F458534

General Info

Members Datasets Scaffolds Average Seq Length
520 338 508 278

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10034644|Ga0105248_100346446
Length 312
Sequence LNEAGATFQPNRASAAACHVAKHITAASWMIKYRMSDEYQPLVTGPAERNEPALWFAFHRGELLIARVDDEASLPHCHDLADLGLNSVRNLYLGTYAGKHCYVSELEHADELPHGHEMHGLRAVFGLVDETLAALAGRAFQIIEWDRNHQYCSRCGTATVPRSEERARACPKCRFTIYPPVSPAIMILIKRGREVLLGRKKEWAPGRYSALAGFVEPGETLEQTVRRETREEVGVEVDNIRYFGSQPWPFPHSLMIAFTADYAGGDVRPDGIEIEEARFFDAEQLPHLPPSISISRRLIVSVCGKLSRGEAV

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2738541297 Duganella sp. GV083 Isolate Unclassified
3 2738541357 Duganella sp. GV053 Isolate Unclassified
4 2738543003 Duganella sp. GV066 Isolate Unclassified
5 2738543026 Duganella sp. GV089 Isolate Unclassified
6 2738543029 Duganella sp. GV039 Isolate Unclassified
7 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
8 2857553236 Duganella sp. R-74557 Isolate Unclassified
9 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
10 2919476304 Duganella sp. 3397 Isolate Unclassified
11 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
12 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
177 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
189 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
190 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
205 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
224 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
232 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
247 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
248 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
251 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
254 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
257 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
258 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
259 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
263 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
269 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
276 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
282 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
283 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
284 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
285 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
307 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
319 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
325 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0.19
Rhizoplane 3.27
Rhizosphere 89.04
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000292 3300002987 Bacteria 23475
2 rootL2_10025805 3300003322 Bacteria 9341
3 rootL2_10076289 3300003322 Bacteria 9441
4 Ga0055529_1000274 3300003763 Bacteria 61422
5 Ga0055526_1000076 3300003771 Bacteria 92438
6 Ga0055543_1005921 3300004625 Bacteria 3043
7 Ga0065165_1000167 3300005262 Bacteria 115630
8 Ga0070658_10083012 3300005327 Bacteria 2633
9 Ga0070676_10089642 3300005328 Bacteria 1881
10 Ga0070683_100001621 3300005329 Bacteria 17400
11 Ga0070690_100004185 3300005330 Bacteria 7987
12 Ga0070690_100337585 3300005330 Bacteria 1090
13 Ga0070670_100039804 3300005331 Bacteria 4042
14 Ga0070670_100104226 3300005331 Bacteria 2443
15 Ga0070677_10009192 3300005333 Bacteria 3349
16 Ga0068869_100161704 3300005334 Bacteria 1743
17 Ga0068869_100256068 3300005334 Bacteria 1400
18 Ga0070666_10312291 3300005335 Bacteria 1120
19 Ga0070680_100028049 3300005336 Bacteria 4514
20 Ga0070680_100107457 3300005336 Bacteria 2321
21 Ga0068868_100000336 3300005338 Bacteria 31703
22 Ga0068868_100021111 3300005338 Bacteria 4903
23 Ga0070660_100020748 3300005339 Bacteria 4835
24 Ga0070660_100108327 3300005339 Bacteria 2208
25 Ga0070689_100003440 3300005340 Bacteria 10534
26 Ga0070689_100091797 3300005340 Bacteria 2394
27 Ga0070661_100001915 3300005344 Bacteria 14406
28 Ga0070661_100012702 3300005344 Bacteria 5893
29 Ga0070661_100257078 3300005344 Bacteria 1349
30 Ga0070692_10042264 3300005345 Bacteria 2340
31 Ga0070692_10189174 3300005345 Bacteria 1198
32 Ga0070669_100088704 3300005353 Bacteria 2315
33 Ga0070675_100000564 3300005354 Bacteria 25558
34 Ga0070675_100167645 3300005354 Bacteria 1892
35 Ga0070675_100475550 3300005354 Bacteria 1123
36 Ga0070671_100003077 3300005355 Bacteria 12974
37 Ga0070671_100018740 3300005355 Bacteria 5625
38 Ga0070674_100024796 3300005356 Bacteria 3896
39 Ga0070674_100041651 3300005356 Bacteria 3114
40 Ga0070674_100101034 3300005356 Bacteria 2101
41 Ga0070673_100000875 3300005364 Bacteria 16956
42 Ga0070673_100006346 3300005364 Bacteria 7682
43 Ga0070688_100001476 3300005365 Bacteria 11687
44 Ga0070667_100074487 3300005367 Bacteria 2896
45 Ga0070667_100084604 3300005367 Bacteria 2719
46 Ga0070667_100305329 3300005367 Bacteria 1433
47 Ga0070713_100010713 3300005436 Bacteria 6637
48 Ga0070710_10030424 3300005437 Bacteria 2905
49 Ga0070710_10224907 3300005437 Bacteria 1196
50 Ga0070711_100005372 3300005439 Bacteria 7662
51 Ga0070711_100044700 3300005439 Bacteria 3007
52 Ga0070705_100037941 3300005440 Bacteria 2721
53 Ga0070700_100052290 3300005441 Bacteria 2546
54 Ga0070694_100316440 3300005444 Bacteria 1200
55 Ga0070708_100106539 3300005445 Bacteria 2573
56 Ga0070708_100169654 3300005445 Bacteria 2037
57 Ga0070678_100012547 3300005456 Bacteria 5275
58 Ga0070678_100085385 3300005456 Bacteria 2405
59 Ga0070662_100014505 3300005457 Bacteria 5268
60 Ga0070662_100044909 3300005457 Bacteria 3168
61 Ga0070662_100062130 3300005457 Bacteria 2728
62 Ga0070681_10001301 3300005458 Bacteria 21770
63 Ga0070681_10013173 3300005458 Bacteria 8215
64 Ga0070681_10271553 3300005458 Bacteria 1607
65 Ga0068867_100212065 3300005459 Bacteria 1556
66 Ga0068867_100532730 3300005459 Bacteria 1014
67 Ga0070685_10002559 3300005466 Bacteria 9310
68 Ga0070685_10012889 3300005466 Bacteria 4400
69 Ga0070706_100022137 3300005467 Bacteria 5852
70 Ga0070706_100073147 3300005467 Bacteria 3172
71 Ga0070706_100318241 3300005467 Bacteria 1451
72 Ga0070707_100012605 3300005468 Bacteria 7896
73 Ga0070679_100038960 3300005530 Bacteria 4725
74 Ga0070684_100011627 3300005535 Bacteria 7015
75 Ga0070697_100029924 3300005536 Bacteria 4372
76 Ga0068853_100015122 3300005539 Bacteria 6345
77 Ga0070672_100085290 3300005543 Bacteria 2538
78 Ga0070672_100245026 3300005543 Bacteria 1508
79 Ga0070686_100173031 3300005544 Bacteria 1529
80 Ga0070693_100054312 3300005547 Bacteria 2303
81 Ga0070693_100096228 3300005547 Bacteria 1794
82 Ga0070665_100016607 3300005548 Bacteria 7378
83 Ga0070665_100083752 3300005548 Bacteria 3194
84 Ga0070665_100123897 3300005548 Bacteria 2586
85 Ga0070704_100023891 3300005549 Bacteria 4002
86 Ga0070704_100027628 3300005549 Bacteria 3766
87 Ga0068855_100031145 3300005563 Bacteria 6371
88 Ga0068855_100410031 3300005563 Bacteria 1484
89 Ga0068855_100481382 3300005563 Bacteria 1351
90 Ga0070664_100003688 3300005564 Bacteria 12350
91 Ga0070664_100274558 3300005564 Unclassified 1519
92 Ga0068854_100009287 3300005578 Bacteria 6346
93 Ga0068854_100128376 3300005578 Bacteria 1933
94 Ga0068856_100422171 3300005614 Bacteria 1353
95 Ga0070702_100024968 3300005615 Bacteria 3196
96 Ga0070702_100126987 3300005615 Bacteria 1605
97 Ga0068852_100000411 3300005616 Bacteria 28617
98 Ga0068852_100050265 3300005616 Bacteria 3571
99 Ga0068852_100113163 3300005616 Bacteria 2471
100 Ga0068852_100406739 3300005616 Bacteria 1340
101 Ga0068859_100005320 3300005617 Bacteria 13086
102 Ga0068864_100009675 3300005618 Bacteria 7953
103 Ga0068864_100025682 3300005618 Bacteria 4963
104 Ga0068866_10003879 3300005718 Bacteria 6134
105 Ga0068866_10006338 3300005718 Bacteria 4922
106 Ga0068861_100028641 3300005719 Bacteria 4065
107 Ga0068851_10011794 3300005834 Bacteria 4106
108 Ga0068870_10030072 3300005840 Bacteria 2743
109 Ga0068863_100012501 3300005841 Bacteria 8193
110 Ga0068863_100108615 3300005841 Bacteria 2640
111 Ga0068858_100007450 3300005842 Bacteria 10579
112 Ga0068858_100182222 3300005842 Bacteria 1983
113 Ga0068858_100272909 3300005842 Bacteria 1609
114 Ga0068860_100142352 3300005843 Bacteria 2305
115 Ga0068860_100341454 3300005843 Bacteria 1472
116 Ga0068862_100020456 3300005844 Bacteria 5529
117 Ga0070717_10012658 3300006028 Bacteria 6438
118 Ga0070715_10008238 3300006163 Bacteria 3625
119 Ga0070712_100042826 3300006175 Bacteria 3114
120 Ga0075362_10089949 3300006177 Bacteria 1424
121 Ga0075366_10002856 3300006195 Bacteria 8951
122 Ga0097621_100000527 3300006237 Bacteria 26821
123 Ga0097621_100293778 3300006237 Bacteria 1433
124 Ga0068871_100000363 3300006358 Bacteria 31624
125 Ga0068871_100301128 3300006358 Bacteria 1407
126 Ga0075428_100003410 3300006844 Bacteria 17382
127 Ga0075430_100159084 3300006846 Bacteria 1881
128 Ga0075434_100347527 3300006871 Bacteria 1504
129 Ga0075429_100003762 3300006880 Bacteria 12935
130 Ga0068865_100441169 3300006881 Bacteria 1074
131 Ga0097620_100005321 3300006931 Bacteria 13086
132 Ga0075435_100044922 3300007076 Bacteria 3540
133 Ga0105240_10005056 3300009093 Bacteria 19777
134 Ga0105240_10673322 3300009093 Bacteria 1132
135 Ga0111539_10004728 3300009094 Bacteria 17792
136 Ga0111539_10229405 3300009094 Bacteria 2162
137 Ga0111539_10350038 3300009094 Bacteria 1719
138 Ga0111539_10733169 3300009094 Bacteria 1150
139 Ga0111539_10872624 3300009094 Bacteria 1047
140 Ga0105245_10010977 3300009098 Bacteria 7883
141 Ga0105245_10028483 3300009098 Bacteria 4928
142 Ga0105245_10338416 3300009098 Bacteria 1487
143 Ga0114129_10276391 3300009147 Bacteria 2245
144 Ga0105243_10043528 3300009148 Bacteria 3519
145 Ga0105243_10067884 3300009148 Bacteria 2872
146 Ga0105242_10000761 3300009176 Bacteria 25021
147 Ga0105242_10235976 3300009176 Bacteria 1641
148 Ga0105248_10034644 3300009177 Bacteria 5648
149 Ga0105248_10096402 3300009177 Bacteria 3332
150 Ga0105248_10215493 3300009177 Bacteria 2163
151 Ga0105248_10331638 3300009177 Bacteria 1713
152 Ga0105237_10000784 3300009545 Bacteria 43457
153 Ga0105237_10364003 3300009545 Bacteria 1450
154 Ga0105239_10001759 3300010375 Bacteria 28533
155 Ga0157373_10132673 3300013100 Bacteria 1751
156 Ga0157370_10021795 3300013104 Bacteria 6382
157 Ga0157369_10158841 3300013105 Bacteria 2387
158 Ga0157374_10001418 3300013296 Bacteria 20316
159 Ga0157374_10004313 3300013296 Bacteria 11963
160 Ga0157374_10059270 3300013296 Bacteria 3579
161 Ga0157378_10002277 3300013297 Bacteria 17044
162 Ga0157378_10027667 3300013297 Bacteria 5001
163 Ga0157378_10139239 3300013297 Bacteria 2252
164 Ga0157378_10543121 3300013297 Bacteria 1166
165 Ga0163162_10036018 3300013306 Bacteria 4930
166 Ga0163162_10036062 3300013306 Bacteria 4928
167 Ga0163162_10118801 3300013306 Bacteria 2746
168 Ga0157372_10049918 3300013307 Bacteria 4654
169 Ga0157372_10273770 3300013307 Bacteria 1962
170 Ga0157375_10080856 3300013308 Bacteria 3288
171 Ga0157375_10082886 3300013308 Bacteria 3250
172 Ga0163163_10004197 3300014325 Bacteria 12275
173 Ga0163163_10421357 3300014325 Bacteria 1394
174 Ga0157380_10097868 3300014326 Bacteria 2436
175 Ga0157380_10288881 3300014326 Bacteria 1505
176 Ga0182008_10002644 3300014497 Bacteria 11121
177 Ga0157377_10012518 3300014745 Bacteria 4269
178 Ga0157379_10035731 3300014968 Bacteria 4430
179 Ga0157379_10049300 3300014968 Bacteria 3759
180 Ga0157376_10059009 3300014969 Bacteria 3217
181 Ga0157376_10069103 3300014969 Bacteria 2993
182 Ga0182006_1000095 3300015261 Bacteria 105469
183 Ga0182007_10000063 3300015262 Bacteria 87093
184 Ga0182005_1000057 3300015265 Bacteria 104753
185 Ga0182005_1000119 3300015265 Bacteria 57192
186 Ga0163161_10025124 3300017792 Bacteria 4214
187 Ga0163161_10030211 3300017792 Bacteria 3854
188 Ga0163161_10055751 3300017792 Bacteria 2869
189 Ga0163161_10163575 3300017792 Bacteria 1698
190 Ga0213872_10000136 3300021361 Bacteria 66682
191 Ga0213872_10001253 3300021361 Bacteria 17099
192 Ga0209437_106638 3300025233 Bacteria 1918
193 Ga0209026_1007384 3300025250 Bacteria 2488
194 Ga0209455_1000253 3300025272 Bacteria 62650
195 Ga0209130_1000016 3300025284 Bacteria 395540
196 Ga0209564_1000042 3300025295 Bacteria 392805
197 Ga0207697_10006613 3300025315 Bacteria 5229
198 Ga0207656_10018386 3300025321 Bacteria 2752
199 Ga0207682_10005908 3300025893 Bacteria 4956
200 Ga0207642_10016912 3300025899 Bacteria 2761
201 Ga0207642_10120109 3300025899 Bacteria 1354
202 Ga0207688_10096438 3300025901 Bacteria 1703
203 Ga0207680_10004468 3300025903 Bacteria 6636
204 Ga0207685_10011454 3300025905 Bacteria 2666
205 Ga0207699_10065245 3300025906 Bacteria 2206
206 Ga0207699_10144903 3300025906 Bacteria 1565
207 Ga0207645_10037093 3300025907 Bacteria 3129
208 Ga0207643_10010215 3300025908 Bacteria 5050
209 Ga0207643_10016761 3300025908 Bacteria 3998
210 Ga0207707_10003985 3300025912 Bacteria 13110
211 Ga0207707_10046321 3300025912 Bacteria 3787
212 Ga0207707_10153308 3300025912 Bacteria 2014
213 Ga0207695_10010612 3300025913 Bacteria 11257
214 Ga0207671_10009892 3300025914 Bacteria 7927
215 Ga0207693_10007619 3300025915 Bacteria 8892
216 Ga0207693_10009659 3300025915 Bacteria 7855
217 Ga0207663_10091705 3300025916 Bacteria 2018
218 Ga0207660_10029769 3300025917 Bacteria 3749
219 Ga0207660_10309505 3300025917 Bacteria 1259
220 Ga0207657_10003387 3300025919 Bacteria 17050
221 Ga0207649_10209166 3300025920 Bacteria 1383
222 Ga0207652_10009203 3300025921 Bacteria 7950
223 Ga0207646_10013719 3300025922 Bacteria 7737
224 Ga0207650_10002371 3300025925 Bacteria 13104
225 Ga0207650_10042488 3300025925 Bacteria 3335
226 Ga0207659_10000462 3300025926 Bacteria 24409
227 Ga0207687_10003283 3300025927 Bacteria 10945
228 Ga0207664_10038283 3300025929 Bacteria 3718
229 Ga0207644_10002291 3300025931 Bacteria 12422
230 Ga0207644_10009296 3300025931 Bacteria 6451
231 Ga0207644_10190225 3300025931 Bacteria 1613
232 Ga0207706_10001466 3300025933 Bacteria 23574
233 Ga0207706_10031760 3300025933 Bacteria 4703
234 Ga0207706_10034962 3300025933 Bacteria 4470
235 Ga0207706_10140687 3300025933 Bacteria 2123
236 Ga0207706_10169081 3300025933 Bacteria 1921
237 Ga0207686_10000798 3300025934 Bacteria 19304
238 Ga0207686_10016946 3300025934 Bacteria 4095
239 Ga0207709_10035265 3300025935 Bacteria 2956
240 Ga0207670_10014043 3300025936 Bacteria 4742
241 Ga0207670_10044747 3300025936 Bacteria 2930
242 Ga0207669_10007150 3300025937 Bacteria 5141
243 Ga0207669_10124630 3300025937 Bacteria 1757
244 Ga0207669_10271241 3300025937 Bacteria 1274
245 Ga0207665_10038353 3300025939 Bacteria 3190
246 Ga0207665_10068565 3300025939 Unclassified 2417
247 Ga0207691_10000513 3300025940 Bacteria 38489
248 Ga0207691_10047706 3300025940 Bacteria 3930
249 Ga0207691_10059321 3300025940 Bacteria 3480
250 Ga0207711_10002829 3300025941 Bacteria 15246
251 Ga0207711_10057235 3300025941 Bacteria 3352
252 Ga0207689_10045180 3300025942 Bacteria 3643
253 Ga0207689_10117926 3300025942 Bacteria 2183
254 Ga0207661_10026593 3300025944 Bacteria 4411
255 Ga0207661_10059378 3300025944 Bacteria 3082
256 Ga0207667_10019744 3300025949 Bacteria 7513
257 Ga0207667_10498883 3300025949 Bacteria 1235
258 Ga0207667_10647419 3300025949 Bacteria 1062
259 Ga0207651_10001059 3300025960 Bacteria 12186
260 Ga0207651_10003258 3300025960 Bacteria 7947
261 Ga0207640_10001436 3300025981 Bacteria 12896
262 Ga0207658_10272168 3300025986 Bacteria 1448
263 Ga0207677_10000186 3300026023 Bacteria 49949
264 Ga0207677_10000494 3300026023 Bacteria 25605
265 Ga0207703_10003780 3300026035 Bacteria 12583
266 Ga0207703_10065764 3300026035 Bacteria 2980
267 Ga0207703_10088929 3300026035 Bacteria 2593
268 Ga0207639_10022812 3300026041 Bacteria 4512
269 Ga0207639_10279203 3300026041 Bacteria 1468
270 Ga0207639_10623637 3300026041 Bacteria 996
271 Ga0207708_10008241 3300026075 Bacteria 7720
272 Ga0207641_10007033 3300026088 Bacteria 9401
273 Ga0207641_10478676 3300026088 Bacteria 1206
274 Ga0207641_10646466 3300026088 Bacteria 1038
275 Ga0207641_10681774 3300026088 Bacteria 1011
276 Ga0207648_10008515 3300026089 Bacteria 9927
277 Ga0207648_10061631 3300026089 Bacteria 3271
278 Ga0207676_10000455 3300026095 Bacteria 34474
279 Ga0207676_10025071 3300026095 Bacteria 4422
280 Ga0207676_10567972 3300026095 Bacteria 1086
281 Ga0207674_10006719 3300026116 Bacteria 13503
282 Ga0207675_100017014 3300026118 Bacteria 6794
283 Ga0207683_10000673 3300026121 Bacteria 31320
284 Ga0207683_10000768 3300026121 Bacteria 29179
285 Ga0207683_10020193 3300026121 Bacteria 5695
286 Ga0207698_10004774 3300026142 Bacteria 8295
287 Ga0209281_1019255 3300027111 Bacteria 1351
288 Ga0209969_1000695 3300027360 Bacteria 4512
289 Ga0210000_1000104 3300027462 Bacteria 11765
290 Ga0209971_1008430 3300027682 Bacteria 2445
291 Ga0209974_10013981 3300027876 Bacteria 2674
292 Ga0207428_10057470 3300027907 Bacteria 3088
293 Ga0268266_10023237 3300028379 Bacteria 5279
294 Ga0268264_10005450 3300028381 Bacteria 10781
295 Ga0268264_10257767 3300028381 Bacteria 1623
296 Ga0265318_10007718 3300028577 Bacteria 4839
297 Ga0265322_10002161 3300028654 Bacteria 6115
298 Ga0307515_10002662 3300028794 Bacteria 38277
299 Ga0307515_10013586 3300028794 Bacteria 15194
300 Ga0265338_10350667 3300028800 Bacteria 1061
301 Ga0265330_10002766 3300031235 Bacteria 9428
302 Ga0265330_10004578 3300031235 Bacteria 6999
303 Ga0265332_10090429 3300031238 Bacteria 1295
304 Ga0265320_10030095 3300031240 Bacteria 2804
305 Ga0265325_10149005 3300031241 Bacteria 1108
306 Ga0265329_10006099 3300031242 Bacteria 4810
307 Ga0265331_10014337 3300031250 Bacteria 4225
308 Ga0265316_10002434 3300031344 Bacteria 19339
309 Ga0265316_10014225 3300031344 Bacteria 7019
310 Ga0307408_100182014 3300031548 Bacteria 1686
311 Ga0265314_10001567 3300031711 Bacteria 25135
312 Ga0265342_10000164 3300031712 Bacteria 74148
313 Ga0307518_10017880 3300031838 Bacteria 5080
314 Ga0307410_10363279 3300031852 Bacteria 1160
315 Ga0307412_10151041 3300031911 Bacteria 1714
316 Ga0307416_100455130 3300032002 Bacteria 1333
317 Ga0307414_10059886 3300032004 Bacteria 2690
318 Ga0307411_10106640 3300032005 Bacteria 1995
319 Ga0373926_0042697 3300035083 Bacteria 1622
320 Ga0373934_0007287 3300035086 Bacteria 4102
321 Ga0373944_0018506 3300035089 Bacteria 1990
322 Ga0373945_0005115 3300035116 Bacteria 4186
323 Ga0373945_0122748 3300035116 Bacteria 1034
324 Ga0373954_0004273 3300035118 Bacteria 6139
325 Ga0373946_0043551 3300035171 Bacteria 1850
326 Ga0373955_0002610 3300035172 Bacteria 7881
327 Ga0373955_0187388 3300035172 Unclassified 1229
328 Ga0373924_0004132 3300035410 Bacteria 5051
329 Ga0373924_0042803 3300035410 Bacteria 1858
330 Ga0373935_0030436 3300035692 Bacteria 3346
331 Ga0373935_0092215 3300035692 Bacteria 1984
332 Ga0373927_0024392 3300035695 Bacteria 3956
333 Ga0373927_0054838 3300035695 Bacteria 2578
334 Ga0373933_0073644 3300035724 Bacteria 2081
335 Ga0373947_0101461 3300035725 Bacteria 1809
336 Ga0373937_0072701 3300036401 Bacteria 3172
337 Ga0373937_0712766 3300036401 Bacteria 950
338 Ga0373925_0004171 3300037068 Bacteria 10967
339 Ga0373925_0068247 3300037068 Bacteria 2683
340 Ga0373925_0218087 3300037068 Bacteria 1522
341 Ga0395899_0000581 3300037312 Bacteria 38482
342 Ga0395898_0868893 3300037466 Bacteria 841
343 Ga0436361_0313546 3300039447 Bacteria 35556
344 Ga0436361_0500164 3300039447 Bacteria 28968
345 Ga0436361_0954756 3300039447 Bacteria 64588
346 Ga0451853_0810706 3300041512 Bacteria 2474
347 Ga0439431_0003490 3300041997 Bacteria 3464
348 Ga0439458_0023339 3300042157 Bacteria 1442
349 Ga0450909_018943 3300042185 Bacteria 1024
350 Ga0466972_0001085 3300044658 Bacteria 13048
351 Ga0466965_0039188 3300044683 Bacteria 2329
352 Ga0466965_0142610 3300044683 Bacteria 1248
353 Ga0466966_0024130 3300044684 Bacteria 3980
354 Ga0466971_0043751 3300044719 Bacteria 2012
355 Ga0466957_0134257 3300044842 Bacteria 1589
356 Ga0451576_0438606 3300045051 Bacteria 1371
357 Ga0451576_0500000 3300045051 Bacteria 1277
358 Ga0495617_000198 3300046452 Bacteria 37950
359 Ga0495617_009638 3300046452 Bacteria 3312
360 Ga0495627_000004 3300046453 Bacteria 640612
361 Ga0495603_0271912 3300046455 Bacteria 975
362 Ga0495590_0000056 3300046457 Bacteria 96913
363 Ga0495629_0016725 3300046459 Bacteria 5263
364 Ga0495638_0014336 3300046460 Bacteria 5364
365 Ga0495651_0037178 3300046462 Bacteria 3790
366 Ga0495653_0000066 3300046463 Bacteria 91671
367 Ga0495653_0029585 3300046463 Bacteria 4371
368 Ga0495650_0000528 3300046471 Bacteria 55706
369 Ga0495650_0000571 3300046471 Bacteria 51694
370 Ga0495650_0003944 3300046471 Bacteria 10456
371 Ga0495650_0081294 3300046471 Bacteria 1248
372 Ga0495580_0006193 3300046472 Bacteria 9783
373 Ga0495580_0174970 3300046472 Bacteria 1483
374 Ga0495639_0027360 3300046475 Bacteria 2523
375 Ga0495662_0012895 3300046476 Bacteria 4072
376 Ga0495664_0113648 3300046477 Bacteria 1635
377 Ga0495585_0000646 3300046492 Bacteria 32025
378 Ga0495594_0121897 3300046499 Bacteria 1474
379 Ga0495607_0001066 3300046501 Bacteria 25057
380 Ga0495606_0000063 3300046507 Bacteria 184610
381 Ga0495606_0000180 3300046507 Bacteria 111330
382 Ga0495610_0000014 3300046512 Bacteria 444708
383 Ga0495610_0006277 3300046512 Bacteria 8229
384 Ga0495630_0146367 3300046517 Bacteria 1797
385 Ga0495632_0051920 3300046519 Bacteria 2017
386 Ga0495637_0002419 3300046520 Bacteria 10313
387 Ga0495643_0000133 3300046522 Bacteria 119563
388 Ga0495644_0008954 3300046523 Bacteria 3850
389 Ga0495648_0003987 3300046524 Bacteria 12776
390 Ga0495642_0076118 3300046528 Bacteria 1409
391 Ga0495654_0000014 3300046530 Bacteria 312126
392 Ga0495654_0004348 3300046530 Bacteria 8429
393 Ga0495654_0008231 3300046530 Bacteria 5772
394 Ga0495654_0018401 3300046530 Bacteria 3662
395 Ga0495665_0138328 3300046531 Bacteria 1273
396 Ga0495586_0113220 3300046535 Bacteria 1511
397 Ga0495609_0001180 3300046538 Bacteria 18046
398 Ga0495621_0035243 3300046539 Bacteria 1732
399 Ga0495621_0039453 3300046539 Bacteria 1651
400 Ga0495645_0039072 3300046543 Bacteria 3461
401 Ga0495622_0004798 3300046557 Bacteria 6262
402 Ga0495633_0000131 3300046558 Bacteria 100408
403 Ga0495633_0001499 3300046558 Bacteria 18101
404 Ga0495656_0028756 3300046615 Bacteria 2232
405 Ga0495668_0000152 3300046616 Bacteria 104716
406 Ga0495668_0000636 3300046616 Bacteria 42184
407 Ga0495668_0002746 3300046616 Bacteria 14081
408 Ga0495634_0022935 3300046642 Bacteria 4395
409 Ga0495635_0011193 3300046663 Bacteria 6289
410 Ga0495659_0010388 3300046664 Bacteria 2986
411 Ga0495588_0008252 3300046674 Bacteria 4770
412 Ga0495657_0142557 3300046675 Bacteria 1493
413 Ga0495623_0031724 3300046679 Bacteria 3397
414 Ga0495647_0000713 3300046681 Bacteria 9888
415 Ga0495669_0051531 3300046684 Bacteria 1848
416 Ga0495613_0003774 3300046689 Bacteria 11353
417 Ga0495671_0000005 3300046692 Bacteria 509397
418 Ga0495671_0015822 3300046692 Bacteria 4037
419 Ga0495660_0000923 3300046810 Bacteria 21621
420 Ga0495660_0003889 3300046810 Bacteria 9130
421 Ga0495660_0004915 3300046810 Bacteria 8051
422 Ga0495660_0005172 3300046810 Bacteria 7834
423 Ga0495581_0003828 3300047315 Bacteria 8653
424 Ga0495604_0081568 3300047317 Bacteria 2421
425 Ga0495604_0192796 3300047317 Unclassified 1419
426 Ga0495672_0000019 3300047320 Bacteria 448153
427 Ga0495676_0000031 3300047321 Bacteria 132364
428 Ga0495683_0012988 3300047323 Bacteria 4363
429 Ga0495683_0018449 3300047323 Bacteria 3608
430 Ga0495673_0000009 3300047469 Bacteria 731993
431 Ga0495673_0000012 3300047469 Bacteria 656908
432 Ga0495673_0000146 3300047469 Bacteria 127378
433 Ga0495681_0000895 3300047470 Bacteria 23009
434 Ga0495684_0019481 3300047471 Bacteria 5225
435 Ga0495686_0000332 3300047472 Bacteria 77832
436 Ga0495686_0004668 3300047472 Bacteria 11120
437 Ga0495686_0148759 3300047472 Bacteria 1376
438 Ga0495686_0315466 3300047472 Bacteria 858
439 Ga0495593_0013259 3300047673 Bacteria 4706
440 Ga0495614_0009243 3300048089 Bacteria 4364
441 Ga0496100_0024371 3300048903 Bacteria 3691
442 Ga0496101_0176973 3300048904 Bacteria 1641
443 Ga0496104_0003415 3300048907 Bacteria 13703
444 Ga0496105_0004826 3300048908 Bacteria 10186
445 Ga0496106_0364505 3300048909 Bacteria 1161
446 Ga0496106_0365646 3300048909 Bacteria 1159
447 Ga0496108_0253265 3300048911 Bacteria 1532
448 Ga0496109_0001737 3300048912 Bacteria 18195
449 Ga0496109_0041300 3300048912 Bacteria 4179
450 Ga0496109_0238043 3300048912 Bacteria 1713
451 Ga0496109_0302677 3300048912 Bacteria 1508
452 Ga0496110_0029368 3300048913 Bacteria 4731
453 Ga0496110_0329324 3300048913 Bacteria 1391
454 Ga0496115_0035197 3300048918 Bacteria 3961
455 Ga0496115_0167203 3300048918 Bacteria 1819
456 Ga0496115_0178651 3300048918 Bacteria 1755
457 Ga0496116_0056944 3300048919 Bacteria 2559
458 Ga0496117_0000075 3300048920 Bacteria 232451
459 Ga0496118_0000055 3300048921 Bacteria 232451
460 Ga0496121_0003403 3300048924 Bacteria 22754
461 Ga0496121_0013110 3300048924 Bacteria 8947
462 Ga0496122_0000800 3300048925 Bacteria 60346
463 Ga0496123_0006032 3300048926 Bacteria 11919
464 Ga0496124_0018943 3300048927 Bacteria 6426
465 Ga0496124_0060462 3300048927 Bacteria 3178
466 Ga0496125_0135375 3300048928 Bacteria 1724
467 Ga0496126_0058971 3300048929 Bacteria 3458
468 Ga0495678_000027 3300049459 Bacteria 222075
469 Ga0495678_002046 3300049459 Bacteria 14431
470 Ga0495678_010529 3300049459 Bacteria 4490
471 Ga0495682_0008184 3300049460 Bacteria 4130
472 Ga0501034_0026205 3300049571 Bacteria 5937
473 Ga0501034_0057097 3300049571 Bacteria 3925
474 Ga0501040_0355071 3300049576 Bacteria 1050
475 Ga0501041_0187250 3300049577 Bacteria 1296
476 Ga0501042_0117513 3300049578 Bacteria 1914
477 Ga0501043_0133618 3300049579 Bacteria 1944
478 Ga0501047_0124228 3300049581 Bacteria 2461
479 Ga0501067_0008963 3300049583 Bacteria 5546
480 Ga0501069_0113752 3300049585 Bacteria 1543
481 Ga0501070_0020725 3300049586 Bacteria 5514
482 Ga0501073_0006495 3300049589 Bacteria 8700
483 Ga0501076_0013438 3300049592 Bacteria 6142
484 Ga0501249_004256 3300049679 Bacteria 2904
485 Ga0501079_0021918 3300049741 Bacteria 4893
486 Ga0501080_0001682 3300049742 Bacteria 18850
487 Ga0501080_0444858 3300049742 Bacteria 1162
488 Ga0501080_0446888 3300049742 Unclassified 1159
489 Ga0501081_0002751 3300049743 Bacteria 11147
490 Ga0501083_0040929 3300049744 Bacteria 3144
491 Ga0501269_002882 3300049766 Bacteria 2096
492 Ga0501045_0066747 3300049824 Bacteria 2641
493 nmdc:mga0k408_15049_c1 3300050493 Bacteria 4276
494 nmdc:mga05p37_528382_c1 3300050507 Bacteria 1348
495 nmdc:mga09592_27897_c1 3300050508 Bacteria 4687
496 nmdc:mga0qj67_167454_c1 3300050509 Bacteria 1784
497 nmdc:mga08y16_1729_c1 3300050511 Bacteria 22150
498 nmdc:mga08y16_31157_c1 3300050511 Bacteria 5611
499 nmdc:mga08y16_96291_c1 3300050511 Bacteria 3082
500 nmdc:mga0n895_334938_c1 3300050512 Bacteria 1533
501 nmdc:mga0n895_789628_c1 3300050512 Bacteria 940
502 nmdc:mga0rr50_230764_c1 3300050513 Bacteria 1531
503 Ga0495601_0188329 3300053077 Bacteria 1349
504 Ga0495595_0064302 3300053084 Bacteria 1724
505 Ga0495619_0023531 3300053085 Bacteria 3950
506 Ga0500586_036531 3300053145 Bacteria 1648
507 Ga0501084_0037703 3300054114 Bacteria 4040
508 Ga0466962_0040270 3300061719 Bacteria 2237

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0868893 Ga0395898_0868893_165_830 218
2 3300021361 Ga0213872_10001253 Ga0213872_100012536 233
3 3300005330 Ga0070690_100337585 Ga0070690_1003375851 239
4 3300046674 Ga0495588_0008252 Ga0495588_0008252_3484_4389 241
5 3300047321 Ga0495676_0000031 Ga0495676_0000031_20736_21641 241
6 3300047472 Ga0495686_0004668 Ga0495686_0004668_5864_6667 248
7 3300025940 Ga0207691_10059321 Ga0207691_100593213 251
8 3300050509 nmdc:mga0qj67_167454_c1 nmdc:mga0qj67_167454_c1_930_1718 251
9 3300046522 Ga0495643_0000133 Ga0495643_0000133_11410_12246 252
10 3300049576 Ga0501040_0355071 Ga0501040_0355071_147_992 253
11 3300049577 Ga0501041_0187250 Ga0501041_0187250_101_946 253
12 3300049578 Ga0501042_0117513 Ga0501042_0117513_633_1478 253
13 3300049579 Ga0501043_0133618 Ga0501043_0133618_736_1581 253
14 3300049592 Ga0501076_0013438 Ga0501076_0013438_62_907 253
15 3300049741 Ga0501079_0021918 Ga0501079_0021918_739_1584 253
16 3300049742 Ga0501080_0444858 Ga0501080_0444858_86_931 253
17 3300049743 Ga0501081_0002751 Ga0501081_0002751_3496_4341 253
18 3300049824 Ga0501045_0066747 Ga0501045_0066747_1444_2289 253
19 3300054114 Ga0501084_0037703 Ga0501084_0037703_1218_2063 253
20 3300037068 Ga0373925_0004171 Ga0373925_0004171_348_1196 254
21 3300036401 Ga0373937_0712766 Ga0373937_0712766_118_927 255
22 3300005328 Ga0070676_10089642 Ga0070676_100896422 256
23 3300005331 Ga0070670_100104226 Ga0070670_1001042262 256
24 3300005334 Ga0068869_100161704 Ga0068869_1001617042 256
25 3300005340 Ga0070689_100091797 Ga0070689_1000917972 256
26 3300005345 Ga0070692_10189174 Ga0070692_101891741 256
27 3300005353 Ga0070669_100088704 Ga0070669_1000887042 256
28 3300005354 Ga0070675_100167645 Ga0070675_1001676453 256
29 3300005356 Ga0070674_100041651 Ga0070674_1000416512 256
30 3300005367 Ga0070667_100074487 Ga0070667_1000744874 256
31 3300005441 Ga0070700_100052290 Ga0070700_1000522902 256
32 3300005456 Ga0070678_100085385 Ga0070678_1000853854 256
33 3300005466 Ga0070685_10012889 Ga0070685_100128892 256
34 3300005543 Ga0070672_100085290 Ga0070672_1000852903 256
35 3300005548 Ga0070665_100123897 Ga0070665_1001238972 256
36 3300005549 Ga0070704_100023891 Ga0070704_1000238913 256
37 3300005563 Ga0068855_100481382 Ga0068855_1004813822 256
38 3300005616 Ga0068852_100406739 Ga0068852_1004067392 256
39 3300005718 Ga0068866_10003879 Ga0068866_100038794 256
40 3300005719 Ga0068861_100028641 Ga0068861_1000286413 256
41 3300005841 Ga0068863_100108615 Ga0068863_1001086154 256
42 3300005842 Ga0068858_100272909 Ga0068858_1002729092 256
43 3300005843 Ga0068860_100142352 Ga0068860_1001423524 256
44 3300006237 Ga0097621_100293778 Ga0097621_1002937781 256
45 3300009094 Ga0111539_10350038 Ga0111539_103500382 256
46 3300009148 Ga0105243_10043528 Ga0105243_100435284 256
47 3300009176 Ga0105242_10235976 Ga0105242_102359763 256
48 3300009177 Ga0105248_10331638 Ga0105248_103316382 256
49 3300013296 Ga0157374_10059270 Ga0157374_100592704 256
50 3300013297 Ga0157378_10139239 Ga0157378_101392392 256
51 3300014325 Ga0163163_10421357 Ga0163163_104213572 256
52 3300014326 Ga0157380_10288881 Ga0157380_102888812 256
53 3300025893 Ga0207682_10005908 Ga0207682_100059084 256
54 3300025899 Ga0207642_10120109 Ga0207642_101201092 256
55 3300025901 Ga0207688_10096438 Ga0207688_100964381 256
56 3300025908 Ga0207643_10016761 Ga0207643_100167612 256
57 3300025933 Ga0207706_10169081 Ga0207706_101690812 256
58 3300025936 Ga0207670_10044747 Ga0207670_100447474 256
59 3300025937 Ga0207669_10271241 Ga0207669_102712411 256
60 3300025940 Ga0207691_10047706 Ga0207691_100477063 256
61 3300025942 Ga0207689_10045180 Ga0207689_100451805 256
62 3300025949 Ga0207667_10498883 Ga0207667_104988832 256
63 3300026035 Ga0207703_10088929 Ga0207703_100889291 256
64 3300026075 Ga0207708_10008241 Ga0207708_1000824112 256
65 3300026088 Ga0207641_10478676 Ga0207641_104786761 256
66 3300026088 Ga0207641_10646466 Ga0207641_106464662 256
67 3300026089 Ga0207648_10008515 Ga0207648_100085158 256
68 3300026095 Ga0207676_10025071 Ga0207676_100250715 256
69 3300026118 Ga0207675_100017014 Ga0207675_1000170144 256
70 3300026121 Ga0207683_10020193 Ga0207683_100201932 256
71 3300028381 Ga0268264_10257767 Ga0268264_102577671 256
72 3300045051 Ga0451576_0438606 Ga0451576_0438606_408_1244 256
73 3300046528 Ga0495642_0076118 Ga0495642_0076118_424_1260 256
74 3300046684 Ga0495669_0051531 Ga0495669_0051531_852_1688 256
75 3300048908 Ga0496105_0004826 Ga0496105_0004826_24_842 256
76 3300048911 Ga0496108_0253265 Ga0496108_0253265_203_1039 256
77 3300048912 Ga0496109_0302677 Ga0496109_0302677_520_1356 256
78 3300048913 Ga0496110_0329324 Ga0496110_0329324_106_942 256
79 3300050511 nmdc:mga08y16_31157_c1 nmdc:mga08y16_31157_c1_2775_3611 256
80 3300005844 Ga0068862_100020456 Ga0068862_1000204563 257
81 3300005336 Ga0070680_100028049 Ga0070680_1000280493 258
82 3300005458 Ga0070681_10013173 Ga0070681_100131735 258
83 3300005530 Ga0070679_100038960 Ga0070679_1000389606 258
84 3300005539 Ga0068853_100015122 Ga0068853_1000151225 258
85 3300005549 Ga0070704_100027628 Ga0070704_1000276282 258
86 3300013307 Ga0157372_10049918 Ga0157372_100499184 258
87 3300025912 Ga0207707_10003985 Ga0207707_1000398510 258
88 3300025917 Ga0207660_10029769 Ga0207660_100297694 258
89 3300025920 Ga0207649_10209166 Ga0207649_102091662 258
90 3300025921 Ga0207652_10009203 Ga0207652_100092036 258
91 3300026041 Ga0207639_10022812 Ga0207639_100228123 258
92 3300049571 Ga0501034_0026205 Ga0501034_0026205_4434_5267 258
93 3300049581 Ga0501047_0124228 Ga0501047_0124228_1289_2122 258
94 3300049583 Ga0501067_0008963 Ga0501067_0008963_2300_3133 258
95 3300049586 Ga0501070_0020725 Ga0501070_0020725_248_1081 258
96 3300049589 Ga0501073_0006495 Ga0501073_0006495_5315_6148 258
97 3300049742 Ga0501080_0001682 Ga0501080_0001682_4327_5160 258
98 3300049744 Ga0501083_0040929 Ga0501083_0040929_2213_3046 258
99 3300017792 Ga0163161_10030211 Ga0163161_100302112 259
100 3300028794 Ga0307515_10002662 Ga0307515_100026625 259
101 3300031548 Ga0307408_100182014 Ga0307408_1001820141 259
102 3300031852 Ga0307410_10363279 Ga0307410_103632791 259
103 3300032004 Ga0307414_10059886 Ga0307414_100598863 259
104 3300032005 Ga0307411_10106640 Ga0307411_101066401 259
105 3300046471 Ga0495650_0003944 Ga0495650_0003944_7999_8811 259
106 3300046535 Ga0495586_0113220 Ga0495586_0113220_73_909 259
107 3300050512 nmdc:mga0n895_789628_c1 nmdc:mga0n895_789628_c1_103_924 259
108 3300005333 Ga0070677_10009192 Ga0070677_100091924 260
109 3300005459 Ga0068867_100212065 Ga0068867_1002120652 260
110 3300005467 Ga0070706_100073147 Ga0070706_1000731475 260
111 3300006177 Ga0075362_10089949 Ga0075362_100899492 260
112 3300006195 Ga0075366_10002856 Ga0075366_100028566 260
113 3300009094 Ga0111539_10733169 Ga0111539_107331692 260
114 3300009094 Ga0111539_10872624 Ga0111539_108726241 260
115 3300017792 Ga0163161_10055751 Ga0163161_100557514 260
116 3300025315 Ga0207697_10006613 Ga0207697_100066135 260
117 3300025935 Ga0207709_10035265 Ga0207709_100352652 260
118 3300028577 Ga0265318_10007718 Ga0265318_100077185 260
119 3300028794 Ga0307515_10013586 Ga0307515_100135865 260
120 3300028800 Ga0265338_10350667 Ga0265338_103506671 260
121 3300031235 Ga0265330_10004578 Ga0265330_100045786 260
122 3300031238 Ga0265332_10090429 Ga0265332_100904292 260
123 3300031240 Ga0265320_10030095 Ga0265320_100300954 260
124 3300031241 Ga0265325_10149005 Ga0265325_101490051 260
125 3300031250 Ga0265331_10014337 Ga0265331_100143377 260
126 3300031344 Ga0265316_10014225 Ga0265316_100142255 260
127 3300031711 Ga0265314_10001567 Ga0265314_1000156721 260
128 3300031911 Ga0307412_10151041 Ga0307412_101510412 260
129 3300032002 Ga0307416_100455130 Ga0307416_1004551301 260
130 3300039447 Ga0436361_0313546 Ga0436361_0313546_17747_18562 260
131 3300039447 Ga0436361_0500164 Ga0436361_0500164_12951_13766 260
132 3300041997 Ga0439431_0003490 Ga0439431_0003490_2496_3302 260
133 3300042185 Ga0450909_018943 Ga0450909_018943_14_820 260
134 3300050493 nmdc:mga0k408_15049_c1 nmdc:mga0k408_15049_c1_3334_4176 260
135 3300003322 rootL2_10025805 rootL2_1002580512 261
136 3300005344 Ga0070661_100257078 Ga0070661_1002570782 261
137 3300005445 Ga0070708_100106539 Ga0070708_1001065392 261
138 3300005457 Ga0070662_100014505 Ga0070662_1000145053 261
139 3300005458 Ga0070681_10001301 Ga0070681_1000130111 261
140 3300005467 Ga0070706_100022137 Ga0070706_1000221374 261
141 3300005468 Ga0070707_100012605 Ga0070707_1000126057 261
142 3300025912 Ga0207707_10046321 Ga0207707_100463215 261
143 3300025922 Ga0207646_10013719 Ga0207646_100137197 261
144 3300025933 Ga0207706_10001466 Ga0207706_100014663 261
145 3300042157 Ga0439458_0023339 Ga0439458_0023339_563_1390 261
146 3300044658 Ga0466972_0001085 Ga0466972_0001085_10832_11656 261
147 3300044683 Ga0466965_0039188 Ga0466965_0039188_56_880 261
148 3300009093 Ga0105240_10005056 Ga0105240_1000505619 262
149 3300009545 Ga0105237_10000784 Ga0105237_1000078421 262
150 3300010375 Ga0105239_10001759 Ga0105239_1000175925 262
151 3300025913 Ga0207695_10010612 Ga0207695_1001061212 262
152 3300025914 Ga0207671_10009892 Ga0207671_100098928 262
153 3300048928 Ga0496125_0135375 Ga0496125_0135375_58_894 262
154 3300028654 Ga0265322_10002161 Ga0265322_100021615 264
155 3300031235 Ga0265330_10002766 Ga0265330_100027664 264
156 3300031242 Ga0265329_10006099 Ga0265329_100060993 264
157 3300031344 Ga0265316_10002434 Ga0265316_1000243416 264
158 3300031712 Ga0265342_10000164 Ga0265342_100001642 264
159 3300005336 Ga0070680_100107457 Ga0070680_1001074572 266
160 iso_pu_bacteria 2738541297 2738826075 266
161 iso_pu_bacteria 2738541357 2739149872 266
162 iso_pu_bacteria 2738543003 2739191791 266
163 iso_pu_bacteria 2738543026 2739318268 266
164 iso_pu_bacteria 2738543029 2739336509 266
165 3300046472 Ga0495580_0174970 Ga0495580_0174970_486_1313 267
166 3300049585 Ga0501069_0113752 Ga0501069_0113752_428_1255 267
167 iso_pu_bacteria 2857547612 2857552832 267
168 3300003771 Ga0055526_1000076 Ga0055526_100007630 268
169 3300005327 Ga0070658_10083012 Ga0070658_100830122 268
170 3300005329 Ga0070683_100001621 Ga0070683_1000016214 268
171 3300005330 Ga0070690_100004185 Ga0070690_1000041853 268
172 3300005331 Ga0070670_100039804 Ga0070670_1000398044 268
173 3300005334 Ga0068869_100256068 Ga0068869_1002560681 268
174 3300005335 Ga0070666_10312291 Ga0070666_103122912 268
175 3300005338 Ga0068868_100021111 Ga0068868_1000211111 268
176 3300005340 Ga0070689_100003440 Ga0070689_1000034407 268
177 3300005345 Ga0070692_10042264 Ga0070692_100422642 268
178 3300005355 Ga0070671_100018740 Ga0070671_1000187404 268
179 3300005356 Ga0070674_100024796 Ga0070674_1000247965 268
180 3300005364 Ga0070673_100000875 Ga0070673_10000087520 268
181 3300005364 Ga0070673_100006346 Ga0070673_1000063466 268
182 3300005365 Ga0070688_100001476 Ga0070688_1000014768 268
183 3300005367 Ga0070667_100305329 Ga0070667_1003053291 268
184 3300005436 Ga0070713_100010713 Ga0070713_1000107132 268
185 3300005437 Ga0070710_10030424 Ga0070710_100304242 268
186 3300005437 Ga0070710_10224907 Ga0070710_102249072 268
187 3300005439 Ga0070711_100005372 Ga0070711_1000053722 268
188 3300005439 Ga0070711_100044700 Ga0070711_1000447004 268
189 3300005440 Ga0070705_100037941 Ga0070705_1000379413 268
190 3300005444 Ga0070694_100316440 Ga0070694_1003164401 268
191 3300005445 Ga0070708_100169654 Ga0070708_1001696542 268
192 3300005456 Ga0070678_100012547 Ga0070678_1000125472 268
193 3300005457 Ga0070662_100044909 Ga0070662_1000449096 268
194 3300005457 Ga0070662_100062130 Ga0070662_1000621302 268
195 3300005458 Ga0070681_10271553 Ga0070681_102715532 268
196 3300005459 Ga0068867_100532730 Ga0068867_1005327301 268
197 3300005466 Ga0070685_10002559 Ga0070685_100025597 268
198 3300005467 Ga0070706_100318241 Ga0070706_1003182412 268
199 3300005536 Ga0070697_100029924 Ga0070697_1000299242 268
200 3300005543 Ga0070672_100245026 Ga0070672_1002450262 268
201 3300005544 Ga0070686_100173031 Ga0070686_1001730312 268
202 3300005547 Ga0070693_100054312 Ga0070693_1000543122 268
203 3300005548 Ga0070665_100016607 Ga0070665_1000166072 268
204 3300005563 Ga0068855_100410031 Ga0068855_1004100312 268
205 3300005564 Ga0070664_100274558 Ga0070664_1002745581 268
206 3300005578 Ga0068854_100128376 Ga0068854_1001283762 268
207 3300005614 Ga0068856_100422171 Ga0068856_1004221712 268
208 3300005615 Ga0070702_100024968 Ga0070702_1000249681 268
209 3300005615 Ga0070702_100126987 Ga0070702_1001269871 268
210 3300005616 Ga0068852_100050265 Ga0068852_1000502653 268
211 3300005617 Ga0068859_100005320 Ga0068859_1000053209 268
212 3300005618 Ga0068864_100009675 Ga0068864_1000096758 268
213 3300005718 Ga0068866_10006338 Ga0068866_100063382 268
214 3300005840 Ga0068870_10030072 Ga0068870_100300724 268
215 3300005841 Ga0068863_100012501 Ga0068863_1000125019 268
216 3300005842 Ga0068858_100182222 Ga0068858_1001822222 268
217 3300005843 Ga0068860_100341454 Ga0068860_1003414542 268
218 3300006163 Ga0070715_10008238 Ga0070715_100082382 268
219 3300006175 Ga0070712_100042826 Ga0070712_1000428263 268
220 3300006358 Ga0068871_100301128 Ga0068871_1003011282 268
221 3300006844 Ga0075428_100003410 Ga0075428_10000341015 268
222 3300006871 Ga0075434_100347527 Ga0075434_1003475272 268
223 3300006880 Ga0075429_100003762 Ga0075429_1000037624 268
224 3300006881 Ga0068865_100441169 Ga0068865_1004411692 268
225 3300006931 Ga0097620_100005321 Ga0097620_1000053219 268
226 3300007076 Ga0075435_100044922 Ga0075435_1000449224 268
227 3300009094 Ga0111539_10004728 Ga0111539_100047288 268
228 3300009094 Ga0111539_10229405 Ga0111539_102294052 268
229 3300009098 Ga0105245_10010977 Ga0105245_100109777 268
230 3300009098 Ga0105245_10028483 Ga0105245_100284832 268
231 3300009098 Ga0105245_10338416 Ga0105245_103384162 268
232 3300009147 Ga0114129_10276391 Ga0114129_102763913 268
233 3300009177 Ga0105248_10096402 Ga0105248_100964024 268
234 3300009545 Ga0105237_10364003 Ga0105237_103640032 268
235 3300013100 Ga0157373_10132673 Ga0157373_101326732 268
236 3300013104 Ga0157370_10021795 Ga0157370_100217953 268
237 3300013105 Ga0157369_10158841 Ga0157369_101588413 268
238 3300013296 Ga0157374_10004313 Ga0157374_100043136 268
239 3300013297 Ga0157378_10027667 Ga0157378_100276672 268
240 3300013297 Ga0157378_10543121 Ga0157378_105431212 268
241 3300013306 Ga0163162_10036018 Ga0163162_100360182 268
242 3300013306 Ga0163162_10036062 Ga0163162_100360622 268
243 3300013308 Ga0157375_10080856 Ga0157375_100808562 268
244 3300014325 Ga0163163_10004197 Ga0163163_100041975 268
245 3300014745 Ga0157377_10012518 Ga0157377_100125183 268
246 3300014968 Ga0157379_10035731 Ga0157379_100357314 268
247 3300014969 Ga0157376_10059009 Ga0157376_100590092 268
248 3300014969 Ga0157376_10069103 Ga0157376_100691032 268
249 3300017792 Ga0163161_10163575 Ga0163161_101635752 268
250 3300025295 Ga0209564_1000042 Ga0209564_1000042300 268
251 3300025899 Ga0207642_10016912 Ga0207642_100169124 268
252 3300025903 Ga0207680_10004468 Ga0207680_100044682 268
253 3300025905 Ga0207685_10011454 Ga0207685_100114543 268
254 3300025906 Ga0207699_10065245 Ga0207699_100652452 268
255 3300025907 Ga0207645_10037093 Ga0207645_100370932 268
256 3300025908 Ga0207643_10010215 Ga0207643_100102156 268
257 3300025912 Ga0207707_10153308 Ga0207707_101533082 268
258 3300025915 Ga0207693_10007619 Ga0207693_100076196 268
259 3300025915 Ga0207693_10009659 Ga0207693_100096594 268
260 3300025916 Ga0207663_10091705 Ga0207663_100917052 268
261 3300025917 Ga0207660_10309505 Ga0207660_103095052 268
262 3300025919 Ga0207657_10003387 Ga0207657_100033877 268
263 3300025925 Ga0207650_10042488 Ga0207650_100424881 268
264 3300025927 Ga0207687_10003283 Ga0207687_100032833 268
265 3300025931 Ga0207644_10009296 Ga0207644_100092962 268
266 3300025931 Ga0207644_10190225 Ga0207644_101902252 268
267 3300025933 Ga0207706_10031760 Ga0207706_100317606 268
268 3300025933 Ga0207706_10140687 Ga0207706_101406872 268
269 3300025934 Ga0207686_10000798 Ga0207686_1000079814 268
270 3300025936 Ga0207670_10014043 Ga0207670_100140435 268
271 3300025937 Ga0207669_10007150 Ga0207669_100071503 268
272 3300025939 Ga0207665_10038353 Ga0207665_100383532 268
273 3300025941 Ga0207711_10002829 Ga0207711_100028299 268
274 3300025942 Ga0207689_10117926 Ga0207689_101179261 268
275 3300025944 Ga0207661_10026593 Ga0207661_100265934 268
276 3300025944 Ga0207661_10059378 Ga0207661_100593784 268
277 3300025949 Ga0207667_10647419 Ga0207667_106474192 268
278 3300025960 Ga0207651_10001059 Ga0207651_100010599 268
279 3300025960 Ga0207651_10003258 Ga0207651_100032582 268
280 3300026023 Ga0207677_10000186 Ga0207677_1000018642 268
281 3300026035 Ga0207703_10003780 Ga0207703_100037806 268
282 3300026041 Ga0207639_10279203 Ga0207639_102792031 268
283 3300026041 Ga0207639_10623637 Ga0207639_106236371 268
284 3300026088 Ga0207641_10007033 Ga0207641_1000703310 268
285 3300026089 Ga0207648_10061631 Ga0207648_100616313 268
286 3300026095 Ga0207676_10000455 Ga0207676_1000045531 268
287 3300026095 Ga0207676_10567972 Ga0207676_105679722 268
288 3300026116 Ga0207674_10006719 Ga0207674_100067195 268
289 3300026121 Ga0207683_10000768 Ga0207683_1000076818 268
290 3300027360 Ga0209969_1000695 Ga0209969_10006952 268
291 3300027462 Ga0210000_1000104 Ga0210000_10001045 268
292 3300027682 Ga0209971_1008430 Ga0209971_10084302 268
293 3300027876 Ga0209974_10013981 Ga0209974_100139813 268
294 3300027907 Ga0207428_10057470 Ga0207428_100574705 268
295 3300028379 Ga0268266_10023237 Ga0268266_100232374 268
296 3300028381 Ga0268264_10005450 Ga0268264_1000545011 268
297 3300035083 Ga0373926_0042697 Ga0373926_0042697_38_892 268
298 3300035086 Ga0373934_0007287 Ga0373934_0007287_563_1417 268
299 3300035089 Ga0373944_0018506 Ga0373944_0018506_584_1438 268
300 3300035116 Ga0373945_0005115 Ga0373945_0005115_931_1785 268
301 3300035116 Ga0373945_0122748 Ga0373945_0122748_114_968 268
302 3300035118 Ga0373954_0004273 Ga0373954_0004273_3759_4613 268
303 3300035172 Ga0373955_0002610 Ga0373955_0002610_3047_3901 268
304 3300035172 Ga0373955_0187388 Ga0373955_0187388_51_905 268
305 3300035410 Ga0373924_0004132 Ga0373924_0004132_1613_2446 268
306 3300035410 Ga0373924_0042803 Ga0373924_0042803_723_1577 268
307 3300035692 Ga0373935_0092215 Ga0373935_0092215_56_910 268
308 3300035695 Ga0373927_0024392 Ga0373927_0024392_2192_3046 268
309 3300035695 Ga0373927_0054838 Ga0373927_0054838_223_1077 268
310 3300035724 Ga0373933_0073644 Ga0373933_0073644_768_1622 268
311 3300036401 Ga0373937_0072701 Ga0373937_0072701_1821_2675 268
312 3300037068 Ga0373925_0068247 Ga0373925_0068247_1317_2171 268
313 3300037068 Ga0373925_0218087 Ga0373925_0218087_26_862 268
314 3300045051 Ga0451576_0500000 Ga0451576_0500000_76_915 268
315 3300046455 Ga0495603_0271912 Ga0495603_0271912_102_956 268
316 3300046459 Ga0495629_0016725 Ga0495629_0016725_2065_2919 268
317 3300046462 Ga0495651_0037178 Ga0495651_0037178_2206_3060 268
318 3300046463 Ga0495653_0029585 Ga0495653_0029585_2508_3362 268
319 3300046472 Ga0495580_0006193 Ga0495580_0006193_2367_3221 268
320 3300046475 Ga0495639_0027360 Ga0495639_0027360_83_937 268
321 3300046476 Ga0495662_0012895 Ga0495662_0012895_1772_2626 268
322 3300046477 Ga0495664_0113648 Ga0495664_0113648_716_1570 268
323 3300046499 Ga0495594_0121897 Ga0495594_0121897_360_1214 268
324 3300046517 Ga0495630_0146367 Ga0495630_0146367_100_933 268
325 3300046531 Ga0495665_0138328 Ga0495665_0138328_199_1053 268
326 3300046543 Ga0495645_0039072 Ga0495645_0039072_1037_1891 268
327 3300046615 Ga0495656_0028756 Ga0495656_0028756_1020_1862 268
328 3300046642 Ga0495634_0022935 Ga0495634_0022935_3008_3862 268
329 3300046663 Ga0495635_0011193 Ga0495635_0011193_3708_4562 268
330 3300046664 Ga0495659_0010388 Ga0495659_0010388_1900_2754 268
331 3300046675 Ga0495657_0142557 Ga0495657_0142557_58_912 268
332 3300046679 Ga0495623_0031724 Ga0495623_0031724_2063_2917 268
333 3300046681 Ga0495647_0000713 Ga0495647_0000713_1540_2394 268
334 3300046689 Ga0495613_0003774 Ga0495613_0003774_3761_4615 268
335 3300047315 Ga0495581_0003828 Ga0495581_0003828_2378_3232 268
336 3300047317 Ga0495604_0081568 Ga0495604_0081568_1316_2170 268
337 3300047317 Ga0495604_0192796 Ga0495604_0192796_101_955 268
338 3300047471 Ga0495684_0019481 Ga0495684_0019481_1786_2640 268
339 3300047673 Ga0495593_0013259 Ga0495593_0013259_2087_2941 268
340 3300048089 Ga0495614_0009243 Ga0495614_0009243_3284_4138 268
341 3300048903 Ga0496100_0024371 Ga0496100_0024371_1133_1987 268
342 3300048904 Ga0496101_0176973 Ga0496101_0176973_225_1079 268
343 3300048907 Ga0496104_0003415 Ga0496104_0003415_6028_6882 268
344 3300048909 Ga0496106_0364505 Ga0496106_0364505_229_1083 268
345 3300048909 Ga0496106_0365646 Ga0496106_0365646_291_1145 268
346 3300048912 Ga0496109_0041300 Ga0496109_0041300_2661_3515 268
347 3300048912 Ga0496109_0238043 Ga0496109_0238043_788_1642 268
348 3300048918 Ga0496115_0035197 Ga0496115_0035197_805_1659 268
349 3300049571 Ga0501034_0057097 Ga0501034_0057097_758_1591 268
350 3300050507 nmdc:mga05p37_528382_c1 nmdc:mga05p37_528382_c1_362_1204 268
351 3300050508 nmdc:mga09592_27897_c1 nmdc:mga09592_27897_c1_3288_4130 268
352 3300050511 nmdc:mga08y16_1729_c1 nmdc:mga08y16_1729_c1_9904_10746 268
353 3300050511 nmdc:mga08y16_96291_c1 nmdc:mga08y16_96291_c1_545_1399 268
354 3300050512 nmdc:mga0n895_334938_c1 nmdc:mga0n895_334938_c1_461_1315 268
355 3300050513 nmdc:mga0rr50_230764_c1 nmdc:mga0rr50_230764_c1_568_1416 268
356 3300053077 Ga0495601_0188329 Ga0495601_0188329_118_972 268
357 3300053084 Ga0495595_0064302 Ga0495595_0064302_768_1622 268
358 3300053085 Ga0495619_0023531 Ga0495619_0023531_2080_2934 268
359 iso_pu_bacteria 2857553236 2857558046 268
360 iso_pu_bacteria 2885080285 2885083945 268
361 iso_pu_bacteria 2919476304 2919476343 268
362 3300005338 Ga0068868_100000336 Ga0068868_10000033618 269
363 3300005339 Ga0070660_100108327 Ga0070660_1001083271 269
364 3300005344 Ga0070661_100001915 Ga0070661_1000019156 269
365 3300005354 Ga0070675_100000564 Ga0070675_10000056421 269
366 3300005355 Ga0070671_100003077 Ga0070671_10000307711 269
367 3300005356 Ga0070674_100101034 Ga0070674_1001010341 269
368 3300005367 Ga0070667_100084604 Ga0070667_1000846044 269
369 3300005535 Ga0070684_100011627 Ga0070684_1000116274 269
370 3300005548 Ga0070665_100083752 Ga0070665_1000837525 269
371 3300005564 Ga0070664_100003688 Ga0070664_1000036888 269
372 3300005578 Ga0068854_100009287 Ga0068854_1000092872 269
373 3300005616 Ga0068852_100000411 Ga0068852_10000041123 269
374 3300005616 Ga0068852_100113163 Ga0068852_1001131631 269
375 3300005618 Ga0068864_100025682 Ga0068864_1000256824 269
376 3300005834 Ga0068851_10011794 Ga0068851_100117944 269
377 3300006237 Ga0097621_100000527 Ga0097621_10000052717 269
378 3300006358 Ga0068871_100000363 Ga0068871_10000036321 269
379 3300009177 Ga0105248_10034644 Ga0105248_100346446 269
380 3300013296 Ga0157374_10001418 Ga0157374_1000141822 269
381 3300013297 Ga0157378_10002277 Ga0157378_1000227717 269
382 3300013306 Ga0163162_10118801 Ga0163162_101188012 269
383 3300013308 Ga0157375_10082886 Ga0157375_100828866 269
384 3300014326 Ga0157380_10097868 Ga0157380_100978682 269
385 3300025321 Ga0207656_10018386 Ga0207656_100183865 269
386 3300025925 Ga0207650_10002371 Ga0207650_1000237110 269
387 3300025926 Ga0207659_10000462 Ga0207659_1000046213 269
388 3300025931 Ga0207644_10002291 Ga0207644_100022912 269
389 3300025933 Ga0207706_10034962 Ga0207706_100349628 269
390 3300025937 Ga0207669_10124630 Ga0207669_101246302 269
391 3300025939 Ga0207665_10068565 Ga0207665_100685652 269
392 3300025940 Ga0207691_10000513 Ga0207691_1000051321 269
393 3300025941 Ga0207711_10057235 Ga0207711_100572353 269
394 3300025981 Ga0207640_10001436 Ga0207640_1000143611 269
395 3300025986 Ga0207658_10272168 Ga0207658_102721682 269
396 3300026023 Ga0207677_10000494 Ga0207677_1000049412 269
397 3300026088 Ga0207641_10681774 Ga0207641_106817741 269
398 3300026121 Ga0207683_10000673 Ga0207683_1000067324 269
399 3300026142 Ga0207698_10004774 Ga0207698_100047742 269
400 3300035171 Ga0373946_0043551 Ga0373946_0043551_236_1099 269
401 3300035692 Ga0373935_0030436 Ga0373935_0030436_207_1070 269
402 3300035725 Ga0373947_0101461 Ga0373947_0101461_162_1025 269
403 3300041512 Ga0451853_0810706 Ga0451853_0810706_449_1387 269
404 3300046457 Ga0495590_0000056 Ga0495590_0000056_39837_40661 269
405 3300046539 Ga0495621_0039453 Ga0495621_0039453_810_1622 269
406 3300048912 Ga0496109_0001737 Ga0496109_0001737_4718_5656 269
407 3300048913 Ga0496110_0029368 Ga0496110_0029368_3866_4717 269
408 3300048918 Ga0496115_0167203 Ga0496115_0167203_834_1676 269
409 3300049742 Ga0501080_0446888 Ga0501080_0446888_73_951 269
410 3300005354 Ga0070675_100475550 Ga0070675_1004755501 270
411 3300005547 Ga0070693_100096228 Ga0070693_1000962281 270
412 3300005563 Ga0068855_100031145 Ga0068855_1000311454 270
413 3300005842 Ga0068858_100007450 Ga0068858_1000074503 270
414 3300009093 Ga0105240_10673322 Ga0105240_106733221 270
415 3300009148 Ga0105243_10067884 Ga0105243_100678842 270
416 3300009176 Ga0105242_10000761 Ga0105242_100007613 270
417 3300009177 Ga0105248_10215493 Ga0105248_102154932 270
418 3300013307 Ga0157372_10273770 Ga0157372_102737703 270
419 3300014497 Ga0182008_10002644 Ga0182008_100026444 270
420 3300014968 Ga0157379_10049300 Ga0157379_100493004 270
421 3300015262 Ga0182007_10000063 Ga0182007_1000006352 270
422 3300015265 Ga0182005_1000057 Ga0182005_100005760 270
423 3300025906 Ga0207699_10144903 Ga0207699_101449032 270
424 3300025929 Ga0207664_10038283 Ga0207664_100382832 270
425 3300025934 Ga0207686_10016946 Ga0207686_100169464 270
426 3300025949 Ga0207667_10019744 Ga0207667_100197444 270
427 3300026035 Ga0207703_10065764 Ga0207703_100657643 270
428 3300027111 Ga0209281_1019255 Ga0209281_10192552 270
429 3300046452 Ga0495617_000198 Ga0495617_000198_9993_10808 270
430 3300046452 Ga0495617_009638 Ga0495617_009638_787_1650 270
431 3300046460 Ga0495638_0014336 Ga0495638_0014336_2976_3791 270
432 3300046463 Ga0495653_0000066 Ga0495653_0000066_54299_55114 270
433 3300046471 Ga0495650_0000571 Ga0495650_0000571_33980_34795 270
434 3300046471 Ga0495650_0081294 Ga0495650_0081294_183_998 270
435 3300046492 Ga0495585_0000646 Ga0495585_0000646_14609_15424 270
436 3300046512 Ga0495610_0000014 Ga0495610_0000014_376146_376961 270
437 3300046524 Ga0495648_0003987 Ga0495648_0003987_9986_10801 270
438 3300046530 Ga0495654_0018401 Ga0495654_0018401_2372_3187 270
439 3300046539 Ga0495621_0035243 Ga0495621_0035243_336_1181 270
440 3300046616 Ga0495668_0000636 Ga0495668_0000636_14408_15223 270
441 3300046692 Ga0495671_0000005 Ga0495671_0000005_35483_36298 270
442 3300046692 Ga0495671_0015822 Ga0495671_0015822_2929_3744 270
443 3300046810 Ga0495660_0000923 Ga0495660_0000923_15315_16130 270
444 3300047323 Ga0495683_0018449 Ga0495683_0018449_832_1647 270
445 3300047469 Ga0495673_0000009 Ga0495673_0000009_704150_704965 270
446 3300047469 Ga0495673_0000012 Ga0495673_0000012_594009_594824 270
447 3300047469 Ga0495673_0000146 Ga0495673_0000146_49987_50805 270
448 3300048920 Ga0496117_0000075 Ga0496117_0000075_73431_74270 270
449 3300048921 Ga0496118_0000055 Ga0496118_0000055_73431_74270 270
450 3300048925 Ga0496122_0000800 Ga0496122_0000800_39330_40169 270
451 3300048926 Ga0496123_0006032 Ga0496123_0006032_1579_2418 270
452 3300048927 Ga0496124_0060462 Ga0496124_0060462_481_1320 270
453 3300048929 Ga0496126_0058971 Ga0496126_0058971_663_1478 270
454 3300049679 Ga0501249_004256 Ga0501249_004256_1455_2273 270
455 3300049766 Ga0501269_002882 Ga0501269_002882_105_923 270
456 3300053145 Ga0500586_036531 Ga0500586_036531_717_1532 270
457 3300003322 rootL2_10076289 rootL2_100762893 271
458 3300003763 Ga0055529_1000274 Ga0055529_100027416 271
459 3300005339 Ga0070660_100020748 Ga0070660_1000207484 271
460 3300005344 Ga0070661_100012702 Ga0070661_1000127023 271
461 3300006028 Ga0070717_10012658 Ga0070717_100126582 271
462 3300006846 Ga0075430_100159084 Ga0075430_1001590843 271
463 3300017792 Ga0163161_10025124 Ga0163161_100251241 271
464 3300025233 Ga0209437_106638 Ga0209437_1066381 271
465 3300025272 Ga0209455_1000253 Ga0209455_100025316 271
466 3300031838 Ga0307518_10017880 Ga0307518_100178801 271
467 3300044842 Ga0466957_0134257 Ga0466957_0134257_648_1499 271
468 3300046471 Ga0495650_0000528 Ga0495650_0000528_33071_33889 271
469 3300046507 Ga0495606_0000063 Ga0495606_0000063_31975_32793 271
470 3300046507 Ga0495606_0000180 Ga0495606_0000180_105514_106359 271
471 3300046512 Ga0495610_0006277 Ga0495610_0006277_5496_6314 271
472 3300046520 Ga0495637_0002419 Ga0495637_0002419_4153_4980 271
473 3300046530 Ga0495654_0000014 Ga0495654_0000014_293218_294036 271
474 3300046530 Ga0495654_0004348 Ga0495654_0004348_2492_3313 271
475 3300046616 Ga0495668_0000152 Ga0495668_0000152_42733_43551 271
476 3300046616 Ga0495668_0002746 Ga0495668_0002746_13115_13933 271
477 3300047472 Ga0495686_0000332 Ga0495686_0000332_31291_32115 271
478 3300047472 Ga0495686_0315466 Ga0495686_0315466_25_843 271
479 3300048918 Ga0496115_0178651 Ga0496115_0178651_210_1067 271
480 3300048919 Ga0496116_0056944 Ga0496116_0056944_1161_1979 271
481 iso_pu_bacteria 2600255292 2601666936 271
482 3300002987 JGI25159J45721_1000292 JGI25159J45721_10002923 272
483 3300004625 Ga0055543_1005921 Ga0055543_10059211 272
484 3300005262 Ga0065165_1000167 Ga0065165_100016716 272
485 3300015261 Ga0182006_1000095 Ga0182006_100009561 272
486 3300015265 Ga0182005_1000119 Ga0182005_100011939 272
487 3300021361 Ga0213872_10000136 Ga0213872_1000013627 272
488 3300025250 Ga0209026_1007384 Ga0209026_10073842 272
489 3300025284 Ga0209130_1000016 Ga0209130_1000016273 272
490 3300037312 Ga0395899_0000581 Ga0395899_0000581_16800_17627 272
491 3300039447 Ga0436361_0954756 Ga0436361_0954756_34962_35792 272
492 3300044683 Ga0466965_0142610 Ga0466965_0142610_275_1102 272
493 3300044684 Ga0466966_0024130 Ga0466966_0024130_1405_2232 272
494 3300044719 Ga0466971_0043751 Ga0466971_0043751_412_1239 272
495 3300046453 Ga0495627_000004 Ga0495627_000004_27023_27847 272
496 3300046501 Ga0495607_0001066 Ga0495607_0001066_18605_19438 272
497 3300046519 Ga0495632_0051920 Ga0495632_0051920_103_927 272
498 3300046523 Ga0495644_0008954 Ga0495644_0008954_131_955 272
499 3300046530 Ga0495654_0008231 Ga0495654_0008231_1083_1919 272
500 3300046538 Ga0495609_0001180 Ga0495609_0001180_5241_6065 272
501 3300046557 Ga0495622_0004798 Ga0495622_0004798_3955_4860 272
502 3300046558 Ga0495633_0000131 Ga0495633_0000131_39673_40494 272
503 3300046558 Ga0495633_0001499 Ga0495633_0001499_14427_15263 272
504 3300046810 Ga0495660_0003889 Ga0495660_0003889_2710_3534 272
505 3300046810 Ga0495660_0004915 Ga0495660_0004915_4301_5125 272
506 3300046810 Ga0495660_0005172 Ga0495660_0005172_2705_3529 272
507 3300047320 Ga0495672_0000019 Ga0495672_0000019_382715_383539 272
508 3300047323 Ga0495683_0012988 Ga0495683_0012988_734_1552 272
509 3300047470 Ga0495681_0000895 Ga0495681_0000895_15836_16660 272
510 3300047472 Ga0495686_0148759 Ga0495686_0148759_138_962 272
511 3300048924 Ga0496121_0003403 Ga0496121_0003403_371_1210 272
512 3300048924 Ga0496121_0013110 Ga0496121_0013110_5755_6594 272
513 3300048927 Ga0496124_0018943 Ga0496124_0018943_1962_2786 272
514 3300049459 Ga0495678_000027 Ga0495678_000027_169735_170559 272
515 3300049459 Ga0495678_002046 Ga0495678_002046_4917_5735 272
516 3300049459 Ga0495678_010529 Ga0495678_010529_2570_3421 272
517 3300049460 Ga0495682_0008184 Ga0495682_0008184_2491_3327 272
518 3300061719 Ga0466962_0040270 Ga0466962_0040270_1384_2211 272
519 iso_pu_bacteria 2932410948 2932415597 272
520 iso_pu_bacteria 2932416698 2932421587 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09296

NUDIX-like

NADH pyrophosphatase-like rudimentary NUDIX domain

52

145

0.95

PF09297

zf-NADH-PPase

NADH pyrophosphatase zinc ribbon domain

147

178

0.95

PF00293

NUDIX

NUDIX domain

180

301

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h95-assembly1.cif.gz_A-2 crystal structure of the nudix domain of nudt6 0.8928 148 248
3oga-assembly1.cif.gz_B 1.75 angstrom resolution crystal structure of a putative ntp pyrophosphohydrolase (yfao) from salmonella typhimurium lt2 0.8708 144 247
5zrl-assembly2.cif.gz_B m. smegmatis antimutator protein mutt2 in complex with cdp 0.8629 145 247
4v14-assembly2.cif.gz_B structure and function analysis of mutt from the psychrofile fish pathogen aliivibrio salmonicida and the mesophile vibrio cholerae 0.8568 146 245
5zrc-assembly1.cif.gz_A structural insights into the catalysis mechanism of m. smegmatis antimutator protein mutt2 0.8553 146 247
ID Description Score Start End Superfamily
2gb5A02 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9334 144 267 3.90.79.10
af_Q94A82_242_424_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9257 144 247 3.90.79.10
af_Q9VXR9_162_296_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9172 148 243 3.90.79.10
af_P9WIX5_169_312_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.915 144 247 3.90.79.10
af_I1MUA9_246_385_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9116 144 245 3.90.79.10
ID Description Score Start End GO Terms
AF-B0NM59-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9473 152 256 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872
AF-R5VE62-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.945 162 266 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872
AF-A0A4Q6CQ37-F1-model_v4 deleted 0.9412 145 267
AF-A0A351DPT9-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9403 147 267 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
AF-B0NM59-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.93 152 256 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.42 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map