 Ga0207675_100132307
743 Ga0207675_100226621
744 Ga0207675_100410627
745 Ga0207683_10275978
746 Ga0207698_10466916
747 Ga0209968_1034482
748 Ga0209999_1038830
749 Ga0209970_1054624
750 Ga0209966_1062523
751 Ga0209998_10042221
752 Ga0209974_10073922
753 Ga0207428_10001071
754 Ga0207428_10001447
755 Ga0207428_10105645
756 Ga0207428_10119616
757 Ga0207428_10230484
758 Ga0207428_10328112
759 Ga0207428_10425844
760 Ga0268265_10162288
761 Ga0268265_10406487
762 Ga0268264_10704920
763 Ga0307405_10070497
764 Ga0307413_10298606
765 Ga0307413_10828782
766 Ga0307410_10018463
767 Ga0307406_10033965
768 Ga0307407_10044990
769 Ga0307407_11086440
770 Ga0307412_10095564
771 Ga0307409_100002287
772 Ga0307409_100165521
773 Ga0307416_100007674
774 Ga0307414_10196693
775 Ga0307414_10360134
776 Ga0307411_10009810
777 Ga0307411_10025739
778 Ga0307415_100014449
779 Ga0307415_100210480
780 Ga0307415_101581240
781 Ga0373951_0089131
782 Ga0373939_0133962
783 Ga0373941_0050068
784 Ga0373956_0002925
785 Ga0373956_0245592
786 Ga0373957_0005735
787 Ga0373946_0072293
788 Ga0373955_0003346
789 Ga0373942_0026287
790 Ga0373933_0003860
791 Ga0373937_0000267
792 Ga0373925_1550903
793 Ga0439461_0042627
794 Ga0439441_151123
795 Ga0450896_016284
796 Ga0439446_0068819
797 Ga0439434_0120605
798 Ga0451576_0016692
799 Ga0451576_0063304
800 Ga0466967_1224721
801 Ga0495592_0147744
802 Ga0495592_0459548
803 Ga0495629_0011113
804 Ga0495580_0194994
805 Ga0495582_0485600
806 Ga0495596_0282588
807 Ga0495665_0273267
808 Ga0495640_0503621
809 Ga0495598_0010744
810 Ga0495598_0067308
811 Ga0495621_0005756
812 Ga0495656_0615113
813 Ga0495599_0116572
814 Ga0495658_0105345
815 Ga0495613_0517583
816 Ga0495600_0084523
817 Ga0495676_0021144
818 Ga0495675_0380327
819 Ga0496109_0348185
820 Ga0496114_0122053
821 Ga0496114_0166528
822 Ga0501031_0006365
823 Ga0501031_0023290
824 Ga0501031_0026104
825 Ga0501031_0109787
826 Ga0501032_0002733
827 Ga0501032_0008738
828 Ga0501032_0028355
829 Ga0501032_0093367
830 Ga0501033_0002191
831 Ga0501033_0008397
832 Ga0501033_0008748
833 Ga0501033_0010716
834 Ga0501034_0002358
835 Ga0501034_0070418
836 Ga0501034_0073511
837 Ga0501034_0146031
838 Ga0501034_0146939
839 Ga0501034_0166398
840 Ga0501034_0461822
841 Ga0501034_0507874
842 Ga0501036_0004417
843 Ga0501036_0006425
844 Ga0501036_0048559
845 Ga0501036_0068482
846 Ga0501036_0136993
847 Ga0501036_0151967
848 Ga0501037_0001691
849 Ga0501037_0011556
850 Ga0501037_0114915
851 Ga0501037_0185097
852 Ga0501037_0187054
853 Ga0501038_0003782
854 Ga0501038_0013272
855 Ga0501038_0039029
856 Ga0501038_0067000
857 Ga0501038_0149173
858 Ga0501038_0166515
859 Ga0501038_0237942
860 Ga0501039_0004274
861 Ga0501039_0011592
862 Ga0501039_0029235
863 Ga0501039_0037170
864 Ga0501039_0054497
865 Ga0501040_0012845
866 Ga0501040_0181521
867 Ga0501040_0222234
868 Ga0501040_0553769
869 Ga0501041_0010672
870 Ga0501041_0139572
871 Ga0501041_0358219
872 Ga0501041_0745761
873 Ga0501042_0004409
874 Ga0501042_0194009
875 Ga0501042_0309124
876 Ga0501043_0001353
877 Ga0501043_0007529
878 Ga0501043_0009877
879 Ga0501043_0016812
880 Ga0501043_0059587
881 Ga0501043_0192947
882 Ga0501046_0001568
883 Ga0501046_0016815
884 Ga0501046_0029403
885 Ga0501046_0075351
886 Ga0501046_0077487
887 Ga0501046_0086550
888 Ga0501046_0094907
889 Ga0501046_0224542
890 Ga0501046_0233369
891 Ga0501047_0000683
892 Ga0501047_0005239
893 Ga0501047_0005505
894 Ga0501047_0203937
895 Ga0501047_0224348
896 Ga0501047_0310521
897 Ga0501047_0450746
898 Ga0501047_0467863
899 Ga0501048_0003910
900 Ga0501048_0010647
901 Ga0501048_0027308
902 Ga0501048_0054763
903 Ga0501048_0061424
904 Ga0501048_0147572
905 Ga0501067_0018019
906 Ga0501067_0035324
907 Ga0501067_0119241
908 Ga0501067_0119775
909 Ga0501067_0291618
910 Ga0501068_0007457
911 Ga0501068_0032407
912 Ga0501068_0032433
913 Ga0501068_0179740
914 Ga0501068_0601927
915 Ga0501069_0000864
916 Ga0501069_0004193
917 Ga0501069_0227797
918 Ga0501070_0051579
919 Ga0501070_0084252
920 Ga0501070_0166009
921 Ga0501070_0423846
922 Ga0501071_0006155
923 Ga0501071_0016609
924 Ga0501071_0405899
925 Ga0501071_0745626
926 Ga0501072_0012375
927 Ga0501072_0013122
928 Ga0501072_0347934
929 Ga0501072_1064950
930 Ga0501073_0003170
931 Ga0501073_0004841
932 Ga0501073_0004865
933 Ga0501073_0025150
934 Ga0501073_0033531
935 Ga0501073_0044909
936 Ga0501073_0354907
937 Ga0501073_0364836
938 Ga0501074_0000197
939 Ga0501074_0009925
940 Ga0501074_0137574
941 Ga0501074_0239546
942 Ga0501074_0623049
943 Ga0501075_0002785
944 Ga0501075_0040563
945 Ga0501075_0071251
946 Ga0501075_0097751
947 Ga0501075_0112214
948 Ga0501075_0298687
949 Ga0501076_0010093
950 Ga0501076_0101523
951 Ga0501076_0110790
952 Ga0501076_0167522
953 Ga0501076_0375713
954 Ga0501076_0629221
955 Ga0501077_0058319
956 Ga0501077_0790773
957 Ga0501079_0000786
958 Ga0501079_0004503
959 Ga0501079_0132129
960 Ga0501079_0638812
961 Ga0501080_0003320
962 Ga0501080_0018631
963 Ga0501080_0019086
964 Ga0501080_0035865
965 Ga0501080_0377130
966 Ga0501080_0401803
967 Ga0501080_0499265
968 Ga0501081_0005266
969 Ga0501083_0004174
970 Ga0501083_0013636
971 Ga0501083_0068991
972 Ga0501083_0179721
973 Ga0501083_0202797
974 Ga0501035_0001894
975 Ga0501035_0002454
976 Ga0501035_0024859
977 Ga0501035_0158748
978 Ga0501035_0322982
979 Ga0501044_0001407
980 Ga0501044_0008686
981 Ga0501044_0120220
982 Ga0501044_0193905
983 Ga0501044_0228028
984 Ga0501045_0003372
985 Ga0501045_0015683
986 Ga0501045_0036608
987 Ga0501045_0075015
988 Ga0501045_0171025
989 Ga0501045_0798992
990 nmdc:mga05p37_1194901_c1
991 nmdc:mga05p37_28099_c1
992 nmdc:mga05p37_33636_c1
993 nmdc:mga05p37_37_c1
994 nmdc:mga05p37_408491_c1
995 nmdc:mga05p37_59771_c1
996 nmdc:mga09592_180189_c1
997 nmdc:mga09592_346581_c1
998 nmdc:mga09592_41882_c1
999 nmdc:mga09592_56968_c1
1000 nmdc:mga0qj67_138134_c1
1001 nmdc:mga0qj67_190763_c1
1002 nmdc:mga06r32_1276102_c1
1003 nmdc:mga06r32_332993_c1
1004 nmdc:mga08y16_12647_c1
1005 nmdc:mga08y16_127135_c1
1006 nmdc:mga08y16_142279_c1
1007 nmdc:mga08y16_1431_c1
1008 nmdc:mga08y16_151980_c1
1009 nmdc:mga08y16_221602_c1
1010 nmdc:mga08y16_384351_c1
1011 nmdc:mga08y16_428964_c1
1012 nmdc:mga08y16_67553_c1
1013 nmdc:mga08y16_78252_c1
1014 nmdc:mga0n895_11067_c1
1015 nmdc:mga0n895_1630197_c1
1016 nmdc:mga0n895_24828_c1
1017 nmdc:mga0n895_911719_c1
1018 nmdc:mga0rr50_270055_c1
1019 nmdc:mga0a205_326149_c1
1020 nmdc:mga0a205_41527_c1
1021 nmdc:mga0a205_905729_c1
1022 Ga0495601_0076732
1023 Ga0495595_0366728
1024 Ga0495619_0712631
1025 Ga0501084_0003286
1026 Ga0501084_0004916
1027 Ga0501084_0006673
1028 Ga0501084_0016834
1029 Ga0501084_0374410
1030 Ga0501084_0592050
1031 Ga0501082_0003801
1032 Ga0501082_0006436
1033 Ga0501082_0011268
1034 Ga0501082_0052348
1035 Ga0501082_0095173
1036 Ga0501082_0104069
1037 Ga0501082_0169395
1038 Ga0501082_0262842
1039 Ga0530510_0008079
1040 Ga0530510_0543530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

3

166

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.95 10 157
5cx0-assembly1.cif.gz_A-2 structure of xoo1075, a peptide deformylase from xanthomonas oryzae pv. oryzae, in complex with fragment 322 0.9452 10 157
6jf3-assembly1.cif.gz_B actinonin bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9441 10 156
6jf3-assembly1.cif.gz_A actinonin bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9414 10 156
6il2-assembly1.cif.gz_A k4u complex structure of peptide deformylase from xanthomonas oryzae pv. oryzae 0.938 9 157
ID Description Score Start End Superfamily
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9494 10 157 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9275 10 150 3.90.45.10
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9113 9 164 3.90.45.10
af_Q54JC1_8_221_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9103 10 157 3.90.45.10
3g5pA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.909 10 162 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A355FYB2-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9651 10 160 GO:0006412
GO:0042586
GO:0046872
AF-A0A7C4Z3N0-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9621 13 161 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A0G1Q7H1-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9604 10 163 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A0G1G2Y1-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9598 10 160 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A1V5XV45-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9591 10 160 GO:0006412
GO:0042586
GO:0046872

Map