F458534
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 520 | 338 | 508 | 278 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10034644|Ga0105248_100346446 |
| Length | 312 |
| Sequence | LNEAGATFQPNRASAAACHVAKHITAASWMIKYRMSDEYQPLVTGPAERNEPALWFAFHRGELLIARVDDEASLPHCHDLADLGLNSVRNLYLGTYAGKHCYVSELEHADELPHGHEMHGLRAVFGLVDETLAALAGRAFQIIEWDRNHQYCSRCGTATVPRSEERARACPKCRFTIYPPVSPAIMILIKRGREVLLGRKKEWAPGRYSALAGFVEPGETLEQTVRRETREEVGVEVDNIRYFGSQPWPFPHSLMIAFTADYAGGDVRPDGIEIEEARFFDAEQLPHLPPSISISRRLIVSVCGKLSRGEAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 2 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 3 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 4 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 5 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 6 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 7 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 8 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 9 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 10 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 11 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 12 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 13 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 177 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 205 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 221 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 222 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 223 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 224 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 225 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 229 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 298 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 299 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 302 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 303 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 304 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 305 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 306 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 325 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 327 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.69 |
| Metatranscriptomes | 0 |
| Isolates | 2.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.5 |
| Nodule | 0.19 |
| Rhizoplane | 3.27 |
| Rhizosphere | 89.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1000292 | 3300002987 | Bacteria | 23475 |
| 2 | rootL2_10025805 | 3300003322 | Bacteria | 9341 |
| 3 | rootL2_10076289 | 3300003322 | Bacteria | 9441 |
| 4 | Ga0055529_1000274 | 3300003763 | Bacteria | 61422 |
| 5 | Ga0055526_1000076 | 3300003771 | Bacteria | 92438 |
| 6 | Ga0055543_1005921 | 3300004625 | Bacteria | 3043 |
| 7 | Ga0065165_1000167 | 3300005262 | Bacteria | 115630 |
| 8 | Ga0070658_10083012 | 3300005327 | Bacteria | 2633 |
| 9 | Ga0070676_10089642 | 3300005328 | Bacteria | 1881 |
| 10 | Ga0070683_100001621 | 3300005329 | Bacteria | 17400 |
| 11 | Ga0070690_100004185 | 3300005330 | Bacteria | 7987 |
| 12 | Ga0070690_100337585 | 3300005330 | Bacteria | 1090 |
| 13 | Ga0070670_100039804 | 3300005331 | Bacteria | 4042 |
| 14 | Ga0070670_100104226 | 3300005331 | Bacteria | 2443 |
| 15 | Ga0070677_10009192 | 3300005333 | Bacteria | 3349 |
| 16 | Ga0068869_100161704 | 3300005334 | Bacteria | 1743 |
| 17 | Ga0068869_100256068 | 3300005334 | Bacteria | 1400 |
| 18 | Ga0070666_10312291 | 3300005335 | Bacteria | 1120 |
| 19 | Ga0070680_100028049 | 3300005336 | Bacteria | 4514 |
| 20 | Ga0070680_100107457 | 3300005336 | Bacteria | 2321 |
| 21 | Ga0068868_100000336 | 3300005338 | Bacteria | 31703 |
| 22 | Ga0068868_100021111 | 3300005338 | Bacteria | 4903 |
| 23 | Ga0070660_100020748 | 3300005339 | Bacteria | 4835 |
| 24 | Ga0070660_100108327 | 3300005339 | Bacteria | 2208 |
| 25 | Ga0070689_100003440 | 3300005340 | Bacteria | 10534 |
| 26 | Ga0070689_100091797 | 3300005340 | Bacteria | 2394 |
| 27 | Ga0070661_100001915 | 3300005344 | Bacteria | 14406 |
| 28 | Ga0070661_100012702 | 3300005344 | Bacteria | 5893 |
| 29 | Ga0070661_100257078 | 3300005344 | Bacteria | 1349 |
| 30 | Ga0070692_10042264 | 3300005345 | Bacteria | 2340 |
| 31 | Ga0070692_10189174 | 3300005345 | Bacteria | 1198 |
| 32 | Ga0070669_100088704 | 3300005353 | Bacteria | 2315 |
| 33 | Ga0070675_100000564 | 3300005354 | Bacteria | 25558 |
| 34 | Ga0070675_100167645 | 3300005354 | Bacteria | 1892 |
| 35 | Ga0070675_100475550 | 3300005354 | Bacteria | 1123 |
| 36 | Ga0070671_100003077 | 3300005355 | Bacteria | 12974 |
| 37 | Ga0070671_100018740 | 3300005355 | Bacteria | 5625 |
| 38 | Ga0070674_100024796 | 3300005356 | Bacteria | 3896 |
| 39 | Ga0070674_100041651 | 3300005356 | Bacteria | 3114 |
| 40 | Ga0070674_100101034 | 3300005356 | Bacteria | 2101 |
| 41 | Ga0070673_100000875 | 3300005364 | Bacteria | 16956 |
| 42 | Ga0070673_100006346 | 3300005364 | Bacteria | 7682 |
| 43 | Ga0070688_100001476 | 3300005365 | Bacteria | 11687 |
| 44 | Ga0070667_100074487 | 3300005367 | Bacteria | 2896 |
| 45 | Ga0070667_100084604 | 3300005367 | Bacteria | 2719 |
| 46 | Ga0070667_100305329 | 3300005367 | Bacteria | 1433 |
| 47 | Ga0070713_100010713 | 3300005436 | Bacteria | 6637 |
| 48 | Ga0070710_10030424 | 3300005437 | Bacteria | 2905 |
| 49 | Ga0070710_10224907 | 3300005437 | Bacteria | 1196 |
| 50 | Ga0070711_100005372 | 3300005439 | Bacteria | 7662 |
| 51 | Ga0070711_100044700 | 3300005439 | Bacteria | 3007 |
| 52 | Ga0070705_100037941 | 3300005440 | Bacteria | 2721 |
| 53 | Ga0070700_100052290 | 3300005441 | Bacteria | 2546 |
| 54 | Ga0070694_100316440 | 3300005444 | Bacteria | 1200 |
| 55 | Ga0070708_100106539 | 3300005445 | Bacteria | 2573 |
| 56 | Ga0070708_100169654 | 3300005445 | Bacteria | 2037 |
| 57 | Ga0070678_100012547 | 3300005456 | Bacteria | 5275 |
| 58 | Ga0070678_100085385 | 3300005456 | Bacteria | 2405 |
| 59 | Ga0070662_100014505 | 3300005457 | Bacteria | 5268 |
| 60 | Ga0070662_100044909 | 3300005457 | Bacteria | 3168 |
| 61 | Ga0070662_100062130 | 3300005457 | Bacteria | 2728 |
| 62 | Ga0070681_10001301 | 3300005458 | Bacteria | 21770 |
| 63 | Ga0070681_10013173 | 3300005458 | Bacteria | 8215 |
| 64 | Ga0070681_10271553 | 3300005458 | Bacteria | 1607 |
| 65 | Ga0068867_100212065 | 3300005459 | Bacteria | 1556 |
| 66 | Ga0068867_100532730 | 3300005459 | Bacteria | 1014 |
| 67 | Ga0070685_10002559 | 3300005466 | Bacteria | 9310 |
| 68 | Ga0070685_10012889 | 3300005466 | Bacteria | 4400 |
| 69 | Ga0070706_100022137 | 3300005467 | Bacteria | 5852 |
| 70 | Ga0070706_100073147 | 3300005467 | Bacteria | 3172 |
| 71 | Ga0070706_100318241 | 3300005467 | Bacteria | 1451 |
| 72 | Ga0070707_100012605 | 3300005468 | Bacteria | 7896 |
| 73 | Ga0070679_100038960 | 3300005530 | Bacteria | 4725 |
| 74 | Ga0070684_100011627 | 3300005535 | Bacteria | 7015 |
| 75 | Ga0070697_100029924 | 3300005536 | Bacteria | 4372 |
| 76 | Ga0068853_100015122 | 3300005539 | Bacteria | 6345 |
| 77 | Ga0070672_100085290 | 3300005543 | Bacteria | 2538 |
| 78 | Ga0070672_100245026 | 3300005543 | Bacteria | 1508 |
| 79 | Ga0070686_100173031 | 3300005544 | Bacteria | 1529 |
| 80 | Ga0070693_100054312 | 3300005547 | Bacteria | 2303 |
| 81 | Ga0070693_100096228 | 3300005547 | Bacteria | 1794 |
| 82 | Ga0070665_100016607 | 3300005548 | Bacteria | 7378 |
| 83 | Ga0070665_100083752 | 3300005548 | Bacteria | 3194 |
| 84 | Ga0070665_100123897 | 3300005548 | Bacteria | 2586 |
| 85 | Ga0070704_100023891 | 3300005549 | Bacteria | 4002 |
| 86 | Ga0070704_100027628 | 3300005549 | Bacteria | 3766 |
| 87 | Ga0068855_100031145 | 3300005563 | Bacteria | 6371 |
| 88 | Ga0068855_100410031 | 3300005563 | Bacteria | 1484 |
| 89 | Ga0068855_100481382 | 3300005563 | Bacteria | 1351 |
| 90 | Ga0070664_100003688 | 3300005564 | Bacteria | 12350 |
| 91 | Ga0070664_100274558 | 3300005564 | Unclassified | 1519 |
| 92 | Ga0068854_100009287 | 3300005578 | Bacteria | 6346 |
| 93 | Ga0068854_100128376 | 3300005578 | Bacteria | 1933 |
| 94 | Ga0068856_100422171 | 3300005614 | Bacteria | 1353 |
| 95 | Ga0070702_100024968 | 3300005615 | Bacteria | 3196 |
| 96 | Ga0070702_100126987 | 3300005615 | Bacteria | 1605 |
| 97 | Ga0068852_100000411 | 3300005616 | Bacteria | 28617 |
| 98 | Ga0068852_100050265 | 3300005616 | Bacteria | 3571 |
| 99 | Ga0068852_100113163 | 3300005616 | Bacteria | 2471 |
| 100 | Ga0068852_100406739 | 3300005616 | Bacteria | 1340 |
| 101 | Ga0068859_100005320 | 3300005617 | Bacteria | 13086 |
| 102 | Ga0068864_100009675 | 3300005618 | Bacteria | 7953 |
| 103 | Ga0068864_100025682 | 3300005618 | Bacteria | 4963 |
| 104 | Ga0068866_10003879 | 3300005718 | Bacteria | 6134 |
| 105 | Ga0068866_10006338 | 3300005718 | Bacteria | 4922 |
| 106 | Ga0068861_100028641 | 3300005719 | Bacteria | 4065 |
| 107 | Ga0068851_10011794 | 3300005834 | Bacteria | 4106 |
| 108 | Ga0068870_10030072 | 3300005840 | Bacteria | 2743 |
| 109 | Ga0068863_100012501 | 3300005841 | Bacteria | 8193 |
| 110 | Ga0068863_100108615 | 3300005841 | Bacteria | 2640 |
| 111 | Ga0068858_100007450 | 3300005842 | Bacteria | 10579 |
| 112 | Ga0068858_100182222 | 3300005842 | Bacteria | 1983 |
| 113 | Ga0068858_100272909 | 3300005842 | Bacteria | 1609 |
| 114 | Ga0068860_100142352 | 3300005843 | Bacteria | 2305 |
| 115 | Ga0068860_100341454 | 3300005843 | Bacteria | 1472 |
| 116 | Ga0068862_100020456 | 3300005844 | Bacteria | 5529 |
| 117 | Ga0070717_10012658 | 3300006028 | Bacteria | 6438 |
| 118 | Ga0070715_10008238 | 3300006163 | Bacteria | 3625 |
| 119 | Ga0070712_100042826 | 3300006175 | Bacteria | 3114 |
| 120 | Ga0075362_10089949 | 3300006177 | Bacteria | 1424 |
| 121 | Ga0075366_10002856 | 3300006195 | Bacteria | 8951 |
| 122 | Ga0097621_100000527 | 3300006237 | Bacteria | 26821 |
| 123 | Ga0097621_100293778 | 3300006237 | Bacteria | 1433 |
| 124 | Ga0068871_100000363 | 3300006358 | Bacteria | 31624 |
| 125 | Ga0068871_100301128 | 3300006358 | Bacteria | 1407 |
| 126 | Ga0075428_100003410 | 3300006844 | Bacteria | 17382 |
| 127 | Ga0075430_100159084 | 3300006846 | Bacteria | 1881 |
| 128 | Ga0075434_100347527 | 3300006871 | Bacteria | 1504 |
| 129 | Ga0075429_100003762 | 3300006880 | Bacteria | 12935 |
| 130 | Ga0068865_100441169 | 3300006881 | Bacteria | 1074 |
| 131 | Ga0097620_100005321 | 3300006931 | Bacteria | 13086 |
| 132 | Ga0075435_100044922 | 3300007076 | Bacteria | 3540 |
| 133 | Ga0105240_10005056 | 3300009093 | Bacteria | 19777 |
| 134 | Ga0105240_10673322 | 3300009093 | Bacteria | 1132 |
| 135 | Ga0111539_10004728 | 3300009094 | Bacteria | 17792 |
| 136 | Ga0111539_10229405 | 3300009094 | Bacteria | 2162 |
| 137 | Ga0111539_10350038 | 3300009094 | Bacteria | 1719 |
| 138 | Ga0111539_10733169 | 3300009094 | Bacteria | 1150 |
| 139 | Ga0111539_10872624 | 3300009094 | Bacteria | 1047 |
| 140 | Ga0105245_10010977 | 3300009098 | Bacteria | 7883 |
| 141 | Ga0105245_10028483 | 3300009098 | Bacteria | 4928 |
| 142 | Ga0105245_10338416 | 3300009098 | Bacteria | 1487 |
| 143 | Ga0114129_10276391 | 3300009147 | Bacteria | 2245 |
| 144 | Ga0105243_10043528 | 3300009148 | Bacteria | 3519 |
| 145 | Ga0105243_10067884 | 3300009148 | Bacteria | 2872 |
| 146 | Ga0105242_10000761 | 3300009176 | Bacteria | 25021 |
| 147 | Ga0105242_10235976 | 3300009176 | Bacteria | 1641 |
| 148 | Ga0105248_10034644 | 3300009177 | Bacteria | 5648 |
| 149 | Ga0105248_10096402 | 3300009177 | Bacteria | 3332 |
| 150 | Ga0105248_10215493 | 3300009177 | Bacteria | 2163 |
| 151 | Ga0105248_10331638 | 3300009177 | Bacteria | 1713 |
| 152 | Ga0105237_10000784 | 3300009545 | Bacteria | 43457 |
| 153 | Ga0105237_10364003 | 3300009545 | Bacteria | 1450 |
| 154 | Ga0105239_10001759 | 3300010375 | Bacteria | 28533 |
| 155 | Ga0157373_10132673 | 3300013100 | Bacteria | 1751 |
| 156 | Ga0157370_10021795 | 3300013104 | Bacteria | 6382 |
| 157 | Ga0157369_10158841 | 3300013105 | Bacteria | 2387 |
| 158 | Ga0157374_10001418 | 3300013296 | Bacteria | 20316 |
| 159 | Ga0157374_10004313 | 3300013296 | Bacteria | 11963 |
| 160 | Ga0157374_10059270 | 3300013296 | Bacteria | 3579 |
| 161 | Ga0157378_10002277 | 3300013297 | Bacteria | 17044 |
| 162 | Ga0157378_10027667 | 3300013297 | Bacteria | 5001 |
| 163 | Ga0157378_10139239 | 3300013297 | Bacteria | 2252 |
| 164 | Ga0157378_10543121 | 3300013297 | Bacteria | 1166 |
| 165 | Ga0163162_10036018 | 3300013306 | Bacteria | 4930 |
| 166 | Ga0163162_10036062 | 3300013306 | Bacteria | 4928 |
| 167 | Ga0163162_10118801 | 3300013306 | Bacteria | 2746 |
| 168 | Ga0157372_10049918 | 3300013307 | Bacteria | 4654 |
| 169 | Ga0157372_10273770 | 3300013307 | Bacteria | 1962 |
| 170 | Ga0157375_10080856 | 3300013308 | Bacteria | 3288 |
| 171 | Ga0157375_10082886 | 3300013308 | Bacteria | 3250 |
| 172 | Ga0163163_10004197 | 3300014325 | Bacteria | 12275 |
| 173 | Ga0163163_10421357 | 3300014325 | Bacteria | 1394 |
| 174 | Ga0157380_10097868 | 3300014326 | Bacteria | 2436 |
| 175 | Ga0157380_10288881 | 3300014326 | Bacteria | 1505 |
| 176 | Ga0182008_10002644 | 3300014497 | Bacteria | 11121 |
| 177 | Ga0157377_10012518 | 3300014745 | Bacteria | 4269 |
| 178 | Ga0157379_10035731 | 3300014968 | Bacteria | 4430 |
| 179 | Ga0157379_10049300 | 3300014968 | Bacteria | 3759 |
| 180 | Ga0157376_10059009 | 3300014969 | Bacteria | 3217 |
| 181 | Ga0157376_10069103 | 3300014969 | Bacteria | 2993 |
| 182 | Ga0182006_1000095 | 3300015261 | Bacteria | 105469 |
| 183 | Ga0182007_10000063 | 3300015262 | Bacteria | 87093 |
| 184 | Ga0182005_1000057 | 3300015265 | Bacteria | 104753 |
| 185 | Ga0182005_1000119 | 3300015265 | Bacteria | 57192 |
| 186 | Ga0163161_10025124 | 3300017792 | Bacteria | 4214 |
| 187 | Ga0163161_10030211 | 3300017792 | Bacteria | 3854 |
| 188 | Ga0163161_10055751 | 3300017792 | Bacteria | 2869 |
| 189 | Ga0163161_10163575 | 3300017792 | Bacteria | 1698 |
| 190 | Ga0213872_10000136 | 3300021361 | Bacteria | 66682 |
| 191 | Ga0213872_10001253 | 3300021361 | Bacteria | 17099 |
| 192 | Ga0209437_106638 | 3300025233 | Bacteria | 1918 |
| 193 | Ga0209026_1007384 | 3300025250 | Bacteria | 2488 |
| 194 | Ga0209455_1000253 | 3300025272 | Bacteria | 62650 |
| 195 | Ga0209130_1000016 | 3300025284 | Bacteria | 395540 |
| 196 | Ga0209564_1000042 | 3300025295 | Bacteria | 392805 |
| 197 | Ga0207697_10006613 | 3300025315 | Bacteria | 5229 |
| 198 | Ga0207656_10018386 | 3300025321 | Bacteria | 2752 |
| 199 | Ga0207682_10005908 | 3300025893 | Bacteria | 4956 |
| 200 | Ga0207642_10016912 | 3300025899 | Bacteria | 2761 |
| 201 | Ga0207642_10120109 | 3300025899 | Bacteria | 1354 |
| 202 | Ga0207688_10096438 | 3300025901 | Bacteria | 1703 |
| 203 | Ga0207680_10004468 | 3300025903 | Bacteria | 6636 |
| 204 | Ga0207685_10011454 | 3300025905 | Bacteria | 2666 |
| 205 | Ga0207699_10065245 | 3300025906 | Bacteria | 2206 |
| 206 | Ga0207699_10144903 | 3300025906 | Bacteria | 1565 |
| 207 | Ga0207645_10037093 | 3300025907 | Bacteria | 3129 |
| 208 | Ga0207643_10010215 | 3300025908 | Bacteria | 5050 |
| 209 | Ga0207643_10016761 | 3300025908 | Bacteria | 3998 |
| 210 | Ga0207707_10003985 | 3300025912 | Bacteria | 13110 |
| 211 | Ga0207707_10046321 | 3300025912 | Bacteria | 3787 |
| 212 | Ga0207707_10153308 | 3300025912 | Bacteria | 2014 |
| 213 | Ga0207695_10010612 | 3300025913 | Bacteria | 11257 |
| 214 | Ga0207671_10009892 | 3300025914 | Bacteria | 7927 |
| 215 | Ga0207693_10007619 | 3300025915 | Bacteria | 8892 |
| 216 | Ga0207693_10009659 | 3300025915 | Bacteria | 7855 |
| 217 | Ga0207663_10091705 | 3300025916 | Bacteria | 2018 |
| 218 | Ga0207660_10029769 | 3300025917 | Bacteria | 3749 |
| 219 | Ga0207660_10309505 | 3300025917 | Bacteria | 1259 |
| 220 | Ga0207657_10003387 | 3300025919 | Bacteria | 17050 |
| 221 | Ga0207649_10209166 | 3300025920 | Bacteria | 1383 |
| 222 | Ga0207652_10009203 | 3300025921 | Bacteria | 7950 |
| 223 | Ga0207646_10013719 | 3300025922 | Bacteria | 7737 |
| 224 | Ga0207650_10002371 | 3300025925 | Bacteria | 13104 |
| 225 | Ga0207650_10042488 | 3300025925 | Bacteria | 3335 |
| 226 | Ga0207659_10000462 | 3300025926 | Bacteria | 24409 |
| 227 | Ga0207687_10003283 | 3300025927 | Bacteria | 10945 |
| 228 | Ga0207664_10038283 | 3300025929 | Bacteria | 3718 |
| 229 | Ga0207644_10002291 | 3300025931 | Bacteria | 12422 |
| 230 | Ga0207644_10009296 | 3300025931 | Bacteria | 6451 |
| 231 | Ga0207644_10190225 | 3300025931 | Bacteria | 1613 |
| 232 | Ga0207706_10001466 | 3300025933 | Bacteria | 23574 |
| 233 | Ga0207706_10031760 | 3300025933 | Bacteria | 4703 |
| 234 | Ga0207706_10034962 | 3300025933 | Bacteria | 4470 |
| 235 | Ga0207706_10140687 | 3300025933 | Bacteria | 2123 |
| 236 | Ga0207706_10169081 | 3300025933 | Bacteria | 1921 |
| 237 | Ga0207686_10000798 | 3300025934 | Bacteria | 19304 |
| 238 | Ga0207686_10016946 | 3300025934 | Bacteria | 4095 |
| 239 | Ga0207709_10035265 | 3300025935 | Bacteria | 2956 |
| 240 | Ga0207670_10014043 | 3300025936 | Bacteria | 4742 |
| 241 | Ga0207670_10044747 | 3300025936 | Bacteria | 2930 |
| 242 | Ga0207669_10007150 | 3300025937 | Bacteria | 5141 |
| 243 | Ga0207669_10124630 | 3300025937 | Bacteria | 1757 |
| 244 | Ga0207669_10271241 | 3300025937 | Bacteria | 1274 |
| 245 | Ga0207665_10038353 | 3300025939 | Bacteria | 3190 |
| 246 | Ga0207665_10068565 | 3300025939 | Unclassified | 2417 |
| 247 | Ga0207691_10000513 | 3300025940 | Bacteria | 38489 |
| 248 | Ga0207691_10047706 | 3300025940 | Bacteria | 3930 |
| 249 | Ga0207691_10059321 | 3300025940 | Bacteria | 3480 |
| 250 | Ga0207711_10002829 | 3300025941 | Bacteria | 15246 |
| 251 | Ga0207711_10057235 | 3300025941 | Bacteria | 3352 |
| 252 | Ga0207689_10045180 | 3300025942 | Bacteria | 3643 |
| 253 | Ga0207689_10117926 | 3300025942 | Bacteria | 2183 |
| 254 | Ga0207661_10026593 | 3300025944 | Bacteria | 4411 |
| 255 | Ga0207661_10059378 | 3300025944 | Bacteria | 3082 |
| 256 | Ga0207667_10019744 | 3300025949 | Bacteria | 7513 |
| 257 | Ga0207667_10498883 | 3300025949 | Bacteria | 1235 |
| 258 | Ga0207667_10647419 | 3300025949 | Bacteria | 1062 |
| 259 | Ga0207651_10001059 | 3300025960 | Bacteria | 12186 |
| 260 | Ga0207651_10003258 | 3300025960 | Bacteria | 7947 |
| 261 | Ga0207640_10001436 | 3300025981 | Bacteria | 12896 |
| 262 | Ga0207658_10272168 | 3300025986 | Bacteria | 1448 |
| 263 | Ga0207677_10000186 | 3300026023 | Bacteria | 49949 |
| 264 | Ga0207677_10000494 | 3300026023 | Bacteria | 25605 |
| 265 | Ga0207703_10003780 | 3300026035 | Bacteria | 12583 |
| 266 | Ga0207703_10065764 | 3300026035 | Bacteria | 2980 |
| 267 | Ga0207703_10088929 | 3300026035 | Bacteria | 2593 |
| 268 | Ga0207639_10022812 | 3300026041 | Bacteria | 4512 |
| 269 | Ga0207639_10279203 | 3300026041 | Bacteria | 1468 |
| 270 | Ga0207639_10623637 | 3300026041 | Bacteria | 996 |
| 271 | Ga0207708_10008241 | 3300026075 | Bacteria | 7720 |
| 272 | Ga0207641_10007033 | 3300026088 | Bacteria | 9401 |
| 273 | Ga0207641_10478676 | 3300026088 | Bacteria | 1206 |
| 274 | Ga0207641_10646466 | 3300026088 | Bacteria | 1038 |
| 275 | Ga0207641_10681774 | 3300026088 | Bacteria | 1011 |
| 276 | Ga0207648_10008515 | 3300026089 | Bacteria | 9927 |
| 277 | Ga0207648_10061631 | 3300026089 | Bacteria | 3271 |
| 278 | Ga0207676_10000455 | 3300026095 | Bacteria | 34474 |
| 279 | Ga0207676_10025071 | 3300026095 | Bacteria | 4422 |
| 280 | Ga0207676_10567972 | 3300026095 | Bacteria | 1086 |
| 281 | Ga0207674_10006719 | 3300026116 | Bacteria | 13503 |
| 282 | Ga0207675_100017014 | 3300026118 | Bacteria | 6794 |
| 283 | Ga0207683_10000673 | 3300026121 | Bacteria | 31320 |
| 284 | Ga0207683_10000768 | 3300026121 | Bacteria | 29179 |
| 285 | Ga0207683_10020193 | 3300026121 | Bacteria | 5695 |
| 286 | Ga0207698_10004774 | 3300026142 | Bacteria | 8295 |
| 287 | Ga0209281_1019255 | 3300027111 | Bacteria | 1351 |
| 288 | Ga0209969_1000695 | 3300027360 | Bacteria | 4512 |
| 289 | Ga0210000_1000104 | 3300027462 | Bacteria | 11765 |
| 290 | Ga0209971_1008430 | 3300027682 | Bacteria | 2445 |
| 291 | Ga0209974_10013981 | 3300027876 | Bacteria | 2674 |
| 292 | Ga0207428_10057470 | 3300027907 | Bacteria | 3088 |
| 293 | Ga0268266_10023237 | 3300028379 | Bacteria | 5279 |
| 294 | Ga0268264_10005450 | 3300028381 | Bacteria | 10781 |
| 295 | Ga0268264_10257767 | 3300028381 | Bacteria | 1623 |
| 296 | Ga0265318_10007718 | 3300028577 | Bacteria | 4839 |
| 297 | Ga0265322_10002161 | 3300028654 | Bacteria | 6115 |
| 298 | Ga0307515_10002662 | 3300028794 | Bacteria | 38277 |
| 299 | Ga0307515_10013586 | 3300028794 | Bacteria | 15194 |
| 300 | Ga0265338_10350667 | 3300028800 | Bacteria | 1061 |
| 301 | Ga0265330_10002766 | 3300031235 | Bacteria | 9428 |
| 302 | Ga0265330_10004578 | 3300031235 | Bacteria | 6999 |
| 303 | Ga0265332_10090429 | 3300031238 | Bacteria | 1295 |
| 304 | Ga0265320_10030095 | 3300031240 | Bacteria | 2804 |
| 305 | Ga0265325_10149005 | 3300031241 | Bacteria | 1108 |
| 306 | Ga0265329_10006099 | 3300031242 | Bacteria | 4810 |
| 307 | Ga0265331_10014337 | 3300031250 | Bacteria | 4225 |
| 308 | Ga0265316_10002434 | 3300031344 | Bacteria | 19339 |
| 309 | Ga0265316_10014225 | 3300031344 | Bacteria | 7019 |
| 310 | Ga0307408_100182014 | 3300031548 | Bacteria | 1686 |
| 311 | Ga0265314_10001567 | 3300031711 | Bacteria | 25135 |
| 312 | Ga0265342_10000164 | 3300031712 | Bacteria | 74148 |
| 313 | Ga0307518_10017880 | 3300031838 | Bacteria | 5080 |
| 314 | Ga0307410_10363279 | 3300031852 | Bacteria | 1160 |
| 315 | Ga0307412_10151041 | 3300031911 | Bacteria | 1714 |
| 316 | Ga0307416_100455130 | 3300032002 | Bacteria | 1333 |
| 317 | Ga0307414_10059886 | 3300032004 | Bacteria | 2690 |
| 318 | Ga0307411_10106640 | 3300032005 | Bacteria | 1995 |
| 319 | Ga0373926_0042697 | 3300035083 | Bacteria | 1622 |
| 320 | Ga0373934_0007287 | 3300035086 | Bacteria | 4102 |
| 321 | Ga0373944_0018506 | 3300035089 | Bacteria | 1990 |
| 322 | Ga0373945_0005115 | 3300035116 | Bacteria | 4186 |
| 323 | Ga0373945_0122748 | 3300035116 | Bacteria | 1034 |
| 324 | Ga0373954_0004273 | 3300035118 | Bacteria | 6139 |
| 325 | Ga0373946_0043551 | 3300035171 | Bacteria | 1850 |
| 326 | Ga0373955_0002610 | 3300035172 | Bacteria | 7881 |
| 327 | Ga0373955_0187388 | 3300035172 | Unclassified | 1229 |
| 328 | Ga0373924_0004132 | 3300035410 | Bacteria | 5051 |
| 329 | Ga0373924_0042803 | 3300035410 | Bacteria | 1858 |
| 330 | Ga0373935_0030436 | 3300035692 | Bacteria | 3346 |
| 331 | Ga0373935_0092215 | 3300035692 | Bacteria | 1984 |
| 332 | Ga0373927_0024392 | 3300035695 | Bacteria | 3956 |
| 333 | Ga0373927_0054838 | 3300035695 | Bacteria | 2578 |
| 334 | Ga0373933_0073644 | 3300035724 | Bacteria | 2081 |
| 335 | Ga0373947_0101461 | 3300035725 | Bacteria | 1809 |
| 336 | Ga0373937_0072701 | 3300036401 | Bacteria | 3172 |
| 337 | Ga0373937_0712766 | 3300036401 | Bacteria | 950 |
| 338 | Ga0373925_0004171 | 3300037068 | Bacteria | 10967 |
| 339 | Ga0373925_0068247 | 3300037068 | Bacteria | 2683 |
| 340 | Ga0373925_0218087 | 3300037068 | Bacteria | 1522 |
| 341 | Ga0395899_0000581 | 3300037312 | Bacteria | 38482 |
| 342 | Ga0395898_0868893 | 3300037466 | Bacteria | 841 |
| 343 | Ga0436361_0313546 | 3300039447 | Bacteria | 35556 |
| 344 | Ga0436361_0500164 | 3300039447 | Bacteria | 28968 |
| 345 | Ga0436361_0954756 | 3300039447 | Bacteria | 64588 |
| 346 | Ga0451853_0810706 | 3300041512 | Bacteria | 2474 |
| 347 | Ga0439431_0003490 | 3300041997 | Bacteria | 3464 |
| 348 | Ga0439458_0023339 | 3300042157 | Bacteria | 1442 |
| 349 | Ga0450909_018943 | 3300042185 | Bacteria | 1024 |
| 350 | Ga0466972_0001085 | 3300044658 | Bacteria | 13048 |
| 351 | Ga0466965_0039188 | 3300044683 | Bacteria | 2329 |
| 352 | Ga0466965_0142610 | 3300044683 | Bacteria | 1248 |
| 353 | Ga0466966_0024130 | 3300044684 | Bacteria | 3980 |
| 354 | Ga0466971_0043751 | 3300044719 | Bacteria | 2012 |
| 355 | Ga0466957_0134257 | 3300044842 | Bacteria | 1589 |
| 356 | Ga0451576_0438606 | 3300045051 | Bacteria | 1371 |
| 357 | Ga0451576_0500000 | 3300045051 | Bacteria | 1277 |
| 358 | Ga0495617_000198 | 3300046452 | Bacteria | 37950 |
| 359 | Ga0495617_009638 | 3300046452 | Bacteria | 3312 |
| 360 | Ga0495627_000004 | 3300046453 | Bacteria | 640612 |
| 361 | Ga0495603_0271912 | 3300046455 | Bacteria | 975 |
| 362 | Ga0495590_0000056 | 3300046457 | Bacteria | 96913 |
| 363 | Ga0495629_0016725 | 3300046459 | Bacteria | 5263 |
| 364 | Ga0495638_0014336 | 3300046460 | Bacteria | 5364 |
| 365 | Ga0495651_0037178 | 3300046462 | Bacteria | 3790 |
| 366 | Ga0495653_0000066 | 3300046463 | Bacteria | 91671 |
| 367 | Ga0495653_0029585 | 3300046463 | Bacteria | 4371 |
| 368 | Ga0495650_0000528 | 3300046471 | Bacteria | 55706 |
| 369 | Ga0495650_0000571 | 3300046471 | Bacteria | 51694 |
| 370 | Ga0495650_0003944 | 3300046471 | Bacteria | 10456 |
| 371 | Ga0495650_0081294 | 3300046471 | Bacteria | 1248 |
| 372 | Ga0495580_0006193 | 3300046472 | Bacteria | 9783 |
| 373 | Ga0495580_0174970 | 3300046472 | Bacteria | 1483 |
| 374 | Ga0495639_0027360 | 3300046475 | Bacteria | 2523 |
| 375 | Ga0495662_0012895 | 3300046476 | Bacteria | 4072 |
| 376 | Ga0495664_0113648 | 3300046477 | Bacteria | 1635 |
| 377 | Ga0495585_0000646 | 3300046492 | Bacteria | 32025 |
| 378 | Ga0495594_0121897 | 3300046499 | Bacteria | 1474 |
| 379 | Ga0495607_0001066 | 3300046501 | Bacteria | 25057 |
| 380 | Ga0495606_0000063 | 3300046507 | Bacteria | 184610 |
| 381 | Ga0495606_0000180 | 3300046507 | Bacteria | 111330 |
| 382 | Ga0495610_0000014 | 3300046512 | Bacteria | 444708 |
| 383 | Ga0495610_0006277 | 3300046512 | Bacteria | 8229 |
| 384 | Ga0495630_0146367 | 3300046517 | Bacteria | 1797 |
| 385 | Ga0495632_0051920 | 3300046519 | Bacteria | 2017 |
| 386 | Ga0495637_0002419 | 3300046520 | Bacteria | 10313 |
| 387 | Ga0495643_0000133 | 3300046522 | Bacteria | 119563 |
| 388 | Ga0495644_0008954 | 3300046523 | Bacteria | 3850 |
| 389 | Ga0495648_0003987 | 3300046524 | Bacteria | 12776 |
| 390 | Ga0495642_0076118 | 3300046528 | Bacteria | 1409 |
| 391 | Ga0495654_0000014 | 3300046530 | Bacteria | 312126 |
| 392 | Ga0495654_0004348 | 3300046530 | Bacteria | 8429 |
| 393 | Ga0495654_0008231 | 3300046530 | Bacteria | 5772 |
| 394 | Ga0495654_0018401 | 3300046530 | Bacteria | 3662 |
| 395 | Ga0495665_0138328 | 3300046531 | Bacteria | 1273 |
| 396 | Ga0495586_0113220 | 3300046535 | Bacteria | 1511 |
| 397 | Ga0495609_0001180 | 3300046538 | Bacteria | 18046 |
| 398 | Ga0495621_0035243 | 3300046539 | Bacteria | 1732 |
| 399 | Ga0495621_0039453 | 3300046539 | Bacteria | 1651 |
| 400 | Ga0495645_0039072 | 3300046543 | Bacteria | 3461 |
| 401 | Ga0495622_0004798 | 3300046557 | Bacteria | 6262 |
| 402 | Ga0495633_0000131 | 3300046558 | Bacteria | 100408 |
| 403 | Ga0495633_0001499 | 3300046558 | Bacteria | 18101 |
| 404 | Ga0495656_0028756 | 3300046615 | Bacteria | 2232 |
| 405 | Ga0495668_0000152 | 3300046616 | Bacteria | 104716 |
| 406 | Ga0495668_0000636 | 3300046616 | Bacteria | 42184 |
| 407 | Ga0495668_0002746 | 3300046616 | Bacteria | 14081 |
| 408 | Ga0495634_0022935 | 3300046642 | Bacteria | 4395 |
| 409 | Ga0495635_0011193 | 3300046663 | Bacteria | 6289 |
| 410 | Ga0495659_0010388 | 3300046664 | Bacteria | 2986 |
| 411 | Ga0495588_0008252 | 3300046674 | Bacteria | 4770 |
| 412 | Ga0495657_0142557 | 3300046675 | Bacteria | 1493 |
| 413 | Ga0495623_0031724 | 3300046679 | Bacteria | 3397 |
| 414 | Ga0495647_0000713 | 3300046681 | Bacteria | 9888 |
| 415 | Ga0495669_0051531 | 3300046684 | Bacteria | 1848 |
| 416 | Ga0495613_0003774 | 3300046689 | Bacteria | 11353 |
| 417 | Ga0495671_0000005 | 3300046692 | Bacteria | 509397 |
| 418 | Ga0495671_0015822 | 3300046692 | Bacteria | 4037 |
| 419 | Ga0495660_0000923 | 3300046810 | Bacteria | 21621 |
| 420 | Ga0495660_0003889 | 3300046810 | Bacteria | 9130 |
| 421 | Ga0495660_0004915 | 3300046810 | Bacteria | 8051 |
| 422 | Ga0495660_0005172 | 3300046810 | Bacteria | 7834 |
| 423 | Ga0495581_0003828 | 3300047315 | Bacteria | 8653 |
| 424 | Ga0495604_0081568 | 3300047317 | Bacteria | 2421 |
| 425 | Ga0495604_0192796 | 3300047317 | Unclassified | 1419 |
| 426 | Ga0495672_0000019 | 3300047320 | Bacteria | 448153 |
| 427 | Ga0495676_0000031 | 3300047321 | Bacteria | 132364 |
| 428 | Ga0495683_0012988 | 3300047323 | Bacteria | 4363 |
| 429 | Ga0495683_0018449 | 3300047323 | Bacteria | 3608 |
| 430 | Ga0495673_0000009 | 3300047469 | Bacteria | 731993 |
| 431 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 432 | Ga0495673_0000146 | 3300047469 | Bacteria | 127378 |
| 433 | Ga0495681_0000895 | 3300047470 | Bacteria | 23009 |
| 434 | Ga0495684_0019481 | 3300047471 | Bacteria | 5225 |
| 435 | Ga0495686_0000332 | 3300047472 | Bacteria | 77832 |
| 436 | Ga0495686_0004668 | 3300047472 | Bacteria | 11120 |
| 437 | Ga0495686_0148759 | 3300047472 | Bacteria | 1376 |
| 438 | Ga0495686_0315466 | 3300047472 | Bacteria | 858 |
| 439 | Ga0495593_0013259 | 3300047673 | Bacteria | 4706 |
| 440 | Ga0495614_0009243 | 3300048089 | Bacteria | 4364 |
| 441 | Ga0496100_0024371 | 3300048903 | Bacteria | 3691 |
| 442 | Ga0496101_0176973 | 3300048904 | Bacteria | 1641 |
| 443 | Ga0496104_0003415 | 3300048907 | Bacteria | 13703 |
| 444 | Ga0496105_0004826 | 3300048908 | Bacteria | 10186 |
| 445 | Ga0496106_0364505 | 3300048909 | Bacteria | 1161 |
| 446 | Ga0496106_0365646 | 3300048909 | Bacteria | 1159 |
| 447 | Ga0496108_0253265 | 3300048911 | Bacteria | 1532 |
| 448 | Ga0496109_0001737 | 3300048912 | Bacteria | 18195 |
| 449 | Ga0496109_0041300 | 3300048912 | Bacteria | 4179 |
| 450 | Ga0496109_0238043 | 3300048912 | Bacteria | 1713 |
| 451 | Ga0496109_0302677 | 3300048912 | Bacteria | 1508 |
| 452 | Ga0496110_0029368 | 3300048913 | Bacteria | 4731 |
| 453 | Ga0496110_0329324 | 3300048913 | Bacteria | 1391 |
| 454 | Ga0496115_0035197 | 3300048918 | Bacteria | 3961 |
| 455 | Ga0496115_0167203 | 3300048918 | Bacteria | 1819 |
| 456 | Ga0496115_0178651 | 3300048918 | Bacteria | 1755 |
| 457 | Ga0496116_0056944 | 3300048919 | Bacteria | 2559 |
| 458 | Ga0496117_0000075 | 3300048920 | Bacteria | 232451 |
| 459 | Ga0496118_0000055 | 3300048921 | Bacteria | 232451 |
| 460 | Ga0496121_0003403 | 3300048924 | Bacteria | 22754 |
| 461 | Ga0496121_0013110 | 3300048924 | Bacteria | 8947 |
| 462 | Ga0496122_0000800 | 3300048925 | Bacteria | 60346 |
| 463 | Ga0496123_0006032 | 3300048926 | Bacteria | 11919 |
| 464 | Ga0496124_0018943 | 3300048927 | Bacteria | 6426 |
| 465 | Ga0496124_0060462 | 3300048927 | Bacteria | 3178 |
| 466 | Ga0496125_0135375 | 3300048928 | Bacteria | 1724 |
| 467 | Ga0496126_0058971 | 3300048929 | Bacteria | 3458 |
| 468 | Ga0495678_000027 | 3300049459 | Bacteria | 222075 |
| 469 | Ga0495678_002046 | 3300049459 | Bacteria | 14431 |
| 470 | Ga0495678_010529 | 3300049459 | Bacteria | 4490 |
| 471 | Ga0495682_0008184 | 3300049460 | Bacteria | 4130 |
| 472 | Ga0501034_0026205 | 3300049571 | Bacteria | 5937 |
| 473 | Ga0501034_0057097 | 3300049571 | Bacteria | 3925 |
| 474 | Ga0501040_0355071 | 3300049576 | Bacteria | 1050 |
| 475 | Ga0501041_0187250 | 3300049577 | Bacteria | 1296 |
| 476 | Ga0501042_0117513 | 3300049578 | Bacteria | 1914 |
| 477 | Ga0501043_0133618 | 3300049579 | Bacteria | 1944 |
| 478 | Ga0501047_0124228 | 3300049581 | Bacteria | 2461 |
| 479 | Ga0501067_0008963 | 3300049583 | Bacteria | 5546 |
| 480 | Ga0501069_0113752 | 3300049585 | Bacteria | 1543 |
| 481 | Ga0501070_0020725 | 3300049586 | Bacteria | 5514 |
| 482 | Ga0501073_0006495 | 3300049589 | Bacteria | 8700 |
| 483 | Ga0501076_0013438 | 3300049592 | Bacteria | 6142 |
| 484 | Ga0501249_004256 | 3300049679 | Bacteria | 2904 |
| 485 | Ga0501079_0021918 | 3300049741 | Bacteria | 4893 |
| 486 | Ga0501080_0001682 | 3300049742 | Bacteria | 18850 |
| 487 | Ga0501080_0444858 | 3300049742 | Bacteria | 1162 |
| 488 | Ga0501080_0446888 | 3300049742 | Unclassified | 1159 |
| 489 | Ga0501081_0002751 | 3300049743 | Bacteria | 11147 |
| 490 | Ga0501083_0040929 | 3300049744 | Bacteria | 3144 |
| 491 | Ga0501269_002882 | 3300049766 | Bacteria | 2096 |
| 492 | Ga0501045_0066747 | 3300049824 | Bacteria | 2641 |
| 493 | nmdc:mga0k408_15049_c1 | 3300050493 | Bacteria | 4276 |
| 494 | nmdc:mga05p37_528382_c1 | 3300050507 | Bacteria | 1348 |
| 495 | nmdc:mga09592_27897_c1 | 3300050508 | Bacteria | 4687 |
| 496 | nmdc:mga0qj67_167454_c1 | 3300050509 | Bacteria | 1784 |
| 497 | nmdc:mga08y16_1729_c1 | 3300050511 | Bacteria | 22150 |
| 498 | nmdc:mga08y16_31157_c1 | 3300050511 | Bacteria | 5611 |
| 499 | nmdc:mga08y16_96291_c1 | 3300050511 | Bacteria | 3082 |
| 500 | nmdc:mga0n895_334938_c1 | 3300050512 | Bacteria | 1533 |
| 501 | nmdc:mga0n895_789628_c1 | 3300050512 | Bacteria | 940 |
| 502 | nmdc:mga0rr50_230764_c1 | 3300050513 | Bacteria | 1531 |
| 503 | Ga0495601_0188329 | 3300053077 | Bacteria | 1349 |
| 504 | Ga0495595_0064302 | 3300053084 | Bacteria | 1724 |
| 505 | Ga0495619_0023531 | 3300053085 | Bacteria | 3950 |
| 506 | Ga0500586_036531 | 3300053145 | Bacteria | 1648 |
| 507 | Ga0501084_0037703 | 3300054114 | Bacteria | 4040 |
| 508 | Ga0466962_0040270 | 3300061719 | Bacteria | 2237 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037466 | Ga0395898_0868893 | Ga0395898_0868893_165_830 | 218 |
| 2 | 3300021361 | Ga0213872_10001253 | Ga0213872_100012536 | 233 |
| 3 | 3300005330 | Ga0070690_100337585 | Ga0070690_1003375851 | 239 |
| 4 | 3300046674 | Ga0495588_0008252 | Ga0495588_0008252_3484_4389 | 241 |
| 5 | 3300047321 | Ga0495676_0000031 | Ga0495676_0000031_20736_21641 | 241 |
| 6 | 3300047472 | Ga0495686_0004668 | Ga0495686_0004668_5864_6667 | 248 |
| 7 | 3300025940 | Ga0207691_10059321 | Ga0207691_100593213 | 251 |
| 8 | 3300050509 | nmdc:mga0qj67_167454_c1 | nmdc:mga0qj67_167454_c1_930_1718 | 251 |
| 9 | 3300046522 | Ga0495643_0000133 | Ga0495643_0000133_11410_12246 | 252 |
| 10 | 3300049576 | Ga0501040_0355071 | Ga0501040_0355071_147_992 | 253 |
| 11 | 3300049577 | Ga0501041_0187250 | Ga0501041_0187250_101_946 | 253 |
| 12 | 3300049578 | Ga0501042_0117513 | Ga0501042_0117513_633_1478 | 253 |
| 13 | 3300049579 | Ga0501043_0133618 | Ga0501043_0133618_736_1581 | 253 |
| 14 | 3300049592 | Ga0501076_0013438 | Ga0501076_0013438_62_907 | 253 |
| 15 | 3300049741 | Ga0501079_0021918 | Ga0501079_0021918_739_1584 | 253 |
| 16 | 3300049742 | Ga0501080_0444858 | Ga0501080_0444858_86_931 | 253 |
| 17 | 3300049743 | Ga0501081_0002751 | Ga0501081_0002751_3496_4341 | 253 |
| 18 | 3300049824 | Ga0501045_0066747 | Ga0501045_0066747_1444_2289 | 253 |
| 19 | 3300054114 | Ga0501084_0037703 | Ga0501084_0037703_1218_2063 | 253 |
| 20 | 3300037068 | Ga0373925_0004171 | Ga0373925_0004171_348_1196 | 254 |
| 21 | 3300036401 | Ga0373937_0712766 | Ga0373937_0712766_118_927 | 255 |
| 22 | 3300005328 | Ga0070676_10089642 | Ga0070676_100896422 | 256 |
| 23 | 3300005331 | Ga0070670_100104226 | Ga0070670_1001042262 | 256 |
| 24 | 3300005334 | Ga0068869_100161704 | Ga0068869_1001617042 | 256 |
| 25 | 3300005340 | Ga0070689_100091797 | Ga0070689_1000917972 | 256 |
| 26 | 3300005345 | Ga0070692_10189174 | Ga0070692_101891741 | 256 |
| 27 | 3300005353 | Ga0070669_100088704 | Ga0070669_1000887042 | 256 |
| 28 | 3300005354 | Ga0070675_100167645 | Ga0070675_1001676453 | 256 |
| 29 | 3300005356 | Ga0070674_100041651 | Ga0070674_1000416512 | 256 |
| 30 | 3300005367 | Ga0070667_100074487 | Ga0070667_1000744874 | 256 |
| 31 | 3300005441 | Ga0070700_100052290 | Ga0070700_1000522902 | 256 |
| 32 | 3300005456 | Ga0070678_100085385 | Ga0070678_1000853854 | 256 |
| 33 | 3300005466 | Ga0070685_10012889 | Ga0070685_100128892 | 256 |
| 34 | 3300005543 | Ga0070672_100085290 | Ga0070672_1000852903 | 256 |
| 35 | 3300005548 | Ga0070665_100123897 | Ga0070665_1001238972 | 256 |
| 36 | 3300005549 | Ga0070704_100023891 | Ga0070704_1000238913 | 256 |
| 37 | 3300005563 | Ga0068855_100481382 | Ga0068855_1004813822 | 256 |
| 38 | 3300005616 | Ga0068852_100406739 | Ga0068852_1004067392 | 256 |
| 39 | 3300005718 | Ga0068866_10003879 | Ga0068866_100038794 | 256 |
| 40 | 3300005719 | Ga0068861_100028641 | Ga0068861_1000286413 | 256 |
| 41 | 3300005841 | Ga0068863_100108615 | Ga0068863_1001086154 | 256 |
| 42 | 3300005842 | Ga0068858_100272909 | Ga0068858_1002729092 | 256 |
| 43 | 3300005843 | Ga0068860_100142352 | Ga0068860_1001423524 | 256 |
| 44 | 3300006237 | Ga0097621_100293778 | Ga0097621_1002937781 | 256 |
| 45 | 3300009094 | Ga0111539_10350038 | Ga0111539_103500382 | 256 |
| 46 | 3300009148 | Ga0105243_10043528 | Ga0105243_100435284 | 256 |
| 47 | 3300009176 | Ga0105242_10235976 | Ga0105242_102359763 | 256 |
| 48 | 3300009177 | Ga0105248_10331638 | Ga0105248_103316382 | 256 |
| 49 | 3300013296 | Ga0157374_10059270 | Ga0157374_100592704 | 256 |
| 50 | 3300013297 | Ga0157378_10139239 | Ga0157378_101392392 | 256 |
| 51 | 3300014325 | Ga0163163_10421357 | Ga0163163_104213572 | 256 |
| 52 | 3300014326 | Ga0157380_10288881 | Ga0157380_102888812 | 256 |
| 53 | 3300025893 | Ga0207682_10005908 | Ga0207682_100059084 | 256 |
| 54 | 3300025899 | Ga0207642_10120109 | Ga0207642_101201092 | 256 |
| 55 | 3300025901 | Ga0207688_10096438 | Ga0207688_100964381 | 256 |
| 56 | 3300025908 | Ga0207643_10016761 | Ga0207643_100167612 | 256 |
| 57 | 3300025933 | Ga0207706_10169081 | Ga0207706_101690812 | 256 |
| 58 | 3300025936 | Ga0207670_10044747 | Ga0207670_100447474 | 256 |
| 59 | 3300025937 | Ga0207669_10271241 | Ga0207669_102712411 | 256 |
| 60 | 3300025940 | Ga0207691_10047706 | Ga0207691_100477063 | 256 |
| 61 | 3300025942 | Ga0207689_10045180 | Ga0207689_100451805 | 256 |
| 62 | 3300025949 | Ga0207667_10498883 | Ga0207667_104988832 | 256 |
| 63 | 3300026035 | Ga0207703_10088929 | Ga0207703_100889291 | 256 |
| 64 | 3300026075 | Ga0207708_10008241 | Ga0207708_1000824112 | 256 |
| 65 | 3300026088 | Ga0207641_10478676 | Ga0207641_104786761 | 256 |
| 66 | 3300026088 | Ga0207641_10646466 | Ga0207641_106464662 | 256 |
| 67 | 3300026089 | Ga0207648_10008515 | Ga0207648_100085158 | 256 |
| 68 | 3300026095 | Ga0207676_10025071 | Ga0207676_100250715 | 256 |
| 69 | 3300026118 | Ga0207675_100017014 | Ga0207675_1000170144 | 256 |
| 70 | 3300026121 | Ga0207683_10020193 | Ga0207683_100201932 | 256 |
| 71 | 3300028381 | Ga0268264_10257767 | Ga0268264_102577671 | 256 |
| 72 | 3300045051 | Ga0451576_0438606 | Ga0451576_0438606_408_1244 | 256 |
| 73 | 3300046528 | Ga0495642_0076118 | Ga0495642_0076118_424_1260 | 256 |
| 74 | 3300046684 | Ga0495669_0051531 | Ga0495669_0051531_852_1688 | 256 |
| 75 | 3300048908 | Ga0496105_0004826 | Ga0496105_0004826_24_842 | 256 |
| 76 | 3300048911 | Ga0496108_0253265 | Ga0496108_0253265_203_1039 | 256 |
| 77 | 3300048912 | Ga0496109_0302677 | Ga0496109_0302677_520_1356 | 256 |
| 78 | 3300048913 | Ga0496110_0329324 | Ga0496110_0329324_106_942 | 256 |
| 79 | 3300050511 | nmdc:mga08y16_31157_c1 | nmdc:mga08y16_31157_c1_2775_3611 | 256 |
| 80 | 3300005844 | Ga0068862_100020456 | Ga0068862_1000204563 | 257 |
| 81 | 3300005336 | Ga0070680_100028049 | Ga0070680_1000280493 | 258 |
| 82 | 3300005458 | Ga0070681_10013173 | Ga0070681_100131735 | 258 |
| 83 | 3300005530 | Ga0070679_100038960 | Ga0070679_1000389606 | 258 |
| 84 | 3300005539 | Ga0068853_100015122 | Ga0068853_1000151225 | 258 |
| 85 | 3300005549 | Ga0070704_100027628 | Ga0070704_1000276282 | 258 |
| 86 | 3300013307 | Ga0157372_10049918 | Ga0157372_100499184 | 258 |
| 87 | 3300025912 | Ga0207707_10003985 | Ga0207707_1000398510 | 258 |
| 88 | 3300025917 | Ga0207660_10029769 | Ga0207660_100297694 | 258 |
| 89 | 3300025920 | Ga0207649_10209166 | Ga0207649_102091662 | 258 |
| 90 | 3300025921 | Ga0207652_10009203 | Ga0207652_100092036 | 258 |
| 91 | 3300026041 | Ga0207639_10022812 | Ga0207639_100228123 | 258 |
| 92 | 3300049571 | Ga0501034_0026205 | Ga0501034_0026205_4434_5267 | 258 |
| 93 | 3300049581 | Ga0501047_0124228 | Ga0501047_0124228_1289_2122 | 258 |
| 94 | 3300049583 | Ga0501067_0008963 | Ga0501067_0008963_2300_3133 | 258 |
| 95 | 3300049586 | Ga0501070_0020725 | Ga0501070_0020725_248_1081 | 258 |
| 96 | 3300049589 | Ga0501073_0006495 | Ga0501073_0006495_5315_6148 | 258 |
| 97 | 3300049742 | Ga0501080_0001682 | Ga0501080_0001682_4327_5160 | 258 |
| 98 | 3300049744 | Ga0501083_0040929 | Ga0501083_0040929_2213_3046 | 258 |
| 99 | 3300017792 | Ga0163161_10030211 | Ga0163161_100302112 | 259 |
| 100 | 3300028794 | Ga0307515_10002662 | Ga0307515_100026625 | 259 |
| 101 | 3300031548 | Ga0307408_100182014 | Ga0307408_1001820141 | 259 |
| 102 | 3300031852 | Ga0307410_10363279 | Ga0307410_103632791 | 259 |
| 103 | 3300032004 | Ga0307414_10059886 | Ga0307414_100598863 | 259 |
| 104 | 3300032005 | Ga0307411_10106640 | Ga0307411_101066401 | 259 |
| 105 | 3300046471 | Ga0495650_0003944 | Ga0495650_0003944_7999_8811 | 259 |
| 106 | 3300046535 | Ga0495586_0113220 | Ga0495586_0113220_73_909 | 259 |
| 107 | 3300050512 | nmdc:mga0n895_789628_c1 | nmdc:mga0n895_789628_c1_103_924 | 259 |
| 108 | 3300005333 | Ga0070677_10009192 | Ga0070677_100091924 | 260 |
| 109 | 3300005459 | Ga0068867_100212065 | Ga0068867_1002120652 | 260 |
| 110 | 3300005467 | Ga0070706_100073147 | Ga0070706_1000731475 | 260 |
| 111 | 3300006177 | Ga0075362_10089949 | Ga0075362_100899492 | 260 |
| 112 | 3300006195 | Ga0075366_10002856 | Ga0075366_100028566 | 260 |
| 113 | 3300009094 | Ga0111539_10733169 | Ga0111539_107331692 | 260 |
| 114 | 3300009094 | Ga0111539_10872624 | Ga0111539_108726241 | 260 |
| 115 | 3300017792 | Ga0163161_10055751 | Ga0163161_100557514 | 260 |
| 116 | 3300025315 | Ga0207697_10006613 | Ga0207697_100066135 | 260 |
| 117 | 3300025935 | Ga0207709_10035265 | Ga0207709_100352652 | 260 |
| 118 | 3300028577 | Ga0265318_10007718 | Ga0265318_100077185 | 260 |
| 119 | 3300028794 | Ga0307515_10013586 | Ga0307515_100135865 | 260 |
| 120 | 3300028800 | Ga0265338_10350667 | Ga0265338_103506671 | 260 |
| 121 | 3300031235 | Ga0265330_10004578 | Ga0265330_100045786 | 260 |
| 122 | 3300031238 | Ga0265332_10090429 | Ga0265332_100904292 | 260 |
| 123 | 3300031240 | Ga0265320_10030095 | Ga0265320_100300954 | 260 |
| 124 | 3300031241 | Ga0265325_10149005 | Ga0265325_101490051 | 260 |
| 125 | 3300031250 | Ga0265331_10014337 | Ga0265331_100143377 | 260 |
| 126 | 3300031344 | Ga0265316_10014225 | Ga0265316_100142255 | 260 |
| 127 | 3300031711 | Ga0265314_10001567 | Ga0265314_1000156721 | 260 |
| 128 | 3300031911 | Ga0307412_10151041 | Ga0307412_101510412 | 260 |
| 129 | 3300032002 | Ga0307416_100455130 | Ga0307416_1004551301 | 260 |
| 130 | 3300039447 | Ga0436361_0313546 | Ga0436361_0313546_17747_18562 | 260 |
| 131 | 3300039447 | Ga0436361_0500164 | Ga0436361_0500164_12951_13766 | 260 |
| 132 | 3300041997 | Ga0439431_0003490 | Ga0439431_0003490_2496_3302 | 260 |
| 133 | 3300042185 | Ga0450909_018943 | Ga0450909_018943_14_820 | 260 |
| 134 | 3300050493 | nmdc:mga0k408_15049_c1 | nmdc:mga0k408_15049_c1_3334_4176 | 260 |
| 135 | 3300003322 | rootL2_10025805 | rootL2_1002580512 | 261 |
| 136 | 3300005344 | Ga0070661_100257078 | Ga0070661_1002570782 | 261 |
| 137 | 3300005445 | Ga0070708_100106539 | Ga0070708_1001065392 | 261 |
| 138 | 3300005457 | Ga0070662_100014505 | Ga0070662_1000145053 | 261 |
| 139 | 3300005458 | Ga0070681_10001301 | Ga0070681_1000130111 | 261 |
| 140 | 3300005467 | Ga0070706_100022137 | Ga0070706_1000221374 | 261 |
| 141 | 3300005468 | Ga0070707_100012605 | Ga0070707_1000126057 | 261 |
| 142 | 3300025912 | Ga0207707_10046321 | Ga0207707_100463215 | 261 |
| 143 | 3300025922 | Ga0207646_10013719 | Ga0207646_100137197 | 261 |
| 144 | 3300025933 | Ga0207706_10001466 | Ga0207706_100014663 | 261 |
| 145 | 3300042157 | Ga0439458_0023339 | Ga0439458_0023339_563_1390 | 261 |
| 146 | 3300044658 | Ga0466972_0001085 | Ga0466972_0001085_10832_11656 | 261 |
| 147 | 3300044683 | Ga0466965_0039188 | Ga0466965_0039188_56_880 | 261 |
| 148 | 3300009093 | Ga0105240_10005056 | Ga0105240_1000505619 | 262 |
| 149 | 3300009545 | Ga0105237_10000784 | Ga0105237_1000078421 | 262 |
| 150 | 3300010375 | Ga0105239_10001759 | Ga0105239_1000175925 | 262 |
| 151 | 3300025913 | Ga0207695_10010612 | Ga0207695_1001061212 | 262 |
| 152 | 3300025914 | Ga0207671_10009892 | Ga0207671_100098928 | 262 |
| 153 | 3300048928 | Ga0496125_0135375 | Ga0496125_0135375_58_894 | 262 |
| 154 | 3300028654 | Ga0265322_10002161 | Ga0265322_100021615 | 264 |
| 155 | 3300031235 | Ga0265330_10002766 | Ga0265330_100027664 | 264 |
| 156 | 3300031242 | Ga0265329_10006099 | Ga0265329_100060993 | 264 |
| 157 | 3300031344 | Ga0265316_10002434 | Ga0265316_1000243416 | 264 |
| 158 | 3300031712 | Ga0265342_10000164 | Ga0265342_100001642 | 264 |
| 159 | 3300005336 | Ga0070680_100107457 | Ga0070680_1001074572 | 266 |
| 160 | iso_pu_bacteria | 2738541297 | 2738826075 | 266 |
| 161 | iso_pu_bacteria | 2738541357 | 2739149872 | 266 |
| 162 | iso_pu_bacteria | 2738543003 | 2739191791 | 266 |
| 163 | iso_pu_bacteria | 2738543026 | 2739318268 | 266 |
| 164 | iso_pu_bacteria | 2738543029 | 2739336509 | 266 |
| 165 | 3300046472 | Ga0495580_0174970 | Ga0495580_0174970_486_1313 | 267 |
| 166 | 3300049585 | Ga0501069_0113752 | Ga0501069_0113752_428_1255 | 267 |
| 167 | iso_pu_bacteria | 2857547612 | 2857552832 | 267 |
| 168 | 3300003771 | Ga0055526_1000076 | Ga0055526_100007630 | 268 |
| 169 | 3300005327 | Ga0070658_10083012 | Ga0070658_100830122 | 268 |
| 170 | 3300005329 | Ga0070683_100001621 | Ga0070683_1000016214 | 268 |
| 171 | 3300005330 | Ga0070690_100004185 | Ga0070690_1000041853 | 268 |
| 172 | 3300005331 | Ga0070670_100039804 | Ga0070670_1000398044 | 268 |
| 173 | 3300005334 | Ga0068869_100256068 | Ga0068869_1002560681 | 268 |
| 174 | 3300005335 | Ga0070666_10312291 | Ga0070666_103122912 | 268 |
| 175 | 3300005338 | Ga0068868_100021111 | Ga0068868_1000211111 | 268 |
| 176 | 3300005340 | Ga0070689_100003440 | Ga0070689_1000034407 | 268 |
| 177 | 3300005345 | Ga0070692_10042264 | Ga0070692_100422642 | 268 |
| 178 | 3300005355 | Ga0070671_100018740 | Ga0070671_1000187404 | 268 |
| 179 | 3300005356 | Ga0070674_100024796 | Ga0070674_1000247965 | 268 |
| 180 | 3300005364 | Ga0070673_100000875 | Ga0070673_10000087520 | 268 |
| 181 | 3300005364 | Ga0070673_100006346 | Ga0070673_1000063466 | 268 |
| 182 | 3300005365 | Ga0070688_100001476 | Ga0070688_1000014768 | 268 |
| 183 | 3300005367 | Ga0070667_100305329 | Ga0070667_1003053291 | 268 |
| 184 | 3300005436 | Ga0070713_100010713 | Ga0070713_1000107132 | 268 |
| 185 | 3300005437 | Ga0070710_10030424 | Ga0070710_100304242 | 268 |
| 186 | 3300005437 | Ga0070710_10224907 | Ga0070710_102249072 | 268 |
| 187 | 3300005439 | Ga0070711_100005372 | Ga0070711_1000053722 | 268 |
| 188 | 3300005439 | Ga0070711_100044700 | Ga0070711_1000447004 | 268 |
| 189 | 3300005440 | Ga0070705_100037941 | Ga0070705_1000379413 | 268 |
| 190 | 3300005444 | Ga0070694_100316440 | Ga0070694_1003164401 | 268 |
| 191 | 3300005445 | Ga0070708_100169654 | Ga0070708_1001696542 | 268 |
| 192 | 3300005456 | Ga0070678_100012547 | Ga0070678_1000125472 | 268 |
| 193 | 3300005457 | Ga0070662_100044909 | Ga0070662_1000449096 | 268 |
| 194 | 3300005457 | Ga0070662_100062130 | Ga0070662_1000621302 | 268 |
| 195 | 3300005458 | Ga0070681_10271553 | Ga0070681_102715532 | 268 |
| 196 | 3300005459 | Ga0068867_100532730 | Ga0068867_1005327301 | 268 |
| 197 | 3300005466 | Ga0070685_10002559 | Ga0070685_100025597 | 268 |
| 198 | 3300005467 | Ga0070706_100318241 | Ga0070706_1003182412 | 268 |
| 199 | 3300005536 | Ga0070697_100029924 | Ga0070697_1000299242 | 268 |
| 200 | 3300005543 | Ga0070672_100245026 | Ga0070672_1002450262 | 268 |
| 201 | 3300005544 | Ga0070686_100173031 | Ga0070686_1001730312 | 268 |
| 202 | 3300005547 | Ga0070693_100054312 | Ga0070693_1000543122 | 268 |
| 203 | 3300005548 | Ga0070665_100016607 | Ga0070665_1000166072 | 268 |
| 204 | 3300005563 | Ga0068855_100410031 | Ga0068855_1004100312 | 268 |
| 205 | 3300005564 | Ga0070664_100274558 | Ga0070664_1002745581 | 268 |
| 206 | 3300005578 | Ga0068854_100128376 | Ga0068854_1001283762 | 268 |
| 207 | 3300005614 | Ga0068856_100422171 | Ga0068856_1004221712 | 268 |
| 208 | 3300005615 | Ga0070702_100024968 | Ga0070702_1000249681 | 268 |
| 209 | 3300005615 | Ga0070702_100126987 | Ga0070702_1001269871 | 268 |
| 210 | 3300005616 | Ga0068852_100050265 | Ga0068852_1000502653 | 268 |
| 211 | 3300005617 | Ga0068859_100005320 | Ga0068859_1000053209 | 268 |
| 212 | 3300005618 | Ga0068864_100009675 | Ga0068864_1000096758 | 268 |
| 213 | 3300005718 | Ga0068866_10006338 | Ga0068866_100063382 | 268 |
| 214 | 3300005840 | Ga0068870_10030072 | Ga0068870_100300724 | 268 |
| 215 | 3300005841 | Ga0068863_100012501 | Ga0068863_1000125019 | 268 |
| 216 | 3300005842 | Ga0068858_100182222 | Ga0068858_1001822222 | 268 |
| 217 | 3300005843 | Ga0068860_100341454 | Ga0068860_1003414542 | 268 |
| 218 | 3300006163 | Ga0070715_10008238 | Ga0070715_100082382 | 268 |
| 219 | 3300006175 | Ga0070712_100042826 | Ga0070712_1000428263 | 268 |
| 220 | 3300006358 | Ga0068871_100301128 | Ga0068871_1003011282 | 268 |
| 221 | 3300006844 | Ga0075428_100003410 | Ga0075428_10000341015 | 268 |
| 222 | 3300006871 | Ga0075434_100347527 | Ga0075434_1003475272 | 268 |
| 223 | 3300006880 | Ga0075429_100003762 | Ga0075429_1000037624 | 268 |
| 224 | 3300006881 | Ga0068865_100441169 | Ga0068865_1004411692 | 268 |
| 225 | 3300006931 | Ga0097620_100005321 | Ga0097620_1000053219 | 268 |
| 226 | 3300007076 | Ga0075435_100044922 | Ga0075435_1000449224 | 268 |
| 227 | 3300009094 | Ga0111539_10004728 | Ga0111539_100047288 | 268 |
| 228 | 3300009094 | Ga0111539_10229405 | Ga0111539_102294052 | 268 |
| 229 | 3300009098 | Ga0105245_10010977 | Ga0105245_100109777 | 268 |
| 230 | 3300009098 | Ga0105245_10028483 | Ga0105245_100284832 | 268 |
| 231 | 3300009098 | Ga0105245_10338416 | Ga0105245_103384162 | 268 |
| 232 | 3300009147 | Ga0114129_10276391 | Ga0114129_102763913 | 268 |
| 233 | 3300009177 | Ga0105248_10096402 | Ga0105248_100964024 | 268 |
| 234 | 3300009545 | Ga0105237_10364003 | Ga0105237_103640032 | 268 |
| 235 | 3300013100 | Ga0157373_10132673 | Ga0157373_101326732 | 268 |
| 236 | 3300013104 | Ga0157370_10021795 | Ga0157370_100217953 | 268 |
| 237 | 3300013105 | Ga0157369_10158841 | Ga0157369_101588413 | 268 |
| 238 | 3300013296 | Ga0157374_10004313 | Ga0157374_100043136 | 268 |
| 239 | 3300013297 | Ga0157378_10027667 | Ga0157378_100276672 | 268 |
| 240 | 3300013297 | Ga0157378_10543121 | Ga0157378_105431212 | 268 |
| 241 | 3300013306 | Ga0163162_10036018 | Ga0163162_100360182 | 268 |
| 242 | 3300013306 | Ga0163162_10036062 | Ga0163162_100360622 | 268 |
| 243 | 3300013308 | Ga0157375_10080856 | Ga0157375_100808562 | 268 |
| 244 | 3300014325 | Ga0163163_10004197 | Ga0163163_100041975 | 268 |
| 245 | 3300014745 | Ga0157377_10012518 | Ga0157377_100125183 | 268 |
| 246 | 3300014968 | Ga0157379_10035731 | Ga0157379_100357314 | 268 |
| 247 | 3300014969 | Ga0157376_10059009 | Ga0157376_100590092 | 268 |
| 248 | 3300014969 | Ga0157376_10069103 | Ga0157376_100691032 | 268 |
| 249 | 3300017792 | Ga0163161_10163575 | Ga0163161_101635752 | 268 |
| 250 | 3300025295 | Ga0209564_1000042 | Ga0209564_1000042300 | 268 |
| 251 | 3300025899 | Ga0207642_10016912 | Ga0207642_100169124 | 268 |
| 252 | 3300025903 | Ga0207680_10004468 | Ga0207680_100044682 | 268 |
| 253 | 3300025905 | Ga0207685_10011454 | Ga0207685_100114543 | 268 |
| 254 | 3300025906 | Ga0207699_10065245 | Ga0207699_100652452 | 268 |
| 255 | 3300025907 | Ga0207645_10037093 | Ga0207645_100370932 | 268 |
| 256 | 3300025908 | Ga0207643_10010215 | Ga0207643_100102156 | 268 |
| 257 | 3300025912 | Ga0207707_10153308 | Ga0207707_101533082 | 268 |
| 258 | 3300025915 | Ga0207693_10007619 | Ga0207693_100076196 | 268 |
| 259 | 3300025915 | Ga0207693_10009659 | Ga0207693_100096594 | 268 |
| 260 | 3300025916 | Ga0207663_10091705 | Ga0207663_100917052 | 268 |
| 261 | 3300025917 | Ga0207660_10309505 | Ga0207660_103095052 | 268 |
| 262 | 3300025919 | Ga0207657_10003387 | Ga0207657_100033877 | 268 |
| 263 | 3300025925 | Ga0207650_10042488 | Ga0207650_100424881 | 268 |
| 264 | 3300025927 | Ga0207687_10003283 | Ga0207687_100032833 | 268 |
| 265 | 3300025931 | Ga0207644_10009296 | Ga0207644_100092962 | 268 |
| 266 | 3300025931 | Ga0207644_10190225 | Ga0207644_101902252 | 268 |
| 267 | 3300025933 | Ga0207706_10031760 | Ga0207706_100317606 | 268 |
| 268 | 3300025933 | Ga0207706_10140687 | Ga0207706_101406872 | 268 |
| 269 | 3300025934 | Ga0207686_10000798 | Ga0207686_1000079814 | 268 |
| 270 | 3300025936 | Ga0207670_10014043 | Ga0207670_100140435 | 268 |
| 271 | 3300025937 | Ga0207669_10007150 | Ga0207669_100071503 | 268 |
| 272 | 3300025939 | Ga0207665_10038353 | Ga0207665_100383532 | 268 |
| 273 | 3300025941 | Ga0207711_10002829 | Ga0207711_100028299 | 268 |
| 274 | 3300025942 | Ga0207689_10117926 | Ga0207689_101179261 | 268 |
| 275 | 3300025944 | Ga0207661_10026593 | Ga0207661_100265934 | 268 |
| 276 | 3300025944 | Ga0207661_10059378 | Ga0207661_100593784 | 268 |
| 277 | 3300025949 | Ga0207667_10647419 | Ga0207667_106474192 | 268 |
| 278 | 3300025960 | Ga0207651_10001059 | Ga0207651_100010599 | 268 |
| 279 | 3300025960 | Ga0207651_10003258 | Ga0207651_100032582 | 268 |
| 280 | 3300026023 | Ga0207677_10000186 | Ga0207677_1000018642 | 268 |
| 281 | 3300026035 | Ga0207703_10003780 | Ga0207703_100037806 | 268 |
| 282 | 3300026041 | Ga0207639_10279203 | Ga0207639_102792031 | 268 |
| 283 | 3300026041 | Ga0207639_10623637 | Ga0207639_106236371 | 268 |
| 284 | 3300026088 | Ga0207641_10007033 | Ga0207641_1000703310 | 268 |
| 285 | 3300026089 | Ga0207648_10061631 | Ga0207648_100616313 | 268 |
| 286 | 3300026095 | Ga0207676_10000455 | Ga0207676_1000045531 | 268 |
| 287 | 3300026095 | Ga0207676_10567972 | Ga0207676_105679722 | 268 |
| 288 | 3300026116 | Ga0207674_10006719 | Ga0207674_100067195 | 268 |
| 289 | 3300026121 | Ga0207683_10000768 | Ga0207683_1000076818 | 268 |
| 290 | 3300027360 | Ga0209969_1000695 | Ga0209969_10006952 | 268 |
| 291 | 3300027462 | Ga0210000_1000104 | Ga0210000_10001045 | 268 |
| 292 | 3300027682 | Ga0209971_1008430 | Ga0209971_10084302 | 268 |
| 293 | 3300027876 | Ga0209974_10013981 | Ga0209974_100139813 | 268 |
| 294 | 3300027907 | Ga0207428_10057470 | Ga0207428_100574705 | 268 |
| 295 | 3300028379 | Ga0268266_10023237 | Ga0268266_100232374 | 268 |
| 296 | 3300028381 | Ga0268264_10005450 | Ga0268264_1000545011 | 268 |
| 297 | 3300035083 | Ga0373926_0042697 | Ga0373926_0042697_38_892 | 268 |
| 298 | 3300035086 | Ga0373934_0007287 | Ga0373934_0007287_563_1417 | 268 |
| 299 | 3300035089 | Ga0373944_0018506 | Ga0373944_0018506_584_1438 | 268 |
| 300 | 3300035116 | Ga0373945_0005115 | Ga0373945_0005115_931_1785 | 268 |
| 301 | 3300035116 | Ga0373945_0122748 | Ga0373945_0122748_114_968 | 268 |
| 302 | 3300035118 | Ga0373954_0004273 | Ga0373954_0004273_3759_4613 | 268 |
| 303 | 3300035172 | Ga0373955_0002610 | Ga0373955_0002610_3047_3901 | 268 |
| 304 | 3300035172 | Ga0373955_0187388 | Ga0373955_0187388_51_905 | 268 |
| 305 | 3300035410 | Ga0373924_0004132 | Ga0373924_0004132_1613_2446 | 268 |
| 306 | 3300035410 | Ga0373924_0042803 | Ga0373924_0042803_723_1577 | 268 |
| 307 | 3300035692 | Ga0373935_0092215 | Ga0373935_0092215_56_910 | 268 |
| 308 | 3300035695 | Ga0373927_0024392 | Ga0373927_0024392_2192_3046 | 268 |
| 309 | 3300035695 | Ga0373927_0054838 | Ga0373927_0054838_223_1077 | 268 |
| 310 | 3300035724 | Ga0373933_0073644 | Ga0373933_0073644_768_1622 | 268 |
| 311 | 3300036401 | Ga0373937_0072701 | Ga0373937_0072701_1821_2675 | 268 |
| 312 | 3300037068 | Ga0373925_0068247 | Ga0373925_0068247_1317_2171 | 268 |
| 313 | 3300037068 | Ga0373925_0218087 | Ga0373925_0218087_26_862 | 268 |
| 314 | 3300045051 | Ga0451576_0500000 | Ga0451576_0500000_76_915 | 268 |
| 315 | 3300046455 | Ga0495603_0271912 | Ga0495603_0271912_102_956 | 268 |
| 316 | 3300046459 | Ga0495629_0016725 | Ga0495629_0016725_2065_2919 | 268 |
| 317 | 3300046462 | Ga0495651_0037178 | Ga0495651_0037178_2206_3060 | 268 |
| 318 | 3300046463 | Ga0495653_0029585 | Ga0495653_0029585_2508_3362 | 268 |
| 319 | 3300046472 | Ga0495580_0006193 | Ga0495580_0006193_2367_3221 | 268 |
| 320 | 3300046475 | Ga0495639_0027360 | Ga0495639_0027360_83_937 | 268 |
| 321 | 3300046476 | Ga0495662_0012895 | Ga0495662_0012895_1772_2626 | 268 |
| 322 | 3300046477 | Ga0495664_0113648 | Ga0495664_0113648_716_1570 | 268 |
| 323 | 3300046499 | Ga0495594_0121897 | Ga0495594_0121897_360_1214 | 268 |
| 324 | 3300046517 | Ga0495630_0146367 | Ga0495630_0146367_100_933 | 268 |
| 325 | 3300046531 | Ga0495665_0138328 | Ga0495665_0138328_199_1053 | 268 |
| 326 | 3300046543 | Ga0495645_0039072 | Ga0495645_0039072_1037_1891 | 268 |
| 327 | 3300046615 | Ga0495656_0028756 | Ga0495656_0028756_1020_1862 | 268 |
| 328 | 3300046642 | Ga0495634_0022935 | Ga0495634_0022935_3008_3862 | 268 |
| 329 | 3300046663 | Ga0495635_0011193 | Ga0495635_0011193_3708_4562 | 268 |
| 330 | 3300046664 | Ga0495659_0010388 | Ga0495659_0010388_1900_2754 | 268 |
| 331 | 3300046675 | Ga0495657_0142557 | Ga0495657_0142557_58_912 | 268 |
| 332 | 3300046679 | Ga0495623_0031724 | Ga0495623_0031724_2063_2917 | 268 |
| 333 | 3300046681 | Ga0495647_0000713 | Ga0495647_0000713_1540_2394 | 268 |
| 334 | 3300046689 | Ga0495613_0003774 | Ga0495613_0003774_3761_4615 | 268 |
| 335 | 3300047315 | Ga0495581_0003828 | Ga0495581_0003828_2378_3232 | 268 |
| 336 | 3300047317 | Ga0495604_0081568 | Ga0495604_0081568_1316_2170 | 268 |
| 337 | 3300047317 | Ga0495604_0192796 | Ga0495604_0192796_101_955 | 268 |
| 338 | 3300047471 | Ga0495684_0019481 | Ga0495684_0019481_1786_2640 | 268 |
| 339 | 3300047673 | Ga0495593_0013259 | Ga0495593_0013259_2087_2941 | 268 |
| 340 | 3300048089 | Ga0495614_0009243 | Ga0495614_0009243_3284_4138 | 268 |
| 341 | 3300048903 | Ga0496100_0024371 | Ga0496100_0024371_1133_1987 | 268 |
| 342 | 3300048904 | Ga0496101_0176973 | Ga0496101_0176973_225_1079 | 268 |
| 343 | 3300048907 | Ga0496104_0003415 | Ga0496104_0003415_6028_6882 | 268 |
| 344 | 3300048909 | Ga0496106_0364505 | Ga0496106_0364505_229_1083 | 268 |
| 345 | 3300048909 | Ga0496106_0365646 | Ga0496106_0365646_291_1145 | 268 |
| 346 | 3300048912 | Ga0496109_0041300 | Ga0496109_0041300_2661_3515 | 268 |
| 347 | 3300048912 | Ga0496109_0238043 | Ga0496109_0238043_788_1642 | 268 |
| 348 | 3300048918 | Ga0496115_0035197 | Ga0496115_0035197_805_1659 | 268 |
| 349 | 3300049571 | Ga0501034_0057097 | Ga0501034_0057097_758_1591 | 268 |
| 350 | 3300050507 | nmdc:mga05p37_528382_c1 | nmdc:mga05p37_528382_c1_362_1204 | 268 |
| 351 | 3300050508 | nmdc:mga09592_27897_c1 | nmdc:mga09592_27897_c1_3288_4130 | 268 |
| 352 | 3300050511 | nmdc:mga08y16_1729_c1 | nmdc:mga08y16_1729_c1_9904_10746 | 268 |
| 353 | 3300050511 | nmdc:mga08y16_96291_c1 | nmdc:mga08y16_96291_c1_545_1399 | 268 |
| 354 | 3300050512 | nmdc:mga0n895_334938_c1 | nmdc:mga0n895_334938_c1_461_1315 | 268 |
| 355 | 3300050513 | nmdc:mga0rr50_230764_c1 | nmdc:mga0rr50_230764_c1_568_1416 | 268 |
| 356 | 3300053077 | Ga0495601_0188329 | Ga0495601_0188329_118_972 | 268 |
| 357 | 3300053084 | Ga0495595_0064302 | Ga0495595_0064302_768_1622 | 268 |
| 358 | 3300053085 | Ga0495619_0023531 | Ga0495619_0023531_2080_2934 | 268 |
| 359 | iso_pu_bacteria | 2857553236 | 2857558046 | 268 |
| 360 | iso_pu_bacteria | 2885080285 | 2885083945 | 268 |
| 361 | iso_pu_bacteria | 2919476304 | 2919476343 | 268 |
| 362 | 3300005338 | Ga0068868_100000336 | Ga0068868_10000033618 | 269 |
| 363 | 3300005339 | Ga0070660_100108327 | Ga0070660_1001083271 | 269 |
| 364 | 3300005344 | Ga0070661_100001915 | Ga0070661_1000019156 | 269 |
| 365 | 3300005354 | Ga0070675_100000564 | Ga0070675_10000056421 | 269 |
| 366 | 3300005355 | Ga0070671_100003077 | Ga0070671_10000307711 | 269 |
| 367 | 3300005356 | Ga0070674_100101034 | Ga0070674_1001010341 | 269 |
| 368 | 3300005367 | Ga0070667_100084604 | Ga0070667_1000846044 | 269 |
| 369 | 3300005535 | Ga0070684_100011627 | Ga0070684_1000116274 | 269 |
| 370 | 3300005548 | Ga0070665_100083752 | Ga0070665_1000837525 | 269 |
| 371 | 3300005564 | Ga0070664_100003688 | Ga0070664_1000036888 | 269 |
| 372 | 3300005578 | Ga0068854_100009287 | Ga0068854_1000092872 | 269 |
| 373 | 3300005616 | Ga0068852_100000411 | Ga0068852_10000041123 | 269 |
| 374 | 3300005616 | Ga0068852_100113163 | Ga0068852_1001131631 | 269 |
| 375 | 3300005618 | Ga0068864_100025682 | Ga0068864_1000256824 | 269 |
| 376 | 3300005834 | Ga0068851_10011794 | Ga0068851_100117944 | 269 |
| 377 | 3300006237 | Ga0097621_100000527 | Ga0097621_10000052717 | 269 |
| 378 | 3300006358 | Ga0068871_100000363 | Ga0068871_10000036321 | 269 |
| 379 | 3300009177 | Ga0105248_10034644 | Ga0105248_100346446 | 269 |
| 380 | 3300013296 | Ga0157374_10001418 | Ga0157374_1000141822 | 269 |
| 381 | 3300013297 | Ga0157378_10002277 | Ga0157378_1000227717 | 269 |
| 382 | 3300013306 | Ga0163162_10118801 | Ga0163162_101188012 | 269 |
| 383 | 3300013308 | Ga0157375_10082886 | Ga0157375_100828866 | 269 |
| 384 | 3300014326 | Ga0157380_10097868 | Ga0157380_100978682 | 269 |
| 385 | 3300025321 | Ga0207656_10018386 | Ga0207656_100183865 | 269 |
| 386 | 3300025925 | Ga0207650_10002371 | Ga0207650_1000237110 | 269 |
| 387 | 3300025926 | Ga0207659_10000462 | Ga0207659_1000046213 | 269 |
| 388 | 3300025931 | Ga0207644_10002291 | Ga0207644_100022912 | 269 |
| 389 | 3300025933 | Ga0207706_10034962 | Ga0207706_100349628 | 269 |
| 390 | 3300025937 | Ga0207669_10124630 | Ga0207669_101246302 | 269 |
| 391 | 3300025939 | Ga0207665_10068565 | Ga0207665_100685652 | 269 |
| 392 | 3300025940 | Ga0207691_10000513 | Ga0207691_1000051321 | 269 |
| 393 | 3300025941 | Ga0207711_10057235 | Ga0207711_100572353 | 269 |
| 394 | 3300025981 | Ga0207640_10001436 | Ga0207640_1000143611 | 269 |
| 395 | 3300025986 | Ga0207658_10272168 | Ga0207658_102721682 | 269 |
| 396 | 3300026023 | Ga0207677_10000494 | Ga0207677_1000049412 | 269 |
| 397 | 3300026088 | Ga0207641_10681774 | Ga0207641_106817741 | 269 |
| 398 | 3300026121 | Ga0207683_10000673 | Ga0207683_1000067324 | 269 |
| 399 | 3300026142 | Ga0207698_10004774 | Ga0207698_100047742 | 269 |
| 400 | 3300035171 | Ga0373946_0043551 | Ga0373946_0043551_236_1099 | 269 |
| 401 | 3300035692 | Ga0373935_0030436 | Ga0373935_0030436_207_1070 | 269 |
| 402 | 3300035725 | Ga0373947_0101461 | Ga0373947_0101461_162_1025 | 269 |
| 403 | 3300041512 | Ga0451853_0810706 | Ga0451853_0810706_449_1387 | 269 |
| 404 | 3300046457 | Ga0495590_0000056 | Ga0495590_0000056_39837_40661 | 269 |
| 405 | 3300046539 | Ga0495621_0039453 | Ga0495621_0039453_810_1622 | 269 |
| 406 | 3300048912 | Ga0496109_0001737 | Ga0496109_0001737_4718_5656 | 269 |
| 407 | 3300048913 | Ga0496110_0029368 | Ga0496110_0029368_3866_4717 | 269 |
| 408 | 3300048918 | Ga0496115_0167203 | Ga0496115_0167203_834_1676 | 269 |
| 409 | 3300049742 | Ga0501080_0446888 | Ga0501080_0446888_73_951 | 269 |
| 410 | 3300005354 | Ga0070675_100475550 | Ga0070675_1004755501 | 270 |
| 411 | 3300005547 | Ga0070693_100096228 | Ga0070693_1000962281 | 270 |
| 412 | 3300005563 | Ga0068855_100031145 | Ga0068855_1000311454 | 270 |
| 413 | 3300005842 | Ga0068858_100007450 | Ga0068858_1000074503 | 270 |
| 414 | 3300009093 | Ga0105240_10673322 | Ga0105240_106733221 | 270 |
| 415 | 3300009148 | Ga0105243_10067884 | Ga0105243_100678842 | 270 |
| 416 | 3300009176 | Ga0105242_10000761 | Ga0105242_100007613 | 270 |
| 417 | 3300009177 | Ga0105248_10215493 | Ga0105248_102154932 | 270 |
| 418 | 3300013307 | Ga0157372_10273770 | Ga0157372_102737703 | 270 |
| 419 | 3300014497 | Ga0182008_10002644 | Ga0182008_100026444 | 270 |
| 420 | 3300014968 | Ga0157379_10049300 | Ga0157379_100493004 | 270 |
| 421 | 3300015262 | Ga0182007_10000063 | Ga0182007_1000006352 | 270 |
| 422 | 3300015265 | Ga0182005_1000057 | Ga0182005_100005760 | 270 |
| 423 | 3300025906 | Ga0207699_10144903 | Ga0207699_101449032 | 270 |
| 424 | 3300025929 | Ga0207664_10038283 | Ga0207664_100382832 | 270 |
| 425 | 3300025934 | Ga0207686_10016946 | Ga0207686_100169464 | 270 |
| 426 | 3300025949 | Ga0207667_10019744 | Ga0207667_100197444 | 270 |
| 427 | 3300026035 | Ga0207703_10065764 | Ga0207703_100657643 | 270 |
| 428 | 3300027111 | Ga0209281_1019255 | Ga0209281_10192552 | 270 |
| 429 | 3300046452 | Ga0495617_000198 | Ga0495617_000198_9993_10808 | 270 |
| 430 | 3300046452 | Ga0495617_009638 | Ga0495617_009638_787_1650 | 270 |
| 431 | 3300046460 | Ga0495638_0014336 | Ga0495638_0014336_2976_3791 | 270 |
| 432 | 3300046463 | Ga0495653_0000066 | Ga0495653_0000066_54299_55114 | 270 |
| 433 | 3300046471 | Ga0495650_0000571 | Ga0495650_0000571_33980_34795 | 270 |
| 434 | 3300046471 | Ga0495650_0081294 | Ga0495650_0081294_183_998 | 270 |
| 435 | 3300046492 | Ga0495585_0000646 | Ga0495585_0000646_14609_15424 | 270 |
| 436 | 3300046512 | Ga0495610_0000014 | Ga0495610_0000014_376146_376961 | 270 |
| 437 | 3300046524 | Ga0495648_0003987 | Ga0495648_0003987_9986_10801 | 270 |
| 438 | 3300046530 | Ga0495654_0018401 | Ga0495654_0018401_2372_3187 | 270 |
| 439 | 3300046539 | Ga0495621_0035243 | Ga0495621_0035243_336_1181 | 270 |
| 440 | 3300046616 | Ga0495668_0000636 | Ga0495668_0000636_14408_15223 | 270 |
| 441 | 3300046692 | Ga0495671_0000005 | Ga0495671_0000005_35483_36298 | 270 |
| 442 | 3300046692 | Ga0495671_0015822 | Ga0495671_0015822_2929_3744 | 270 |
| 443 | 3300046810 | Ga0495660_0000923 | Ga0495660_0000923_15315_16130 | 270 |
| 444 | 3300047323 | Ga0495683_0018449 | Ga0495683_0018449_832_1647 | 270 |
| 445 | 3300047469 | Ga0495673_0000009 | Ga0495673_0000009_704150_704965 | 270 |
| 446 | 3300047469 | Ga0495673_0000012 | Ga0495673_0000012_594009_594824 | 270 |
| 447 | 3300047469 | Ga0495673_0000146 | Ga0495673_0000146_49987_50805 | 270 |
| 448 | 3300048920 | Ga0496117_0000075 | Ga0496117_0000075_73431_74270 | 270 |
| 449 | 3300048921 | Ga0496118_0000055 | Ga0496118_0000055_73431_74270 | 270 |
| 450 | 3300048925 | Ga0496122_0000800 | Ga0496122_0000800_39330_40169 | 270 |
| 451 | 3300048926 | Ga0496123_0006032 | Ga0496123_0006032_1579_2418 | 270 |
| 452 | 3300048927 | Ga0496124_0060462 | Ga0496124_0060462_481_1320 | 270 |
| 453 | 3300048929 | Ga0496126_0058971 | Ga0496126_0058971_663_1478 | 270 |
| 454 | 3300049679 | Ga0501249_004256 | Ga0501249_004256_1455_2273 | 270 |
| 455 | 3300049766 | Ga0501269_002882 | Ga0501269_002882_105_923 | 270 |
| 456 | 3300053145 | Ga0500586_036531 | Ga0500586_036531_717_1532 | 270 |
| 457 | 3300003322 | rootL2_10076289 | rootL2_100762893 | 271 |
| 458 | 3300003763 | Ga0055529_1000274 | Ga0055529_100027416 | 271 |
| 459 | 3300005339 | Ga0070660_100020748 | Ga0070660_1000207484 | 271 |
| 460 | 3300005344 | Ga0070661_100012702 | Ga0070661_1000127023 | 271 |
| 461 | 3300006028 | Ga0070717_10012658 | Ga0070717_100126582 | 271 |
| 462 | 3300006846 | Ga0075430_100159084 | Ga0075430_1001590843 | 271 |
| 463 | 3300017792 | Ga0163161_10025124 | Ga0163161_100251241 | 271 |
| 464 | 3300025233 | Ga0209437_106638 | Ga0209437_1066381 | 271 |
| 465 | 3300025272 | Ga0209455_1000253 | Ga0209455_100025316 | 271 |
| 466 | 3300031838 | Ga0307518_10017880 | Ga0307518_100178801 | 271 |
| 467 | 3300044842 | Ga0466957_0134257 | Ga0466957_0134257_648_1499 | 271 |
| 468 | 3300046471 | Ga0495650_0000528 | Ga0495650_0000528_33071_33889 | 271 |
| 469 | 3300046507 | Ga0495606_0000063 | Ga0495606_0000063_31975_32793 | 271 |
| 470 | 3300046507 | Ga0495606_0000180 | Ga0495606_0000180_105514_106359 | 271 |
| 471 | 3300046512 | Ga0495610_0006277 | Ga0495610_0006277_5496_6314 | 271 |
| 472 | 3300046520 | Ga0495637_0002419 | Ga0495637_0002419_4153_4980 | 271 |
| 473 | 3300046530 | Ga0495654_0000014 | Ga0495654_0000014_293218_294036 | 271 |
| 474 | 3300046530 | Ga0495654_0004348 | Ga0495654_0004348_2492_3313 | 271 |
| 475 | 3300046616 | Ga0495668_0000152 | Ga0495668_0000152_42733_43551 | 271 |
| 476 | 3300046616 | Ga0495668_0002746 | Ga0495668_0002746_13115_13933 | 271 |
| 477 | 3300047472 | Ga0495686_0000332 | Ga0495686_0000332_31291_32115 | 271 |
| 478 | 3300047472 | Ga0495686_0315466 | Ga0495686_0315466_25_843 | 271 |
| 479 | 3300048918 | Ga0496115_0178651 | Ga0496115_0178651_210_1067 | 271 |
| 480 | 3300048919 | Ga0496116_0056944 | Ga0496116_0056944_1161_1979 | 271 |
| 481 | iso_pu_bacteria | 2600255292 | 2601666936 | 271 |
| 482 | 3300002987 | JGI25159J45721_1000292 | JGI25159J45721_10002923 | 272 |
| 483 | 3300004625 | Ga0055543_1005921 | Ga0055543_10059211 | 272 |
| 484 | 3300005262 | Ga0065165_1000167 | Ga0065165_100016716 | 272 |
| 485 | 3300015261 | Ga0182006_1000095 | Ga0182006_100009561 | 272 |
| 486 | 3300015265 | Ga0182005_1000119 | Ga0182005_100011939 | 272 |
| 487 | 3300021361 | Ga0213872_10000136 | Ga0213872_1000013627 | 272 |
| 488 | 3300025250 | Ga0209026_1007384 | Ga0209026_10073842 | 272 |
| 489 | 3300025284 | Ga0209130_1000016 | Ga0209130_1000016273 | 272 |
| 490 | 3300037312 | Ga0395899_0000581 | Ga0395899_0000581_16800_17627 | 272 |
| 491 | 3300039447 | Ga0436361_0954756 | Ga0436361_0954756_34962_35792 | 272 |
| 492 | 3300044683 | Ga0466965_0142610 | Ga0466965_0142610_275_1102 | 272 |
| 493 | 3300044684 | Ga0466966_0024130 | Ga0466966_0024130_1405_2232 | 272 |
| 494 | 3300044719 | Ga0466971_0043751 | Ga0466971_0043751_412_1239 | 272 |
| 495 | 3300046453 | Ga0495627_000004 | Ga0495627_000004_27023_27847 | 272 |
| 496 | 3300046501 | Ga0495607_0001066 | Ga0495607_0001066_18605_19438 | 272 |
| 497 | 3300046519 | Ga0495632_0051920 | Ga0495632_0051920_103_927 | 272 |
| 498 | 3300046523 | Ga0495644_0008954 | Ga0495644_0008954_131_955 | 272 |
| 499 | 3300046530 | Ga0495654_0008231 | Ga0495654_0008231_1083_1919 | 272 |
| 500 | 3300046538 | Ga0495609_0001180 | Ga0495609_0001180_5241_6065 | 272 |
| 501 | 3300046557 | Ga0495622_0004798 | Ga0495622_0004798_3955_4860 | 272 |
| 502 | 3300046558 | Ga0495633_0000131 | Ga0495633_0000131_39673_40494 | 272 |
| 503 | 3300046558 | Ga0495633_0001499 | Ga0495633_0001499_14427_15263 | 272 |
| 504 | 3300046810 | Ga0495660_0003889 | Ga0495660_0003889_2710_3534 | 272 |
| 505 | 3300046810 | Ga0495660_0004915 | Ga0495660_0004915_4301_5125 | 272 |
| 506 | 3300046810 | Ga0495660_0005172 | Ga0495660_0005172_2705_3529 | 272 |
| 507 | 3300047320 | Ga0495672_0000019 | Ga0495672_0000019_382715_383539 | 272 |
| 508 | 3300047323 | Ga0495683_0012988 | Ga0495683_0012988_734_1552 | 272 |
| 509 | 3300047470 | Ga0495681_0000895 | Ga0495681_0000895_15836_16660 | 272 |
| 510 | 3300047472 | Ga0495686_0148759 | Ga0495686_0148759_138_962 | 272 |
| 511 | 3300048924 | Ga0496121_0003403 | Ga0496121_0003403_371_1210 | 272 |
| 512 | 3300048924 | Ga0496121_0013110 | Ga0496121_0013110_5755_6594 | 272 |
| 513 | 3300048927 | Ga0496124_0018943 | Ga0496124_0018943_1962_2786 | 272 |
| 514 | 3300049459 | Ga0495678_000027 | Ga0495678_000027_169735_170559 | 272 |
| 515 | 3300049459 | Ga0495678_002046 | Ga0495678_002046_4917_5735 | 272 |
| 516 | 3300049459 | Ga0495678_010529 | Ga0495678_010529_2570_3421 | 272 |
| 517 | 3300049460 | Ga0495682_0008184 | Ga0495682_0008184_2491_3327 | 272 |
| 518 | 3300061719 | Ga0466962_0040270 | Ga0466962_0040270_1384_2211 | 272 |
| 519 | iso_pu_bacteria | 2932410948 | 2932415597 | 272 |
| 520 | iso_pu_bacteria | 2932416698 | 2932421587 | 272 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3h95-assembly1.cif.gz_A-2 | crystal structure of the nudix domain of nudt6 | 0.8928 | 148 | 248 |
| 3oga-assembly1.cif.gz_B | 1.75 angstrom resolution crystal structure of a putative ntp pyrophosphohydrolase (yfao) from salmonella typhimurium lt2 | 0.8708 | 144 | 247 |
| 5zrl-assembly2.cif.gz_B | m. smegmatis antimutator protein mutt2 in complex with cdp | 0.8629 | 145 | 247 |
| 4v14-assembly2.cif.gz_B | structure and function analysis of mutt from the psychrofile fish pathogen aliivibrio salmonicida and the mesophile vibrio cholerae | 0.8568 | 146 | 245 |
| 5zrc-assembly1.cif.gz_A | structural insights into the catalysis mechanism of m. smegmatis antimutator protein mutt2 | 0.8553 | 146 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gb5A02 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9334 | 144 | 267 | 3.90.79.10 |
| af_Q94A82_242_424_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9257 | 144 | 247 | 3.90.79.10 |
| af_Q9VXR9_162_296_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9172 | 148 | 243 | 3.90.79.10 |
| af_P9WIX5_169_312_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.915 | 144 | 247 | 3.90.79.10 |
| af_I1MUA9_246_385_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9116 | 144 | 245 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B0NM59-F1-model_v4 | NAD(+) diphosphatase (EC 3.6.1.22) | 0.9473 | 152 | 256 |
GO:0005829
GO:0006734 GO:0006742 GO:0019677 GO:0035529 GO:0046872 |
| AF-R5VE62-F1-model_v4 | NAD(+) diphosphatase (EC 3.6.1.22) | 0.945 | 162 | 266 |
GO:0005829
GO:0006734 GO:0006742 GO:0019677 GO:0035529 GO:0046872 |
| AF-A0A4Q6CQ37-F1-model_v4 | deleted | 0.9412 | 145 | 267 |
|
| AF-A0A351DPT9-F1-model_v4 | NAD(+) diphosphatase (EC 3.6.1.22) | 0.9403 | 147 | 267 |
GO:0005829
GO:0006734 GO:0006742 GO:0019677 GO:0035529 |
| AF-B0NM59-F1-model_v4 | NAD(+) diphosphatase (EC 3.6.1.22) | 0.93 | 152 | 256 |
GO:0005829
GO:0006734 GO:0006742 GO:0019677 GO:0035529 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar