F458505

General Info

Members Datasets Scaffolds Average Seq Length
520 307 1040 330

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100080944|Ga0070659_1000809442
Length 380
Sequence MISLCNGLSRARCARRPLTPPLSAGERPSDFPTSPPPTSRPLLFVDNLNSTDASRNLALEEYVLRHRMGDDDLLLFYVNAPAIIIGRNQNTIEEIAPDVVAERGIQVVRRVSGGGAVYHDLGNLNFSFMTRDVSGRFNRYDRFNGPVVEVLRDLGVPAEIGGRNDILVGGRKISGNAQFARPDRMFSHGTLLVHSNLDDVTAALRPRPGKVESKGVKSIRSRVANINEFLVQPVDTGEHALGVHELRELILERIFGTRDRSAIPTVELTDDDWQRIEELRVTKYAAWSWNFGENPPCNVQRAQRFPAGEIDLRFDVHQGLISNLRIFGDFMGRRDVAELESRLRGVAFDRDAMLAAIGDADLSMYFGAVERDEVLGLLLP

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
101 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
186 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
187 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
188 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
189 2554235283 Bacillus safensis VK Isolate Rhizosphere
190 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
191 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
192 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
193 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
194 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
195 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
196 2643221729 Bacillus sp. Root11 Isolate Unclassified
197 2643221730 Bacillus sp. Root131 Isolate Unclassified
198 2643221731 Bacillus sp. Root147 Isolate Unclassified
199 2643221732 Bacillus sp. Root239 Isolate Unclassified
200 2643221735 Bacillus sp. Root920 Isolate Unclassified
201 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
202 2671180694 Paenibacillus sp. A3 Isolate Unclassified
203 2684622632 Bacillus cereus 905 Isolate Unclassified
204 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
205 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
206 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
207 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
208 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
209 2738541295 Bacillus sp. OK085 Isolate Unclassified
210 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
211 2738541358 Bacillus sp. OV752 Isolate Unclassified
212 2738543006 Bacillus sp. OK077 Isolate Unclassified
213 2738543010 Bacillus sp. YR335 Isolate Unclassified
214 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
215 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
216 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
217 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
218 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
219 2811994870 Bacillus sp. JB4 Isolate Unclassified
220 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
221 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
222 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
223 2818991441 Niallia circulans 3243 Isolate Rhizosphere
224 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
225 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
226 2818991459 Paenibacillus sp. 597 Isolate Unclassified
227 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
228 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
229 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
230 2842682962 Bacillus sp. R-72492 Isolate Unclassified
231 2842882022 Bacillus sp. R-71893 Isolate Unclassified
232 2849139964 Bacillus sp. R-71875 Isolate Unclassified
233 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
234 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
235 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
236 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
237 2857472729 Cohnella sp. R-74144 Isolate Unclassified
238 2857581216 Bacillus sp. R-71922 Isolate Unclassified
239 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
240 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
241 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
242 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
243 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
244 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
245 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
246 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
247 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
248 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
249 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
250 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
251 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
252 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
253 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
254 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
255 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
256 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
257 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
258 2919720352 Priestia megaterium 4340 Isolate Unclassified
259 2919726948 Bacillus pumilus 4489 Isolate Unclassified
260 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
261 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
262 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
263 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
264 2929004312 Priestia megaterium 1104 Isolate Unclassified
265 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
266 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
267 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
268 2938917290 Bacillus sp. CR71 Isolate Unclassified
269 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
270 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
271 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
272 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
273 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
274 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
275 2965761152 Bacillus sp. COPE52 Isolate Unclassified
276 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
277 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
278 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
279 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
280 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
281 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
282 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
283 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
284 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
285 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
286 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
287 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
288 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
289 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
290 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
291 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
292 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
293 8022792930 Bacillus sp. Xin Isolate Rhizosphere
294 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
295 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
296 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
297 8023438354 Bacillus sp. BH2 Isolate Unclassified
298 8023444577 Bacillus sp. BH32 Isolate Unclassified
299 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
300 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
301 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
302 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
303 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
304 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
305 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
306 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
307 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.38
Metatranscriptomes 0.77
Isolates 23.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.46
Nodule 0.38
Rhizoplane 3.46
Rhizosphere 68.27
Stem 0
Stem Tuber 0
Unclassified 3.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100080944 3300005366 Bacteria 2593
2 JGI25159J45721_1003482 3300002987 Bacteria 5554
3 JGI25159J45721_1007371 3300002987 Bacteria 3161
4 JGI25151J46595_10000009 3300003187 Bacteria 296412
5 JGI25151J46595_10009468 3300003187 Bacteria 4609
6 JGI25151J46595_10010928 3300003187 Bacteria 4196
7 JGI25151J46595_10021248 3300003187 Bacteria 2719
8 JGI25151J46595_10029903 3300003187 Bacteria 2149
9 JGI25151J46595_10030718 3300003187 Bacteria 2109
10 JGI25151J46595_10041637 3300003187 Bacteria 1666
11 rootH1_10025147 3300003316 Bacteria 10316
12 rootL2_10017596 3300003322 Bacteria 10714
13 rootH1_10036582 3300003323 Bacteria 5242
14 Ga0006562J51391_1001382 3300003578 Bacteria 3710
15 Ga0006562J51391_1003939 3300003578 Bacteria 4676
16 Ga0055538_1000709 3300003751 Bacteria 10108
17 Ga0055532_1009420 3300003758 Bacteria 1188
18 Ga0055535_1003668 3300003761 Bacteria 4170
19 Ga0055528_1005766 3300003790 Bacteria 5706
20 Ga0055528_1007497 3300003790 Bacteria 4815
21 Ga0055541_1001295 3300003841 Bacteria 5485
22 Ga0070658_10001978 3300005327 Bacteria 17221
23 Ga0070658_10007321 3300005327 Bacteria 8913
24 Ga0070658_10031585 3300005327 Bacteria 4253
25 Ga0070658_10189868 3300005327 Bacteria 1731
26 Ga0070683_100028915 3300005329 Bacteria 5013
27 Ga0070683_100055419 3300005329 Bacteria 3679
28 Ga0070683_100063840 3300005329 Bacteria 3426
29 Ga0070683_100073745 3300005329 Bacteria 3187
30 Ga0070683_100134243 3300005329 Bacteria 2343
31 Ga0070683_100318727 3300005329 Bacteria 1479
32 Ga0070680_100007796 3300005336 Bacteria 8161
33 Ga0070680_100012060 3300005336 Bacteria 6709
34 Ga0070680_100015201 3300005336 Bacteria 6030
35 Ga0070680_100133531 3300005336 Bacteria 2078
36 Ga0070680_100136735 3300005336 Bacteria 2053
37 Ga0070682_100114690 3300005337 Bacteria 1801
38 Ga0070660_100013594 3300005339 Bacteria 5846
39 Ga0070660_100082756 3300005339 Bacteria 2521
40 Ga0070691_10024759 3300005341 Bacteria 2791
41 Ga0070661_100049531 3300005344 Unclassified 3075
42 Ga0070668_100065789 3300005347 Bacteria 2812
43 Ga0070659_100015973 3300005366 Bacteria 5630
44 Ga0070659_100133625 3300005366 Bacteria 2017
45 Ga0070659_100169877 3300005366 Bacteria 1786
46 Ga0070709_10200898 3300005434 Bacteria 1411
47 Ga0070714_100003830 3300005435 Bacteria 11299
48 Ga0070714_100005187 3300005435 Bacteria 9914
49 Ga0070714_100028991 3300005435 Bacteria 4598
50 Ga0070663_100053050 3300005455 Bacteria 2893
51 Ga0070663_100061714 3300005455 Bacteria 2700
52 Ga0070663_100169776 3300005455 Bacteria 1685
53 Ga0070663_100358510 3300005455 Bacteria 1182
54 Ga0070681_10007878 3300005458 Bacteria 10426
55 Ga0070681_10025345 3300005458 Bacteria 5965
56 Ga0070681_10048069 3300005458 Bacteria 4264
57 Ga0070681_10072360 3300005458 Bacteria 3410
58 Ga0070681_10079104 3300005458 Bacteria 3244
59 Ga0070681_10589234 3300005458 Bacteria 1026
60 Ga0070699_100030059 3300005518 Bacteria 4688
61 Ga0070679_100004305 3300005530 Bacteria 13141
62 Ga0070679_100004437 3300005530 Bacteria 12966
63 Ga0070679_100017203 3300005530 Bacteria 6993
64 Ga0070679_100022983 3300005530 Bacteria 6098
65 Ga0070679_100042380 3300005530 Bacteria 4532
66 Ga0070679_100134592 3300005530 Bacteria 2452
67 Ga0070679_100138927 3300005530 Bacteria 2410
68 Ga0070679_100272367 3300005530 Bacteria 1647
69 Ga0070684_100027675 3300005535 Bacteria 4788
70 Ga0070684_100046069 3300005535 Bacteria 3778
71 Ga0070684_100121303 3300005535 Bacteria 2352
72 Ga0068853_100027367 3300005539 Bacteria 4790
73 Ga0070672_100044961 3300005543 Bacteria 3412
74 Ga0070672_100078240 3300005543 Bacteria 2646
75 Ga0070696_100008407 3300005546 Bacteria 6905
76 Ga0070696_100047065 3300005546 Bacteria 2992
77 Ga0070665_100245170 3300005548 Unclassified 1792
78 Ga0068855_100026052 3300005563 Bacteria 6995
79 Ga0068855_100167159 3300005563 Bacteria 2493
80 Ga0068855_100243887 3300005563 Bacteria 2006
81 Ga0070664_100016998 3300005564 Bacteria 5971
82 Ga0070664_100073163 3300005564 Bacteria 2940
83 Ga0068854_100028371 3300005578 Bacteria 3867
84 Ga0068854_100050743 3300005578 Unclassified 2970
85 Ga0068856_100158866 3300005614 Bacteria 2271
86 Ga0068856_100162900 3300005614 Bacteria 2241
87 Ga0068856_100471747 3300005614 Bacteria 1276
88 Ga0068852_100046297 3300005616 Bacteria 3706
89 Ga0068852_100152529 3300005616 Unclassified 2150
90 Ga0068852_100204383 3300005616 Bacteria 1870
91 Ga0070717_10160410 3300006028 Bacteria 1950
92 Ga0075436_100023244 3300006914 Bacteria 4258
93 Ga0105251_10013695 3300009011 Bacteria 4523
94 Ga0105251_10046698 3300009011 Bacteria 2084
95 Ga0105250_10003739 3300009092 Bacteria 7145
96 Ga0105250_10026509 3300009092 Bacteria 2334
97 Ga0105240_10050512 3300009093 Bacteria 5242
98 Ga0105240_10153630 3300009093 Unclassified 2739
99 Ga0105240_10233065 3300009093 Bacteria 2138
100 Ga0105245_10211359 3300009098 Bacteria 1867
101 Ga0105247_10053008 3300009101 Bacteria 2501
102 Ga0105243_10002585 3300009148 Bacteria 15110
103 Ga0105242_10157191 3300009176 Bacteria 1987
104 Ga0105238_10069228 3300009551 Bacteria 3529
105 Ga0105238_10072520 3300009551 Bacteria 3438
106 Ga0105238_10140751 3300009551 Unclassified 2389
107 Ga0105249_10000009 3300009553 Bacteria 313866
108 Ga0105246_10004986 3300011119 Bacteria 8081
109 Ga0105246_10019281 3300011119 Bacteria 4357
110 Ga0157373_10005892 3300013100 Bacteria 9168
111 Ga0157373_10031767 3300013100 Bacteria 3800
112 Ga0157373_10040035 3300013100 Bacteria 3354
113 Ga0157373_10048566 3300013100 Bacteria 3025
114 Ga0157371_10036248 3300013102 Bacteria 3532
115 Ga0157371_10114038 3300013102 Unclassified 1919
116 Ga0157370_10019658 3300013104 Bacteria 6764
117 Ga0157370_10025870 3300013104 Bacteria 5804
118 Ga0157370_10110406 3300013104 Bacteria 2571
119 Ga0157370_10349391 3300013104 Bacteria 1363
120 Ga0157369_10009308 3300013105 Bacteria 11239
121 Ga0157369_10035844 3300013105 Bacteria 5439
122 Ga0157369_10055081 3300013105 Bacteria 4293
123 Ga0157369_10115338 3300013105 Unclassified 2853
124 Ga0157369_10136245 3300013105 Bacteria 2599
125 Ga0157369_10442865 3300013105 Bacteria 1345
126 Ga0157369_10450842 3300013105 Bacteria 1332
127 Ga0157374_10332664 3300013296 Bacteria 1507
128 Ga0157378_10020113 3300013297 Bacteria 5871
129 Ga0157372_10010412 3300013307 Bacteria 9886
130 Ga0157372_10025884 3300013307 Bacteria 6381
131 Ga0157372_10048555 3300013307 Bacteria 4718
132 Ga0157372_10068736 3300013307 Unclassified 3983
133 Ga0157372_10101697 3300013307 Bacteria 3282
134 Ga0157372_10103755 3300013307 Bacteria 3249
135 Ga0157372_10323043 3300013307 Bacteria 1797
136 Ga0157372_10379656 3300013307 Bacteria 1647
137 Ga0157372_10456772 3300013307 Bacteria 1489
138 Ga0157375_10818855 3300013308 Bacteria 1079
139 Ga0182008_10029881 3300014497 Bacteria 2751
140 Ga0157377_10112174 3300014745 Bacteria 1640
141 Ga0206354_11643509 3300020081 Bacteria 1509
142 Ga0213876_10039125 3300021384 Bacteria 2505
143 Ga0209784_100178 3300025224 Bacteria 53225
144 Ga0209566_100133 3300025225 Bacteria 91857
145 Ga0209566_100144 3300025225 Bacteria 83705
146 Ga0209566_100417 3300025225 Bacteria 33299
147 Ga0209147_100069 3300025229 Bacteria 224017
148 Ga0209147_101481 3300025229 Bacteria 8368
149 Ga0209147_106669 3300025229 Bacteria 1581
150 Ga0209258_104560 3300025242 Bacteria 2591
151 Ga0209673_1003272 3300025273 Bacteria 9772
152 Ga0209130_1000311 3300025284 Bacteria 57319
153 Ga0209130_1005287 3300025284 Bacteria 4543
154 Ga0209675_1008234 3300025291 Bacteria 3865
155 Ga0209676_1000844 3300025292 Bacteria 39621
156 Ga0209676_1020970 3300025292 Bacteria 2204
157 Ga0209676_1037339 3300025292 Bacteria 1403
158 Ga0209025_1000001 3300025294 Bacteria 1888151
159 Ga0209025_1000209 3300025294 Bacteria 140401
160 Ga0209025_1000616 3300025294 Bacteria 63937
161 Ga0209025_1001238 3300025294 Bacteria 35471
162 Ga0209025_1001550 3300025294 Bacteria 29284
163 Ga0209025_1003250 3300025294 Bacteria 15661
164 Ga0209025_1004828 3300025294 Bacteria 11389
165 Ga0209025_1005845 3300025294 Bacteria 9844
166 Ga0209025_1013841 3300025294 Bacteria 5029
167 Ga0209025_1014767 3300025294 Bacteria 4771
168 Ga0209025_1017206 3300025294 Bacteria 4194
169 Ga0209025_1030138 3300025294 Bacteria 2604
170 Ga0209025_1032590 3300025294 Bacteria 2430
171 Ga0207426_1028824 3300025302 Bacteria 1837
172 Ga0207696_1004554 3300025711 Bacteria 5938
173 Ga0207696_1005979 3300025711 Bacteria 4967
174 Ga0207655_1005394 3300025728 Bacteria 8704
175 Ga0207713_1003689 3300025735 Bacteria 10296
176 Ga0207713_1031112 3300025735 Bacteria 2365
177 Ga0207710_10132313 3300025900 Bacteria 1199
178 Ga0207705_10004588 3300025909 Bacteria 10429
179 Ga0207705_10012034 3300025909 Bacteria 6251
180 Ga0207705_10072297 3300025909 Bacteria 2501
181 Ga0207707_10004233 3300025912 Bacteria 12699
182 Ga0207707_10007682 3300025912 Bacteria 9392
183 Ga0207707_10033234 3300025912 Bacteria 4515
184 Ga0207695_10008938 3300025913 Bacteria 12471
185 Ga0207695_10032565 3300025913 Bacteria 5703
186 Ga0207695_10046022 3300025913 Unclassified 4626
187 Ga0207695_10046809 3300025913 Bacteria 4582
188 Ga0207695_10075929 3300025913 Bacteria 3418
189 Ga0207695_10112309 3300025913 Bacteria 2703
190 Ga0207695_10338847 3300025913 Bacteria 1392
191 Ga0207671_10133841 3300025914 Bacteria 1905
192 Ga0207660_10002202 3300025917 Bacteria 12895
193 Ga0207660_10010646 3300025917 Bacteria 5976
194 Ga0207660_10025378 3300025917 Bacteria 4022
195 Ga0207660_10162532 3300025917 Unclassified 1724
196 Ga0207660_10197670 3300025917 Bacteria 1569
197 Ga0207657_10001243 3300025919 Bacteria 27235
198 Ga0207657_10028131 3300025919 Bacteria 5135
199 Ga0207657_10106434 3300025919 Bacteria 2321
200 Ga0207657_10147627 3300025919 Bacteria 1917
201 Ga0207657_10269062 3300025919 Bacteria 1355
202 Ga0207649_10061890 3300025920 Bacteria 2357
203 Ga0207652_10001195 3300025921 Bacteria 23355
204 Ga0207652_10002768 3300025921 Bacteria 14733
205 Ga0207652_10026651 3300025921 Bacteria 4817
206 Ga0207652_10031954 3300025921 Bacteria 4421
207 Ga0207652_10042679 3300025921 Bacteria 3861
208 Ga0207652_10052114 3300025921 Bacteria 3510
209 Ga0207652_10131396 3300025921 Bacteria 2233
210 Ga0207652_10156989 3300025921 Bacteria 2038
211 Ga0207652_10226110 3300025921 Bacteria 1686
212 Ga0207652_10413072 3300025921 Bacteria 1217
213 Ga0207694_10080132 3300025924 Bacteria 2562
214 Ga0207694_10147165 3300025924 Bacteria 1896
215 Ga0207687_10285648 3300025927 Bacteria 1324
216 Ga0207664_10056683 3300025929 Bacteria 3112
217 Ga0207690_10018348 3300025932 Bacteria 4290
218 Ga0207690_10072271 3300025932 Bacteria 2382
219 Ga0207690_10077448 3300025932 Bacteria 2311
220 Ga0207709_10006359 3300025935 Bacteria 6629
221 Ga0207661_10001309 3300025944 Bacteria 16641
222 Ga0207661_10004803 3300025944 Bacteria 9462
223 Ga0207661_10056352 3300025944 Bacteria 3155
224 Ga0207661_10066679 3300025944 Unclassified 2924
225 Ga0207661_10099107 3300025944 Bacteria 2443
226 Ga0207679_10004518 3300025945 Bacteria 8666
227 Ga0207679_10030390 3300025945 Bacteria 3772
228 Ga0207667_10098440 3300025949 Bacteria 3018
229 Ga0207667_10130399 3300025949 Bacteria 2589
230 Ga0207667_10149694 3300025949 Bacteria 2403
231 Ga0207667_10317810 3300025949 Bacteria 1590
232 Ga0207667_10353473 3300025949 Bacteria 1498
233 Ga0207667_10400399 3300025949 Unclassified 1398
234 Ga0207651_10207121 3300025960 Bacteria 1576
235 Ga0207712_10000077 3300025961 Bacteria 119803
236 Ga0207712_10445289 3300025961 Bacteria 1097
237 Ga0207668_10060786 3300025972 Bacteria 2653
238 Ga0207640_10011317 3300025981 Bacteria 5048
239 Ga0207640_10045359 3300025981 Unclassified 2822
240 Ga0207678_10016217 3300026067 Bacteria 6537
241 Ga0207678_10043687 3300026067 Bacteria 3877
242 Ga0207678_10417158 3300026067 Bacteria 1164
243 Ga0207702_10120002 3300026078 Bacteria 2352
244 Ga0207702_10126958 3300026078 Bacteria 2291
245 Ga0207702_10139744 3300026078 Unclassified 2190
246 Ga0207702_10447520 3300026078 Bacteria 1253
247 Ga0207698_10042844 3300026142 Bacteria 3386
248 Ga0207698_10122316 3300026142 Bacteria 2205
249 Ga0207698_10170294 3300026142 Unclassified 1917
250 Ga0207698_10191166 3300026142 Bacteria 1823
251 Ga0209371_1001082 3300027312 Bacteria 20358
252 Ga0268266_10235147 3300028379 Unclassified 1689
253 Ga0237817_10231 3300030083 Bacteria 14044
254 Ga0237817_10324 3300030083 Bacteria 9446
255 Ga0268256_1000917 3300030500 Bacteria 20356
256 Ga0307408_100065436 3300031548 Bacteria 2666
257 Ga0307408_100067459 3300031548 Bacteria 2631
258 Ga0307405_10213606 3300031731 Bacteria 1410
259 Ga0307413_10006193 3300031824 Bacteria 5435
260 Ga0307413_10009395 3300031824 Bacteria 4677
261 Ga0307413_10157470 3300031824 Bacteria 1591
262 Ga0307413_10259946 3300031824 Bacteria 1293
263 Ga0307410_10089742 3300031852 Bacteria 2178
264 Ga0307406_10055965 3300031901 Bacteria 2523
265 Ga0307412_10081183 3300031911 Bacteria 2242
266 Ga0307412_10194316 3300031911 Bacteria 1536
267 Ga0307409_100011318 3300031995 Bacteria 5615
268 Ga0307409_100039231 3300031995 Bacteria 3512
269 Ga0307416_100006790 3300032002 Bacteria 7197
270 Ga0307416_100087773 3300032002 Bacteria 2657
271 Ga0307416_100092975 3300032002 Bacteria 2596
272 Ga0307414_10081827 3300032004 Bacteria 2366
273 Ga0307411_10008033 3300032005 Bacteria 5434
274 Ga0307411_10111455 3300032005 Bacteria 1959
275 Ga0307411_10234440 3300032005 Bacteria 1433
276 Ga0316582_0019519 3300036647 Unclassified 3970
277 Ga0316582_0090008 3300036647 Bacteria 2019
278 Ga0316582_0305219 3300036647 Bacteria 1094
279 Ga0395899_0008040 3300037312 Bacteria 8120
280 Ga0395899_0048588 3300037312 Bacteria 3157
281 Ga0395899_0171192 3300037312 Bacteria 1529
282 Ga0395900_0043098 3300037418 Bacteria 4650
283 Ga0395905_0034926 3300037471 Bacteria 4720
284 Ga0395905_0143061 3300037471 Bacteria 2250
285 Ga0395905_0248205 3300037471 Bacteria 1663
286 Ga0395901_0002411 3300038443 Bacteria 18976
287 Ga0237819_01147 3300038705 Bacteria 7604
288 Ga0436365_1520238 3300039437 Bacteria 28946
289 Ga0439449_0033286 3300042007 Bacteria 1920
290 Ga0466969_0027620 3300044656 Bacteria 2905
291 Ga0453683_0017376 3300044673 Bacteria 4631
292 Ga0466965_0146905 3300044683 Bacteria 1231
293 Ga0466966_0031606 3300044684 Bacteria 3432
294 Ga0466966_0053986 3300044684 Bacteria 2548
295 Ga0453684_0000955 3300044712 Bacteria 95198
296 Ga0453684_0059399 3300044712 Bacteria 4930
297 Ga0453684_0125232 3300044712 Unclassified 3094
298 Ga0466968_0006070 3300044735 Bacteria 4537
299 Ga0466959_0037645 3300045049 Bacteria 3575
300 Ga0451576_0002956 3300045051 Bacteria 24090
301 Ga0466967_0000910 3300045976 Bacteria 15867
302 Ga0495603_0042279 3300046455 Bacteria 2724
303 Ga0495622_0036702 3300046557 Bacteria 2284
304 Ga0495676_0214872 3300047321 Bacteria 1328
305 Ga0495676_0288134 3300047321 Bacteria 1110
306 Ga0495683_0033228 3300047323 Bacteria 2626
307 Ga0496100_0000490 3300048903 Bacteria 19068
308 Ga0496101_0009981 3300048904 Bacteria 6256
309 Ga0496102_0057572 3300048905 Bacteria 3549
310 Ga0496103_0018905 3300048906 Bacteria 4137
311 Ga0496104_0005880 3300048907 Bacteria 10741
312 Ga0496105_0015693 3300048908 Bacteria 6043
313 Ga0496106_0003209 3300048909 Bacteria 12245
314 Ga0496107_0000379 3300048910 Bacteria 24154
315 Ga0496108_0018100 3300048911 Bacteria 5764
316 Ga0496109_0003732 3300048912 Bacteria 12726
317 Ga0496110_0002059 3300048913 Bacteria 14989
318 Ga0496110_0020104 3300048913 Bacteria 5632
319 Ga0496111_0003380 3300048914 Bacteria 9863
320 Ga0496111_0034200 3300048914 Bacteria 3628
321 Ga0496112_0051265 3300048915 Bacteria 4047
322 Ga0496113_0034447 3300048916 Bacteria 3694
323 Ga0496116_0010687 3300048919 Bacteria 7664
324 Ga0496116_0012774 3300048919 Bacteria 6825
325 Ga0496116_0018545 3300048919 Bacteria 5359
326 Ga0496117_0000060 3300048920 Bacteria 258500
327 Ga0496117_0015715 3300048920 Bacteria 6429
328 Ga0496119_0004574 3300048922 Bacteria 13672
329 Ga0496119_0033826 3300048922 Bacteria 3381
330 Ga0496120_0100885 3300048923 Bacteria 1525
331 Ga0496120_0128315 3300048923 Bacteria 1302
332 Ga0496122_0003265 3300048925 Bacteria 21509
333 Ga0496122_0019998 3300048925 Bacteria 6084
334 Ga0496122_0045776 3300048925 Bacteria 3396
335 Ga0496122_0067368 3300048925 Bacteria 2579
336 Ga0496123_0013357 3300048926 Bacteria 6903
337 Ga0496124_0002469 3300048927 Bacteria 24176
338 Ga0496125_0000937 3300048928 Bacteria 45857
339 Ga0496125_0135492 3300048928 Bacteria 1724
340 Ga0496126_0022089 3300048929 Bacteria 6198
341 Ga0496126_0338917 3300048929 Bacteria 1232
342 Ga0501338_01417 3300049554 Bacteria 1279
343 Ga0501031_0005367 3300049568 Bacteria 8346
344 Ga0501032_0007458 3300049569 Bacteria 7988
345 Ga0501032_0035300 3300049569 Bacteria 3419
346 Ga0501032_0294618 3300049569 Bacteria 1049
347 Ga0501033_0000030 3300049570 Bacteria 157953
348 Ga0501033_0064414 3300049570 Bacteria 2697
349 Ga0501034_0000167 3300049571 Bacteria 122702
350 Ga0501034_0004061 3300049571 Bacteria 16425
351 Ga0501034_0035091 3300049571 Bacteria 5086
352 Ga0501034_0078280 3300049571 Bacteria 3311
353 Ga0501034_0092366 3300049571 Bacteria 3024
354 Ga0501036_0018365 3300049572 Bacteria 5857
355 Ga0501036_0035365 3300049572 Bacteria 4228
356 Ga0501037_0024112 3300049573 Bacteria 4498
357 Ga0501037_0037771 3300049573 Bacteria 3561
358 Ga0501038_0006084 3300049574 Bacteria 11165
359 Ga0501038_0098022 3300049574 Bacteria 2445
360 Ga0501038_0170020 3300049574 Bacteria 1765
361 Ga0501039_0002194 3300049575 Bacteria 14438
362 Ga0501043_0019729 3300049579 Bacteria 5294
363 Ga0501047_0026638 3300049581 Bacteria 5564
364 Ga0501047_0218794 3300049581 Bacteria 1761
365 Ga0501047_0402699 3300049581 Bacteria 1201
366 Ga0501047_0555960 3300049581 Bacteria 972
367 Ga0501067_0000995 3300049583 Bacteria 15223
368 Ga0501068_0001203 3300049584 Bacteria 13760
369 Ga0501068_0011371 3300049584 Bacteria 5023
370 Ga0501069_0008950 3300049585 Bacteria 5281
371 Ga0501069_0016528 3300049585 Bacteria 3964
372 Ga0501070_0002778 3300049586 Bacteria 15275
373 Ga0501070_0026845 3300049586 Bacteria 4829
374 Ga0501070_0053151 3300049586 Bacteria 3361
375 Ga0501071_0001301 3300049587 Bacteria 14219
376 Ga0501071_0003120 3300049587 Bacteria 10290
377 Ga0501072_0001835 3300049588 Bacteria 15821
378 Ga0501073_0036870 3300049589 Bacteria 3472
379 Ga0501073_0071182 3300049589 Bacteria 2423
380 Ga0501074_0003633 3300049590 Bacteria 10948
381 Ga0501074_0029871 3300049590 Bacteria 3949
382 Ga0501076_0185388 3300049592 Bacteria 1697
383 Ga0501079_0067114 3300049741 Bacteria 2768
384 Ga0501080_0021377 3300049742 Bacteria 5989
385 Ga0501080_0131463 3300049742 Bacteria 2318
386 Ga0501080_0464889 3300049742 Bacteria 1133
387 Ga0501081_0164271 3300049743 Bacteria 1601
388 Ga0501083_0001801 3300049744 Bacteria 14661
389 Ga0501035_0027991 3300049822 Bacteria 5148
390 Ga0501044_0031962 3300049823 Bacteria 5533
391 Ga0501044_0070825 3300049823 Bacteria 3546
392 Ga0501044_0172520 3300049823 Bacteria 2133
393 Ga0501044_0398650 3300049823 Bacteria 1289
394 Ga0501045_0008602 3300049824 Bacteria 7113
395 Ga0501084_0002354 3300054114 Bacteria 15203
396 Ga0501082_0004613 3300060353 Bacteria 12032
397 2511177848 2510917027 Bacteria 5287437
398 2512641371 2512564013 Bacteria 6286191
399 2512734168 2512564039 Bacteria 8739048
400 2524191291 2524023129 Bacteria 6762600
401 2555470724 2554235283 Bacteria 3683090
402 2587740974 2585428059 Bacteria 8696589
403 2595316209 2593339198 Bacteria 7267884
404 2600199080 2599185353 Bacteria 2219443
405 2600400718 2600254943 Bacteria 2613887
406 2643739545 2643221543 Bacteria 6628015
407 2644422287 2643221676 Bacteria 8119172
408 2644707835 2643221729 Bacteria 6621700
409 2644712135 2643221730 Bacteria 6523787
410 2644721069 2643221731 Bacteria 5623886
411 2644722527 2643221732 Bacteria 5756404
412 2644739356 2643221735 Bacteria 3676263
413 2672334663 2671180330 Bacteria 5521719
414 2673822370 2671180694 Bacteria 7506943
415 2685149011 2684622632 Bacteria 5380049
416 2686996238 2684623153 Bacteria 3878815
417 2687497489 2687453109 Bacteria 3860091
418 2698324154 2695420987 Bacteria 6152737
419 2705993056 2703719227 Bacteria 5631989
420 2721504414 2718218445 Bacteria 5113413
421 2738812543 2738541295 Bacteria 5730091
422 2738838165 2738541299 Bacteria 4020721
423 2739156648 2738541358 Bacteria 5932299
424 2739210249 2738543006 Bacteria 5904091
425 2739231941 2738543010 Bacteria 5583595
426 2740990824 2740891818 Bacteria 6711283
427 2745169928 2744054657 Bacteria 5016802
428 2791215215 2788500588 Bacteria 4584915
429 2793182375 2791355222 Bacteria 5898266
430 2808868163 2808606364 Bacteria 4465927
431 2812315361 2811994870 Bacteria 3776934
432 2816863519 2816332186 Bacteria 5331395
433 2817479228 2816332295 Bacteria 4352468
434 2817619094 2816332336 Bacteria 5207640
435 2819570067 2818991441 Bacteria 5062707
436 2819582831 2818991443 Bacteria 6598732
437 2819628209 2818991451 Bacteria 4697364
438 2819669037 2818991459 Bacteria 8736032
439 2819711631 2818991465 Bacteria 5388835
440 2819725209 2818991468 Bacteria 3723169
441 2823527340 2823526263 Bacteria 3765752
442 2842685579 2842682962 Bacteria 5589973
443 2842887195 2842882022 Bacteria 6158489
444 2849140420 2849139964 Bacteria 5613304
445 2852674663 2852673933 Bacteria 3347676
446 2857453980 2857453340 Bacteria 8090534
447 2857463009 2857460504 Bacteria 5194327
448 2857472436 2857465823 Bacteria 6772595
449 2857474921 2857472729 Bacteria 6568124
450 2857584821 2857581216 Bacteria 5522813
451 2857594410 2857591370 Bacteria 6569758
452 2857605685 2857604169 Bacteria 5111450
453 2857612080 2857609550 Bacteria 3753890
454 2858440098 2858438669 Bacteria 2058402
455 2881649848 2881644220 Bacteria 5302661
456 2888580152 2888578766 Bacteria 6743310
457 2889051192 2889049205 Bacteria 7524325
458 2904116420 2904113452 Bacteria 7796941
459 2904529626 2904524088 Bacteria 5887454
460 2904610427 2904606771 Bacteria 4684500
461 2904762228 2904755435 Bacteria 7986759
462 2908666441 2908665501 Bacteria 3678115
463 2915603407 2915597211 Bacteria 6475886
464 2915608278 2915606848 Bacteria 6032732
465 2916973661 2916971899 Bacteria 4250608
466 2919093444 2919093281 Bacteria 3660974
467 2919148862 2919143609 Bacteria 6219228
468 2919429320 2919425241 Bacteria 8055701
469 2919522328 2919517244 Bacteria 5858162
470 2919725499 2919720352 Bacteria 5986006
471 2919729646 2919726948 Bacteria 3696050
472 2925327291 2925326138 Bacteria 9652120
473 2928099208 2928093941 Bacteria 5965005
474 2928511342 2928510474 Bacteria 4815308
475 2928520605 2928519762 Bacteria 1953908
476 2929009182 2929004312 Bacteria 5678476
477 2929188515 2929183550 Bacteria 6377511
478 2929234281 2929233124 Bacteria 5948380
479 2936364722 2936361878 Bacteria 5632809
480 2938918460 2938917290 Bacteria 5914775
481 2939596097 2939593269 Bacteria 4798695
482 2939616638 2939615513 Bacteria 2384962
483 2947427810 2947426588 Bacteria 5357194
484 2954775153 2954773129 Bacteria 3741715
485 2960324697 2960319331 Bacteria 5502575
486 2960378130 2960375949 Bacteria 5361395
487 2965762322 2965761152 Bacteria 5806513
488 2971416923 2971410472 Bacteria 8311090
489 2977258780 2977254563 Bacteria 4828420
490 2979084732 2979083700 Bacteria 5894929
491 2990279805 2990275345 Bacteria 4887158
492 3001267204 3001267043 Bacteria 4823521
493 3001272680 3001272096 Bacteria 4729684
494 3001893869 3001892409 Bacteria 6328293
495 3006831653 3006826541 Bacteria 4678913
496 3006859552 3006858327 Bacteria 4317835
497 3006969944 3006969106 Bacteria 4739423
498 3006974267 3006973921 Bacteria 4423788
499 3006978751 3006978542 Bacteria 5328100
500 3006985881 3006984091 Bacteria 4207523
501 3006989967 3006988479 Bacteria 4767936
502 8002322838 8002317523 Bacteria 8051857
503 8007372205 8007371054 Bacteria 4849201
504 8007374476 8007371054 Bacteria 4849201
505 8022622236 8022621104 Bacteria 5241040
506 8022798708 8022792930 Bacteria 5693794
507 8022894691 8022893055 Bacteria 5300455
508 8022915147 8022914991 Bacteria 5584517
509 8022951320 8022948649 Bacteria 5366783
510 8023443389 8023438354 Bacteria 5779374
511 8023449310 8023444577 Bacteria 5661597
512 8046998978 8046991243 Bacteria 8497463
513 8054804703 8054795415 Bacteria 9785225
514 8055536344 8055531788 Bacteria 5249694
515 8055635680 8055632911 Bacteria 5283357
516 8056533924 8056533031 Bacteria 8964429
517 8057477999 8057473075 Bacteria 5892720
518 8057583816 8057582654 Bacteria 5218944
519 8057633765 8057632132 Bacteria 4726859
520 8057734619 8057733483 Bacteria 6578323
521 Ga0070659_100080944
522 JGI25159J45721_1003482
523 JGI25159J45721_1007371
524 JGI25151J46595_10000009
525 JGI25151J46595_10009468
526 JGI25151J46595_10010928
527 JGI25151J46595_10021248
528 JGI25151J46595_10029903
529 JGI25151J46595_10030718
530 JGI25151J46595_10041637
531 rootH1_10025147
532 rootL2_10017596
533 rootH1_10036582
534 Ga0006562J51391_1001382
535 Ga0006562J51391_1003939
536 Ga0055538_1000709
537 Ga0055532_1009420
538 Ga0055535_1003668
539 Ga0055528_1005766
540 Ga0055528_1007497
541 Ga0055541_1001295
542 Ga0070658_10001978
543 Ga0070658_10007321
544 Ga0070658_10031585
545 Ga0070658_10189868
546 Ga0070683_100028915
547 Ga0070683_100055419
548 Ga0070683_100063840
549 Ga0070683_100073745
550 Ga0070683_100134243
551 Ga0070683_100318727
552 Ga0070680_100007796
553 Ga0070680_100012060
554 Ga0070680_100015201
555 Ga0070680_100133531
556 Ga0070680_100136735
557 Ga0070682_100114690
558 Ga0070660_100013594
559 Ga0070660_100082756
560 Ga0070691_10024759
561 Ga0070661_100049531
562 Ga0070668_100065789
563 Ga0070659_100015973
564 Ga0070659_100133625
565 Ga0070659_100169877
566 Ga0070709_10200898
567 Ga0070714_100003830
568 Ga0070714_100005187
569 Ga0070714_100028991
570 Ga0070663_100053050
571 Ga0070663_100061714
572 Ga0070663_100169776
573 Ga0070663_100358510
574 Ga0070681_10007878
575 Ga0070681_10025345
576 Ga0070681_10048069
577 Ga0070681_10072360
578 Ga0070681_10079104
579 Ga0070681_10589234
580 Ga0070699_100030059
581 Ga0070679_100004305
582 Ga0070679_100004437
583 Ga0070679_100017203
584 Ga0070679_100022983
585 Ga0070679_100042380
586 Ga0070679_100134592
587 Ga0070679_100138927
588 Ga0070679_100272367
589 Ga0070684_100027675
590 Ga0070684_100046069
591 Ga0070684_100121303
592 Ga0068853_100027367
593 Ga0070672_100044961
594 Ga0070672_100078240
595 Ga0070696_100008407
596 Ga0070696_100047065
597 Ga0070665_100245170
598 Ga0068855_100026052
599 Ga0068855_100167159
600 Ga0068855_100243887
601 Ga0070664_100016998
602 Ga0070664_100073163
603 Ga0068854_100028371
604 Ga0068854_100050743
605 Ga0068856_100158866
606 Ga0068856_100162900
607 Ga0068856_100471747
608 Ga0068852_100046297
609 Ga0068852_100152529
610 Ga0068852_100204383
611 Ga0070717_10160410
612 Ga0075436_100023244
613 Ga0105251_10013695
614 Ga0105251_10046698
615 Ga0105250_10003739
616 Ga0105250_10026509
617 Ga0105240_10050512
618 Ga0105240_10153630
619 Ga0105240_10233065
620 Ga0105245_10211359
621 Ga0105247_10053008
622 Ga0105243_10002585
623 Ga0105242_10157191
624 Ga0105238_10069228
625 Ga0105238_10072520
626 Ga0105238_10140751
627 Ga0105249_10000009
628 Ga0105246_10004986
629 Ga0105246_10019281
630 Ga0157373_10005892
631 Ga0157373_10031767
632 Ga0157373_10040035
633 Ga0157373_10048566
634 Ga0157371_10036248
635 Ga0157371_10114038
636 Ga0157370_10019658
637 Ga0157370_10025870
638 Ga0157370_10110406
639 Ga0157370_10349391
640 Ga0157369_10009308
641 Ga0157369_10035844
642 Ga0157369_10055081
643 Ga0157369_10115338
644 Ga0157369_10136245
645 Ga0157369_10442865
646 Ga0157369_10450842
647 Ga0157374_10332664
648 Ga0157378_10020113
649 Ga0157372_10010412
650 Ga0157372_10025884
651 Ga0157372_10048555
652 Ga0157372_10068736
653 Ga0157372_10101697
654 Ga0157372_10103755
655 Ga0157372_10323043
656 Ga0157372_10379656
657 Ga0157372_10456772
658 Ga0157375_10818855
659 Ga0182008_10029881
660 Ga0157377_10112174
661 Ga0206354_11643509
662 Ga0213876_10039125
663 Ga0209784_100178
664 Ga0209566_100133
665 Ga0209566_100144
666 Ga0209566_100417
667 Ga0209147_100069
668 Ga0209147_101481
669 Ga0209147_106669
670 Ga0209258_104560
671 Ga0209673_1003272
672 Ga0209130_1000311
673 Ga0209130_1005287
674 Ga0209675_1008234
675 Ga0209676_1000844
676 Ga0209676_1020970
677 Ga0209676_1037339
678 Ga0209025_1000001
679 Ga0209025_1000209
680 Ga0209025_1000616
681 Ga0209025_1001238
682 Ga0209025_1001550
683 Ga0209025_1003250
684 Ga0209025_1004828
685 Ga0209025_1005845
686 Ga0209025_1013841
687 Ga0209025_1014767
688 Ga0209025_1017206
689 Ga0209025_1030138
690 Ga0209025_1032590
691 Ga0207426_1028824
692 Ga0207696_1004554
693 Ga0207696_1005979
694 Ga0207655_1005394
695 Ga0207713_1003689
696 Ga0207713_1031112
697 Ga0207710_10132313
698 Ga0207705_10004588
699 Ga0207705_10012034
700 Ga0207705_10072297
701 Ga0207707_10004233
702 Ga0207707_10007682
703 Ga0207707_10033234
704 Ga0207695_10008938
705 Ga0207695_10032565
706 Ga0207695_10046022
707 Ga0207695_10046809
708 Ga0207695_10075929
709 Ga0207695_10112309
710 Ga0207695_10338847
711 Ga0207671_10133841
712 Ga0207660_10002202
713 Ga0207660_10010646
714 Ga0207660_10025378
715 Ga0207660_10162532
716 Ga0207660_10197670
717 Ga0207657_10001243
718 Ga0207657_10028131
719 Ga0207657_10106434
720 Ga0207657_10147627
721 Ga0207657_10269062
722 Ga0207649_10061890
723 Ga0207652_10001195
724 Ga0207652_10002768
725 Ga0207652_10026651
726 Ga0207652_10031954
727 Ga0207652_10042679
728 Ga0207652_10052114
729 Ga0207652_10131396
730 Ga0207652_10156989
731 Ga0207652_10226110
732 Ga0207652_10413072
733 Ga0207694_10080132
734 Ga0207694_10147165
735 Ga0207687_10285648
736 Ga0207664_10056683
737 Ga0207690_10018348
738 Ga0207690_10072271
739 Ga0207690_10077448
740 Ga0207709_10006359
741 Ga0207661_10001309
742 Ga0207661_10004803
743 Ga0207661_10056352
744 Ga0207661_10066679
745 Ga0207661_10099107
746 Ga0207679_10004518
747 Ga0207679_10030390
748 Ga0207667_10098440
749 Ga0207667_10130399
750 Ga0207667_10149694
751 Ga0207667_10317810
752 Ga0207667_10353473
753 Ga0207667_10400399
754 Ga0207651_10207121
755 Ga0207712_10000077
756 Ga0207712_10445289
757 Ga0207668_10060786
758 Ga0207640_10011317
759 Ga0207640_10045359
760 Ga0207678_10016217
761 Ga0207678_10043687
762 Ga0207678_10417158
763 Ga0207702_10120002
764 Ga0207702_10126958
765 Ga0207702_10139744
766 Ga0207702_10447520
767 Ga0207698_10042844
768 Ga0207698_10122316
769 Ga0207698_10170294
770 Ga0207698_10191166
771 Ga0209371_1001082
772 Ga0268266_10235147
773 Ga0237817_10231
774 Ga0237817_10324
775 Ga0268256_1000917
776 Ga0307408_100065436
777 Ga0307408_100067459
778 Ga0307405_10213606
779 Ga0307413_10006193
780 Ga0307413_10009395
781 Ga0307413_10157470
782 Ga0307413_10259946
783 Ga0307410_10089742
784 Ga0307406_10055965
785 Ga0307412_10081183
786 Ga0307412_10194316
787 Ga0307409_100011318
788 Ga0307409_100039231
789 Ga0307416_100006790
790 Ga0307416_100087773
791 Ga0307416_100092975
792 Ga0307414_10081827
793 Ga0307411_10008033
794 Ga0307411_10111455
795 Ga0307411_10234440
796 Ga0316582_0019519
797 Ga0316582_0090008
798 Ga0316582_0305219
799 Ga0395899_0008040
800 Ga0395899_0048588
801 Ga0395899_0171192
802 Ga0395900_0043098
803 Ga0395905_0034926
804 Ga0395905_0143061
805 Ga0395905_0248205
806 Ga0395901_0002411
807 Ga0237819_01147
808 Ga0436365_1520238
809 Ga0439449_0033286
810 Ga0466969_0027620
811 Ga0453683_0017376
812 Ga0466965_0146905
813 Ga0466966_0031606
814 Ga0466966_0053986
815 Ga0453684_0000955
816 Ga0453684_0059399
817 Ga0453684_0125232
818 Ga0466968_0006070
819 Ga0466959_0037645
820 Ga0451576_0002956
821 Ga0466967_0000910
822 Ga0495603_0042279
823 Ga0495622_0036702
824 Ga0495676_0214872
825 Ga0495676_0288134
826 Ga0495683_0033228
827 Ga0496100_0000490
828 Ga0496101_0009981
829 Ga0496102_0057572
830 Ga0496103_0018905
831 Ga0496104_0005880
832 Ga0496105_0015693
833 Ga0496106_0003209
834 Ga0496107_0000379
835 Ga0496108_0018100
836 Ga0496109_0003732
837 Ga0496110_0002059
838 Ga0496110_0020104
839 Ga0496111_0003380
840 Ga0496111_0034200
841 Ga0496112_0051265
842 Ga0496113_0034447
843 Ga0496116_0010687
844 Ga0496116_0012774
845 Ga0496116_0018545
846 Ga0496117_0000060
847 Ga0496117_0015715
848 Ga0496119_0004574
849 Ga0496119_0033826
850 Ga0496120_0100885
851 Ga0496120_0128315
852 Ga0496122_0003265
853 Ga0496122_0019998
854 Ga0496122_0045776
855 Ga0496122_0067368
856 Ga0496123_0013357
857 Ga0496124_0002469
858 Ga0496125_0000937
859 Ga0496125_0135492
860 Ga0496126_0022089
861 Ga0496126_0338917
862 Ga0501338_01417
863 Ga0501031_0005367
864 Ga0501032_0007458
865 Ga0501032_0035300
866 Ga0501032_0294618
867 Ga0501033_0000030
868 Ga0501033_0064414
869 Ga0501034_0000167
870 Ga0501034_0004061
871 Ga0501034_0035091
872 Ga0501034_0078280
873 Ga0501034_0092366
874 Ga0501036_0018365
875 Ga0501036_0035365
876 Ga0501037_0024112
877 Ga0501037_0037771
878 Ga0501038_0006084
879 Ga0501038_0098022
880 Ga0501038_0170020
881 Ga0501039_0002194
882 Ga0501043_0019729
883 Ga0501047_0026638
884 Ga0501047_0218794
885 Ga0501047_0402699
886 Ga0501047_0555960
887 Ga0501067_0000995
888 Ga0501068_0001203
889 Ga0501068_0011371
890 Ga0501069_0008950
891 Ga0501069_0016528
892 Ga0501070_0002778
893 Ga0501070_0026845
894 Ga0501070_0053151
895 Ga0501071_0001301
896 Ga0501071_0003120
897 Ga0501072_0001835
898 Ga0501073_0036870
899 Ga0501073_0071182
900 Ga0501074_0003633
901 Ga0501074_0029871
902 Ga0501076_0185388
903 Ga0501079_0067114
904 Ga0501080_0021377
905 Ga0501080_0131463
906 Ga0501080_0464889
907 Ga0501081_0164271
908 Ga0501083_0001801
909 Ga0501035_0027991
910 Ga0501044_0031962
911 Ga0501044_0070825
912 Ga0501044_0172520
913 Ga0501044_0398650
914 Ga0501045_0008602
915 Ga0501084_0002354
916 Ga0501082_0004613
917 2511177848
918 2512641371
919 2512734168
920 2524191291
921 2555470724
922 2587740974
923 2595316209
924 2600199080
925 2600400718
926 2643739545
927 2644422287
928 2644707835
929 2644712135
930 2644721069
931 2644722527
932 2644739356
933 2672334663
934 2673822370
935 2685149011
936 2686996238
937 2687497489
938 2698324154
939 2705993056
940 2721504414
941 2738812543
942 2738838165
943 2739156648
944 2739210249
945 2739231941
946 2740990824
947 2745169928
948 2791215215
949 2793182375
950 2808868163
951 2812315361
952 2816863519
953 2817479228
954 2817619094
955 2819570067
956 2819582831
957 2819628209
958 2819669037
959 2819711631
960 2819725209
961 2823527340
962 2842685579
963 2842887195
964 2849140420
965 2852674663
966 2857453980
967 2857463009
968 2857472436
969 2857474921
970 2857584821
971 2857594410
972 2857605685
973 2857612080
974 2858440098
975 2881649848
976 2888580152
977 2889051192
978 2904116420
979 2904529626
980 2904610427
981 2904762228
982 2908666441
983 2915603407
984 2915608278
985 2916973661
986 2919093444
987 2919148862
988 2919429320
989 2919522328
990 2919725499
991 2919729646
992 2925327291
993 2928099208
994 2928511342
995 2928520605
996 2929009182
997 2929188515
998 2929234281
999 2936364722
1000 2938918460
1001 2939596097
1002 2939616638
1003 2947427810
1004 2954775153
1005 2960324697
1006 2960378130
1007 2965762322
1008 2971416923
1009 2977258780
1010 2979084732
1011 2990279805
1012 3001267204
1013 3001272680
1014 3001893869
1015 3006831653
1016 3006859552
1017 3006969944
1018 3006974267
1019 3006978751
1020 3006985881
1021 3006989967
1022 8002322838
1023 8007372205
1024 8007374476
1025 8022622236
1026 8022798708
1027 8022894691
1028 8022915147
1029 8022951320
1030 8023443389
1031 8023449310
1032 8046998978
1033 8054804703
1034 8055536344
1035 8055635680
1036 8056533924
1037 8057477999
1038 8057583816
1039 8057633765
1040 8057734619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10437

Lip_prot_lig_C

Bacterial lipoate protein ligase C-terminus

294

378

0.98

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

52

244

0.97

PF03099

BPL_LplA_LipB

Biotin/lipoate A/B protein ligase family

84

196

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8crj-assembly1.cif.gz_A crystal structure of lpla1 in complex with lipoyl-amp (listeria monocytogenes) 0.9199 1 329
8crj-assembly1.cif.gz_A crystal structure of lpla1 in complex with lipoyl-amp (listeria monocytogenes) 0.9172 1 329
3r07-assembly1.cif.gz_A structural analysis of an archaeal lipoylation system. a bi-partite lipoate protein ligase and its e2 lipoyl domain from thermoplasma acidophilum 0.877 2 247
2aru-assembly1.cif.gz_A crystal structure of lipoate-protein ligase a bound with atp 0.867 11 243
2c7i-assembly2.cif.gz_B structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. 0.8593 2 242
ID Description Score Start End Superfamily
af_Q2FZN7_2_241_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9606 3 241 3.30.930.10
af_Q2FZN7_2_241_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9488 3 241 3.30.930.10
af_Q2G147_253_340_3.30.390.50 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.9433 244 328 3.30.390.50
af_Q2FZN7_242_328_3.30.390.50 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.9272 244 329 3.30.390.50
af_Q2FZN7_242_328_3.30.390.50 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.9067 244 329 3.30.390.50
ID Description Score Start End GO Terms
AF-A0A2T6ESI9-F1-model_v4 deleted 1.003 1 106
AF-A0A2M9MTW8-F1-model_v4 deleted 0.9998 249 328
AF-A0A3D1G825-F1-model_v4 Lipoate--protein ligase 0.9954 1 155 GO:0005737
GO:0016979
GO:0017118
AF-A0A3D1G825-F1-model_v4 Lipoate--protein ligase 0.9891 1 155 GO:0005737
GO:0016979
GO:0017118
AF-A0A2T6ESI9-F1-model_v4 deleted 0.9844 1 106

Map