F458476
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 519 | 311 | 1038 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300053121|Ga0500607_005859|Ga0500607_005859_1955_2872 |
| Length | 297 |
| Sequence | MVYGDVESTSRSVAPFRPGMRNNEHLLYLPQSSNGSPRIHGSQVSFHFHRTMPISHLTLITGASRGLGRAMAEQLLQAGHVVLGISRKQDPQLAELAKAAGAELTQWEQDLSDPVAASARVSAWLKTIDPQRFDSVTLINNAGTVGNPAPLASAVGAELEAPMLLTAAVLGATREWRGARKVLNISSGLGRNAMGSQAPYCAAKAGMDHFSRAVALEEAAAPNGARIVSLAPGIIDTDMQVQLRGASAENFPDRTRFVSMKEEGRLDSPATAAAKVLKYLARADFGNNPVADVRDPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 65 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 66 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 132 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 137 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 138 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 139 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 140 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 143 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 144 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 145 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 146 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 148 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 155 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 156 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 157 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 158 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 159 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 160 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 161 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 162 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 163 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 164 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 165 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 166 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 167 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 168 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 169 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 170 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 171 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 172 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 173 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 174 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 175 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 176 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 177 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 178 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 179 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 180 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 181 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 182 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 186 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 217 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 224 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 225 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 226 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 227 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 228 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 229 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 230 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 231 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 232 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 233 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 234 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 235 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 236 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 237 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 238 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 239 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 240 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 241 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 242 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 243 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 246 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 248 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 249 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 250 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 251 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 252 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 253 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 254 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 255 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 256 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 257 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 258 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 259 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 260 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 261 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 262 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 263 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 264 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 265 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 266 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 267 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 268 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 269 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 270 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 271 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 272 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 273 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 274 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 275 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 276 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 277 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 278 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 279 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 280 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 281 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 282 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 283 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 284 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 285 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 286 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 287 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 288 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 289 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 290 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 291 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 292 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 293 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 294 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 295 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 296 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 297 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 298 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 299 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 300 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 301 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 302 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 303 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 304 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 305 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 306 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 307 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 308 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 309 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 310 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 311 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.14 |
| Metatranscriptomes | 0.77 |
| Isolates | 8.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 35.45 |
| Nodule | 1.16 |
| Rhizoplane | 3.28 |
| Rhizosphere | 48.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500607_005859 | 3300053121 | Bacteria | 7913 |
| 2 | JGI24740J21852_10058899 | 3300001979 | Bacteria | 1066 |
| 3 | JGI24739J22299_10024071 | 3300001989 | Bacteria | 2149 |
| 4 | JGI24735J21928_10087803 | 3300002067 | Bacteria | 891 |
| 5 | JGI25158J39367_1003572 | 3300002739 | Bacteria | 2390 |
| 6 | JGI25152J39213_1007449 | 3300002773 | Bacteria | 2832 |
| 7 | JGI25152J39213_1009752 | 3300002773 | Bacteria | 2254 |
| 8 | JGI25152J39213_1021572 | 3300002773 | Bacteria | 1127 |
| 9 | JGI25150J39212_1000718 | 3300002774 | Bacteria | 11846 |
| 10 | JGI25150J39212_1003558 | 3300002774 | Bacteria | 3636 |
| 11 | JGI25150J39212_1007071 | 3300002774 | Bacteria | 2278 |
| 12 | JGI25159J45721_1006329 | 3300002987 | Bacteria | 3558 |
| 13 | JGI25159J45721_1007465 | 3300002987 | Bacteria | 3131 |
| 14 | JGI25159J45721_1017077 | 3300002987 | Bacteria | 1516 |
| 15 | JGI25151J46595_10002213 | 3300003187 | Bacteria | 12014 |
| 16 | JGI25151J46595_10008367 | 3300003187 | Bacteria | 4982 |
| 17 | JGI25151J46595_10009581 | 3300003187 | Bacteria | 4570 |
| 18 | JGI25151J46595_10028103 | 3300003187 | Bacteria | 2244 |
| 19 | JGI25153J46596_10012560 | 3300003215 | Bacteria | 3644 |
| 20 | rootH1_10013655 | 3300003316 | Bacteria | 6605 |
| 21 | rootL2_10142366 | 3300003322 | Bacteria | 2711 |
| 22 | rootH1_10030043 | 3300003323 | Bacteria | 4714 |
| 23 | JGI25160J50197_1008199 | 3300003354 | Bacteria | 4002 |
| 24 | JGI25160J50197_1008298 | 3300003354 | Bacteria | 3966 |
| 25 | JGI25161J50226_1002701 | 3300003374 | Bacteria | 4397 |
| 26 | JGI25161J50226_1004046 | 3300003374 | Bacteria | 3160 |
| 27 | Ga0006562J51391_1112371 | 3300003578 | Bacteria | 3710 |
| 28 | Ga0006562J51391_1112372 | 3300003578 | Bacteria | 2544 |
| 29 | Ga0006562J51391_1181373 | 3300003578 | Bacteria | 1810 |
| 30 | Ga0006562J51391_1181374 | 3300003578 | Bacteria | 1630 |
| 31 | Ga0055535_1002469 | 3300003761 | Bacteria | 6411 |
| 32 | Ga0055542_1000003 | 3300003762 | Bacteria | 582721 |
| 33 | Ga0055526_1013030 | 3300003771 | Bacteria | 3558 |
| 34 | Ga0055537_1000819 | 3300003773 | Bacteria | 15272 |
| 35 | Ga0055537_1003007 | 3300003773 | Bacteria | 5332 |
| 36 | Ga0055524_1011028 | 3300003775 | Bacteria | 3558 |
| 37 | Ga0055524_1013422 | 3300003775 | Bacteria | 3088 |
| 38 | Ga0055536_1006783 | 3300003781 | Bacteria | 5243 |
| 39 | Ga0055536_1009299 | 3300003781 | Bacteria | 4082 |
| 40 | Ga0055536_1010143 | 3300003781 | Bacteria | 3781 |
| 41 | Ga0055534_1001205 | 3300003784 | Bacteria | 10841 |
| 42 | Ga0055534_1003154 | 3300003784 | Bacteria | 5336 |
| 43 | Ga0055528_1006417 | 3300003790 | Bacteria | 5336 |
| 44 | Ga0055528_1007537 | 3300003790 | Bacteria | 4799 |
| 45 | Ga0055530_10004055 | 3300003791 | Bacteria | 7855 |
| 46 | Ga0055530_10008763 | 3300003791 | Bacteria | 3998 |
| 47 | Ga0055540_1006642 | 3300003792 | Bacteria | 4544 |
| 48 | Ga0055540_1007817 | 3300003792 | Bacteria | 3961 |
| 49 | Ga0055540_1008258 | 3300003792 | Bacteria | 3775 |
| 50 | Ga0055540_1008834 | 3300003792 | Bacteria | 3572 |
| 51 | Ga0055531_10008762 | 3300003794 | Bacteria | 5278 |
| 52 | Ga0055531_10009563 | 3300003794 | Bacteria | 4942 |
| 53 | Ga0055531_10022162 | 3300003794 | Bacteria | 2432 |
| 54 | Ga0055531_10025590 | 3300003794 | Bacteria | 2137 |
| 55 | Ga0055543_1003699 | 3300004625 | Bacteria | 4390 |
| 56 | Ga0055543_1012629 | 3300004625 | Bacteria | 1690 |
| 57 | Ga0065165_1012771 | 3300005262 | Bacteria | 3395 |
| 58 | Ga0065165_1012863 | 3300005262 | Bacteria | 3373 |
| 59 | Ga0065165_1013939 | 3300005262 | Bacteria | 3151 |
| 60 | Ga0065714_10082236 | 3300005288 | Bacteria | 2321 |
| 61 | Ga0070677_10019494 | 3300005333 | Bacteria | 2457 |
| 62 | Ga0068869_100153808 | 3300005334 | Bacteria | 1786 |
| 63 | Ga0070666_10176868 | 3300005335 | Bacteria | 1496 |
| 64 | Ga0070660_100378137 | 3300005339 | Bacteria | 1169 |
| 65 | Ga0070668_100151171 | 3300005347 | Bacteria | 1878 |
| 66 | Ga0070669_100131374 | 3300005353 | Bacteria | 1921 |
| 67 | Ga0070674_100060272 | 3300005356 | Bacteria | 2645 |
| 68 | Ga0070673_100072689 | 3300005364 | Bacteria | 2766 |
| 69 | Ga0070659_100468388 | 3300005366 | Bacteria | 1071 |
| 70 | Ga0070667_100008514 | 3300005367 | Bacteria | 8502 |
| 71 | Ga0070667_100070420 | 3300005367 | Bacteria | 2977 |
| 72 | Ga0070678_100018582 | 3300005456 | Bacteria | 4507 |
| 73 | Ga0070678_100314913 | 3300005456 | Bacteria | 1334 |
| 74 | Ga0070662_100015807 | 3300005457 | Bacteria | 5061 |
| 75 | Ga0070662_100097017 | 3300005457 | Bacteria | 2224 |
| 76 | Ga0068867_100418224 | 3300005459 | Bacteria | 1135 |
| 77 | Ga0068853_100024482 | 3300005539 | Bacteria | 5061 |
| 78 | Ga0068853_100545391 | 3300005539 | Bacteria | 1098 |
| 79 | Ga0070665_100014019 | 3300005548 | Bacteria | 8058 |
| 80 | Ga0070665_100063617 | 3300005548 | Bacteria | 3699 |
| 81 | Ga0070665_100076707 | 3300005548 | Bacteria | 3349 |
| 82 | Ga0070665_100157994 | 3300005548 | Bacteria | 2269 |
| 83 | Ga0070665_100225190 | 3300005548 | Bacteria | 1875 |
| 84 | Ga0068855_100023604 | 3300005563 | Bacteria | 7366 |
| 85 | Ga0070664_100015785 | 3300005564 | Bacteria | 6182 |
| 86 | Ga0070664_100158382 | 3300005564 | Bacteria | 2002 |
| 87 | Ga0068854_100085141 | 3300005578 | Bacteria | 2341 |
| 88 | Ga0068852_100094223 | 3300005616 | Bacteria | 2686 |
| 89 | Ga0068852_100106171 | 3300005616 | Bacteria | 2545 |
| 90 | Ga0068852_100652271 | 3300005616 | Bacteria | 1060 |
| 91 | Ga0068851_10003855 | 3300005834 | Bacteria | 6711 |
| 92 | Ga0068862_100056123 | 3300005844 | Bacteria | 3374 |
| 93 | Ga0075365_10075163 | 3300006038 | Bacteria | 2279 |
| 94 | Ga0075363_100009573 | 3300006048 | Bacteria | 4560 |
| 95 | Ga0075363_100029571 | 3300006048 | Bacteria | 2830 |
| 96 | Ga0075363_100086724 | 3300006048 | Bacteria | 1719 |
| 97 | Ga0075364_10019647 | 3300006051 | Bacteria | 4241 |
| 98 | Ga0075364_10257974 | 3300006051 | Bacteria | 1185 |
| 99 | Ga0075432_10014618 | 3300006058 | Bacteria | 2672 |
| 100 | Ga0075432_10067177 | 3300006058 | Bacteria | 1284 |
| 101 | Ga0075362_10002300 | 3300006177 | Bacteria | 6384 |
| 102 | Ga0075362_10004470 | 3300006177 | Bacteria | 5032 |
| 103 | Ga0075362_10008027 | 3300006177 | Bacteria | 4022 |
| 104 | Ga0075362_10052028 | 3300006177 | Bacteria | 1834 |
| 105 | Ga0075367_10061213 | 3300006178 | Bacteria | 2246 |
| 106 | Ga0075369_10124818 | 3300006186 | Bacteria | 1167 |
| 107 | Ga0075366_10000230 | 3300006195 | Bacteria | 24874 |
| 108 | Ga0075366_10016881 | 3300006195 | Bacteria | 4195 |
| 109 | Ga0075366_10025184 | 3300006195 | Bacteria | 3473 |
| 110 | Ga0075366_10053055 | 3300006195 | Bacteria | 2408 |
| 111 | Ga0097621_100563732 | 3300006237 | Bacteria | 1038 |
| 112 | Ga0075370_10007439 | 3300006353 | Bacteria | 5579 |
| 113 | Ga0075370_10019410 | 3300006353 | Bacteria | 3702 |
| 114 | Ga0075370_10028947 | 3300006353 | Bacteria | 3082 |
| 115 | Ga0075370_10061716 | 3300006353 | Bacteria | 2135 |
| 116 | Ga0075370_10071425 | 3300006353 | Bacteria | 1986 |
| 117 | Ga0075370_10088022 | 3300006353 | Bacteria | 1790 |
| 118 | Ga0068871_100309202 | 3300006358 | Bacteria | 1389 |
| 119 | Ga0075429_100002953 | 3300006880 | Bacteria | 14422 |
| 120 | Ga0079104_1000007 | 3300006946 | Bacteria | 390531 |
| 121 | Ga0099826_10018393 | 3300006948 | Bacteria | 5273 |
| 122 | Ga0105244_10004236 | 3300009036 | Bacteria | 9954 |
| 123 | Ga0105250_10023612 | 3300009092 | Bacteria | 2478 |
| 124 | Ga0105240_10013451 | 3300009093 | Bacteria | 11239 |
| 125 | Ga0105240_10110778 | 3300009093 | Bacteria | 3322 |
| 126 | Ga0105245_10076221 | 3300009098 | Bacteria | 3055 |
| 127 | Ga0114129_10005410 | 3300009147 | Bacteria | 18033 |
| 128 | Ga0105243_10001699 | 3300009148 | Bacteria | 18975 |
| 129 | Ga0105243_10007111 | 3300009148 | Bacteria | 8607 |
| 130 | Ga0105243_10008605 | 3300009148 | Bacteria | 7829 |
| 131 | Ga0105243_10998959 | 3300009148 | Bacteria | 839 |
| 132 | Ga0105241_10210253 | 3300009174 | Bacteria | 1630 |
| 133 | Ga0105242_10264021 | 3300009176 | Bacteria | 1556 |
| 134 | Ga0105237_10052161 | 3300009545 | Bacteria | 4107 |
| 135 | Ga0105237_10072710 | 3300009545 | Bacteria | 3432 |
| 136 | Ga0105237_10207520 | 3300009545 | Bacteria | 1959 |
| 137 | Ga0105238_10631243 | 3300009551 | Bacteria | 1080 |
| 138 | Ga0105239_10263890 | 3300010375 | Bacteria | 1936 |
| 139 | Ga0105246_10105320 | 3300011119 | Bacteria | 2061 |
| 140 | Ga0105246_10141748 | 3300011119 | Bacteria | 1808 |
| 141 | Ga0105246_10452686 | 3300011119 | Bacteria | 1079 |
| 142 | Ga0157371_10347267 | 3300013102 | Bacteria | 1080 |
| 143 | Ga0157370_10033743 | 3300013104 | Bacteria | 4988 |
| 144 | Ga0157370_10039885 | 3300013104 | Bacteria | 4535 |
| 145 | Ga0157369_10009750 | 3300013105 | Bacteria | 10984 |
| 146 | Ga0163162_10041677 | 3300013306 | Bacteria | 4594 |
| 147 | Ga0163162_10256317 | 3300013306 | Bacteria | 1881 |
| 148 | Ga0157372_10069886 | 3300013307 | Bacteria | 3950 |
| 149 | Ga0157375_10424402 | 3300013308 | Bacteria | 1496 |
| 150 | Ga0157375_10489923 | 3300013308 | Bacteria | 1394 |
| 151 | Ga0182008_10000398 | 3300014497 | Bacteria | 33725 |
| 152 | Ga0182008_10004701 | 3300014497 | Bacteria | 7921 |
| 153 | Ga0182008_10015360 | 3300014497 | Bacteria | 3995 |
| 154 | Ga0182008_10018484 | 3300014497 | Bacteria | 3608 |
| 155 | Ga0157376_10089275 | 3300014969 | Bacteria | 2665 |
| 156 | Ga0157376_10421900 | 3300014969 | Bacteria | 1295 |
| 157 | Ga0182006_1028315 | 3300015261 | Bacteria | 2279 |
| 158 | Ga0182007_10002765 | 3300015262 | Bacteria | 8568 |
| 159 | Ga0182007_10003853 | 3300015262 | Bacteria | 6972 |
| 160 | Ga0183362_10007 | 3300015683 | Bacteria | 240101 |
| 161 | Ga0163161_10000657 | 3300017792 | Bacteria | 27646 |
| 162 | Ga0163161_10046748 | 3300017792 | Bacteria | 3123 |
| 163 | Ga0163161_10053045 | 3300017792 | Bacteria | 2940 |
| 164 | Ga0163161_10061392 | 3300017792 | Bacteria | 2736 |
| 165 | Ga0163161_10103716 | 3300017792 | Bacteria | 2119 |
| 166 | Ga0209436_105391 | 3300025208 | Bacteria | 2955 |
| 167 | Ga0209436_110139 | 3300025208 | Bacteria | 1741 |
| 168 | Ga0209672_100354 | 3300025228 | Bacteria | 29117 |
| 169 | Ga0209147_100439 | 3300025229 | Bacteria | 26588 |
| 170 | Ga0209258_100015 | 3300025242 | Bacteria | 706310 |
| 171 | Ga0207425_1003301 | 3300025245 | Bacteria | 5231 |
| 172 | Ga0207425_1005498 | 3300025245 | Bacteria | 3601 |
| 173 | Ga0209148_1000028 | 3300025254 | Bacteria | 582773 |
| 174 | Ga0209129_1000049 | 3300025258 | Bacteria | 268086 |
| 175 | Ga0209129_1004227 | 3300025258 | Bacteria | 5752 |
| 176 | Ga0209129_1006576 | 3300025258 | Bacteria | 3710 |
| 177 | Ga0209565_1000108 | 3300025263 | Bacteria | 120719 |
| 178 | Ga0209565_1000337 | 3300025263 | Bacteria | 41609 |
| 179 | Ga0209565_1002917 | 3300025263 | Bacteria | 5830 |
| 180 | Ga0209673_1000193 | 3300025273 | Bacteria | 123134 |
| 181 | Ga0209673_1000477 | 3300025273 | Bacteria | 66849 |
| 182 | Ga0209673_1000817 | 3300025273 | Bacteria | 41131 |
| 183 | Ga0209673_1006865 | 3300025273 | Bacteria | 5396 |
| 184 | Ga0209130_1000267 | 3300025284 | Bacteria | 65435 |
| 185 | Ga0209130_1001005 | 3300025284 | Bacteria | 21918 |
| 186 | Ga0209130_1002152 | 3300025284 | Bacteria | 10404 |
| 187 | Ga0209130_1007173 | 3300025284 | Bacteria | 3490 |
| 188 | Ga0209675_1000163 | 3300025291 | Bacteria | 81884 |
| 189 | Ga0209675_1000398 | 3300025291 | Bacteria | 36047 |
| 190 | Ga0209675_1003839 | 3300025291 | Bacteria | 6929 |
| 191 | Ga0209675_1007351 | 3300025291 | Bacteria | 4237 |
| 192 | Ga0209675_1020329 | 3300025291 | Bacteria | 1803 |
| 193 | Ga0209675_1038029 | 3300025291 | Bacteria | 1076 |
| 194 | Ga0209676_1000137 | 3300025292 | Bacteria | 179437 |
| 195 | Ga0209676_1000416 | 3300025292 | Bacteria | 76249 |
| 196 | Ga0209676_1000903 | 3300025292 | Bacteria | 37397 |
| 197 | Ga0209676_1004657 | 3300025292 | Bacteria | 7535 |
| 198 | Ga0209676_1006031 | 3300025292 | Bacteria | 6111 |
| 199 | Ga0209676_1026321 | 3300025292 | Bacteria | 1849 |
| 200 | Ga0209025_1000313 | 3300025294 | Bacteria | 107850 |
| 201 | Ga0209025_1000481 | 3300025294 | Bacteria | 77405 |
| 202 | Ga0209025_1000707 | 3300025294 | Bacteria | 56879 |
| 203 | Ga0209025_1005768 | 3300025294 | Bacteria | 9932 |
| 204 | Ga0209025_1011103 | 3300025294 | Bacteria | 5997 |
| 205 | Ga0209025_1019867 | 3300025294 | Bacteria | 3710 |
| 206 | Ga0209025_1022920 | 3300025294 | Bacteria | 3289 |
| 207 | Ga0209564_1000232 | 3300025295 | Bacteria | 122080 |
| 208 | Ga0209564_1000303 | 3300025295 | Bacteria | 97431 |
| 209 | Ga0209758_1000135 | 3300025297 | Bacteria | 177753 |
| 210 | Ga0209758_1016690 | 3300025297 | Bacteria | 3710 |
| 211 | Ga0209050_1000015 | 3300025298 | Bacteria | 759102 |
| 212 | Ga0209050_1000936 | 3300025298 | Bacteria | 38151 |
| 213 | Ga0209050_1013627 | 3300025298 | Bacteria | 3592 |
| 214 | Ga0209050_1014845 | 3300025298 | Bacteria | 3320 |
| 215 | Ga0209256_1000129 | 3300025299 | Bacteria | 163766 |
| 216 | Ga0207426_1000171 | 3300025302 | Bacteria | 163766 |
| 217 | Ga0207426_1000185 | 3300025302 | Bacteria | 154146 |
| 218 | Ga0207426_1012604 | 3300025302 | Bacteria | 3169 |
| 219 | Ga0209051_1000010 | 3300025303 | Bacteria | 641298 |
| 220 | Ga0209051_1000137 | 3300025303 | Bacteria | 137784 |
| 221 | Ga0209051_1000556 | 3300025303 | Bacteria | 45471 |
| 222 | Ga0209051_1001027 | 3300025303 | Bacteria | 26555 |
| 223 | Ga0209051_1003312 | 3300025303 | Bacteria | 10670 |
| 224 | Ga0209257_1000026 | 3300025304 | Bacteria | 723225 |
| 225 | Ga0209257_1000205 | 3300025304 | Bacteria | 143735 |
| 226 | Ga0209257_1000643 | 3300025304 | Bacteria | 55819 |
| 227 | Ga0209257_1009941 | 3300025304 | Bacteria | 4948 |
| 228 | Ga0209257_1010007 | 3300025304 | Bacteria | 4917 |
| 229 | Ga0209257_1016166 | 3300025304 | Bacteria | 3041 |
| 230 | Ga0207696_1018230 | 3300025711 | Bacteria | 2308 |
| 231 | Ga0207655_1009809 | 3300025728 | Bacteria | 5901 |
| 232 | Ga0207680_10124578 | 3300025903 | Bacteria | 1690 |
| 233 | Ga0207695_10055810 | 3300025913 | Bacteria | 4114 |
| 234 | Ga0207671_10237511 | 3300025914 | Bacteria | 1431 |
| 235 | Ga0207681_10026583 | 3300025923 | Bacteria | 3734 |
| 236 | Ga0207694_10115658 | 3300025924 | Bacteria | 2137 |
| 237 | Ga0207690_10256663 | 3300025932 | Bacteria | 1353 |
| 238 | Ga0207706_10002998 | 3300025933 | Bacteria | 16269 |
| 239 | Ga0207706_10100068 | 3300025933 | Bacteria | 2551 |
| 240 | Ga0207709_10000155 | 3300025935 | Bacteria | 93200 |
| 241 | Ga0207709_10000195 | 3300025935 | Bacteria | 80988 |
| 242 | Ga0207709_10002722 | 3300025935 | Bacteria | 10913 |
| 243 | Ga0207709_10079477 | 3300025935 | Bacteria | 2109 |
| 244 | Ga0207691_10091012 | 3300025940 | Bacteria | 2734 |
| 245 | Ga0207667_10091141 | 3300025949 | Bacteria | 3149 |
| 246 | Ga0207651_10275456 | 3300025960 | Bacteria | 1388 |
| 247 | Ga0207668_10118539 | 3300025972 | Bacteria | 2000 |
| 248 | Ga0207640_10158681 | 3300025981 | Bacteria | 1671 |
| 249 | Ga0207658_10469305 | 3300025986 | Bacteria | 1117 |
| 250 | Ga0207658_10510450 | 3300025986 | Bacteria | 1072 |
| 251 | Ga0207639_10124794 | 3300026041 | Bacteria | 2121 |
| 252 | Ga0207639_10237715 | 3300026041 | Bacteria | 1582 |
| 253 | Ga0207702_10083457 | 3300026078 | Bacteria | 2780 |
| 254 | Ga0207648_10621863 | 3300026089 | Bacteria | 997 |
| 255 | Ga0207674_10010090 | 3300026116 | Bacteria | 10739 |
| 256 | Ga0207674_10188189 | 3300026116 | Bacteria | 2014 |
| 257 | Ga0207683_10028105 | 3300026121 | Bacteria | 4863 |
| 258 | Ga0207683_10180112 | 3300026121 | Bacteria | 1916 |
| 259 | Ga0209281_1000020 | 3300027111 | Bacteria | 575972 |
| 260 | Ga0209281_1007055 | 3300027111 | Bacteria | 2847 |
| 261 | Ga0209983_1031613 | 3300027665 | Bacteria | 1129 |
| 262 | Ga0209282_1000919 | 3300027666 | Bacteria | 15361 |
| 263 | Ga0268266_10117350 | 3300028379 | Bacteria | 2365 |
| 264 | Ga0268266_10293697 | 3300028379 | Bacteria | 1514 |
| 265 | Ga0268266_10310480 | 3300028379 | Bacteria | 1473 |
| 266 | Ga0268266_10346995 | 3300028379 | Bacteria | 1394 |
| 267 | Ga0268265_10048845 | 3300028380 | Bacteria | 3179 |
| 268 | Ga0307515_10000063 | 3300028794 | Bacteria | 245504 |
| 269 | Ga0307515_10017802 | 3300028794 | Bacteria | 12919 |
| 270 | Ga0307515_10168247 | 3300028794 | Bacteria | 2199 |
| 271 | Ga0316176_1075838 | 3300030732 | Bacteria | 1322 |
| 272 | Ga0316178_1084819 | 3300030735 | Bacteria | 1245 |
| 273 | Ga0316181_1146937 | 3300030744 | Bacteria | 3882 |
| 274 | Ga0316182_1171931 | 3300030745 | Bacteria | 4104 |
| 275 | Ga0265327_10006483 | 3300031251 | Bacteria | 9343 |
| 276 | Ga0265327_10029195 | 3300031251 | Bacteria | 3140 |
| 277 | Ga0307513_10110680 | 3300031456 | Bacteria | 2741 |
| 278 | Ga0307513_10188632 | 3300031456 | Bacteria | 1916 |
| 279 | Ga0307513_10224055 | 3300031456 | Bacteria | 1699 |
| 280 | Ga0307408_100118324 | 3300031548 | Bacteria | 2048 |
| 281 | Ga0307408_100195394 | 3300031548 | Bacteria | 1633 |
| 282 | Ga0307408_100307443 | 3300031548 | Bacteria | 1330 |
| 283 | Ga0307408_100570036 | 3300031548 | Bacteria | 1002 |
| 284 | Ga0307514_10006305 | 3300031649 | Bacteria | 10376 |
| 285 | Ga0307516_10000360 | 3300031730 | Bacteria | 59179 |
| 286 | Ga0307516_10026971 | 3300031730 | Bacteria | 5829 |
| 287 | Ga0307405_10030099 | 3300031731 | Bacteria | 3180 |
| 288 | Ga0307405_10068715 | 3300031731 | Bacteria | 2268 |
| 289 | Ga0307405_10110497 | 3300031731 | Bacteria | 1861 |
| 290 | Ga0307413_10072881 | 3300031824 | Bacteria | 2169 |
| 291 | Ga0307412_10026702 | 3300031911 | Bacteria | 3592 |
| 292 | Ga0307412_10352946 | 3300031911 | Bacteria | 1181 |
| 293 | Ga0307416_100018352 | 3300032002 | Bacteria | 4926 |
| 294 | Ga0307416_100235703 | 3300032002 | Bacteria | 1768 |
| 295 | Ga0307414_10488259 | 3300032004 | Bacteria | 1087 |
| 296 | Ga0307411_10064000 | 3300032005 | Bacteria | 2460 |
| 297 | Ga0307411_10151633 | 3300032005 | Bacteria | 1723 |
| 298 | Ga0395900_0146234 | 3300037418 | Bacteria | 2417 |
| 299 | Ga0395898_0055016 | 3300037466 | Bacteria | 3882 |
| 300 | Ga0395905_0007343 | 3300037471 | Bacteria | 10975 |
| 301 | Ga0395905_0039209 | 3300037471 | Bacteria | 4444 |
| 302 | Ga0395905_0043843 | 3300037471 | Bacteria | 4197 |
| 303 | Ga0395905_0096191 | 3300037471 | Bacteria | 2780 |
| 304 | Ga0439436_0001547 | 3300041404 | Bacteria | 6694 |
| 305 | Ga0439436_0003450 | 3300041404 | Bacteria | 4805 |
| 306 | Ga0439439_0001042 | 3300041406 | Bacteria | 5246 |
| 307 | Ga0439447_019122 | 3300041407 | Bacteria | 1831 |
| 308 | Ga0439461_0012437 | 3300041410 | Bacteria | 1593 |
| 309 | Ga0439466_0006006 | 3300041411 | Bacteria | 4622 |
| 310 | Ga0439466_0007950 | 3300041411 | Bacteria | 3999 |
| 311 | Ga0439466_0069912 | 3300041411 | Bacteria | 1119 |
| 312 | Ga0439465_0001706 | 3300041413 | Bacteria | 7176 |
| 313 | Ga0439465_0025901 | 3300041413 | Bacteria | 1853 |
| 314 | Ga0451791_0271330 | 3300041451 | Bacteria | 852 |
| 315 | Ga0439433_0001126 | 3300041999 | Bacteria | 5456 |
| 316 | Ga0439433_0005304 | 3300041999 | Bacteria | 2769 |
| 317 | Ga0439433_0034047 | 3300041999 | Bacteria | 1172 |
| 318 | Ga0439442_005026 | 3300042002 | Bacteria | 2641 |
| 319 | Ga0439442_009616 | 3300042002 | Bacteria | 1954 |
| 320 | Ga0439445_0015973 | 3300042004 | Bacteria | 1843 |
| 321 | Ga0439445_0016457 | 3300042004 | Bacteria | 1819 |
| 322 | Ga0439449_0001898 | 3300042007 | Bacteria | 8215 |
| 323 | Ga0439449_0004383 | 3300042007 | Bacteria | 5443 |
| 324 | Ga0439449_0017756 | 3300042007 | Bacteria | 2671 |
| 325 | Ga0439449_0056924 | 3300042007 | Bacteria | 1444 |
| 326 | Ga0439452_003600 | 3300042010 | Bacteria | 5399 |
| 327 | Ga0439457_008454 | 3300042014 | Bacteria | 2428 |
| 328 | Ga0439457_028703 | 3300042014 | Bacteria | 1232 |
| 329 | Ga0439462_0002073 | 3300042015 | Bacteria | 4601 |
| 330 | Ga0439462_0002470 | 3300042015 | Bacteria | 4299 |
| 331 | Ga0439462_0004189 | 3300042015 | Bacteria | 3508 |
| 332 | Ga0450921_000255 | 3300042123 | Bacteria | 2267 |
| 333 | Ga0450923_011942 | 3300042125 | Bacteria | 1572 |
| 334 | Ga0450890_013022 | 3300042127 | Bacteria | 1083 |
| 335 | Ga0450894_010332 | 3300042131 | Bacteria | 1212 |
| 336 | Ga0450896_002471 | 3300042133 | Bacteria | 2388 |
| 337 | Ga0450906_000981 | 3300042145 | Bacteria | 6272 |
| 338 | Ga0450906_035222 | 3300042145 | Bacteria | 884 |
| 339 | Ga0439446_0004350 | 3300042156 | Bacteria | 3589 |
| 340 | Ga0450908_013206 | 3300042184 | Bacteria | 1491 |
| 341 | Ga0450909_005551 | 3300042185 | Bacteria | 1814 |
| 342 | Ga0439434_0001921 | 3300042435 | Bacteria | 6024 |
| 343 | Ga0450893_0003245 | 3300042532 | Bacteria | 2556 |
| 344 | Ga0451577_0019663 | 3300042876 | Bacteria | 6207 |
| 345 | Ga0451577_0159908 | 3300042876 | Bacteria | 2028 |
| 346 | Ga0466969_0110498 | 3300044656 | Bacteria | 1287 |
| 347 | Ga0466972_0002649 | 3300044658 | Bacteria | 8859 |
| 348 | Ga0466966_0030507 | 3300044684 | Bacteria | 3501 |
| 349 | Ga0466961_0002048 | 3300044693 | Bacteria | 12550 |
| 350 | Ga0466959_0000990 | 3300045049 | Bacteria | 16905 |
| 351 | Ga0495651_0249468 | 3300046462 | Bacteria | 1213 |
| 352 | Ga0495606_0027176 | 3300046507 | Bacteria | 4063 |
| 353 | Ga0495610_0016012 | 3300046512 | Bacteria | 4334 |
| 354 | Ga0495616_0006735 | 3300046513 | Bacteria | 6927 |
| 355 | Ga0495620_0029880 | 3300046515 | Bacteria | 2516 |
| 356 | Ga0495631_0000568 | 3300046518 | Bacteria | 24838 |
| 357 | Ga0495632_0034174 | 3300046519 | Bacteria | 2604 |
| 358 | Ga0495637_0016644 | 3300046520 | Bacteria | 3435 |
| 359 | Ga0495637_0025889 | 3300046520 | Bacteria | 2640 |
| 360 | Ga0495654_0047432 | 3300046530 | Bacteria | 2111 |
| 361 | Ga0495621_0003634 | 3300046539 | Bacteria | 4259 |
| 362 | Ga0495621_0009953 | 3300046539 | Bacteria | 2901 |
| 363 | Ga0495597_0005867 | 3300046542 | Bacteria | 6419 |
| 364 | Ga0495622_0181402 | 3300046557 | Bacteria | 944 |
| 365 | Ga0495633_0102441 | 3300046558 | Bacteria | 1329 |
| 366 | Ga0495656_0000049 | 3300046615 | Bacteria | 56829 |
| 367 | Ga0495625_0000510 | 3300046660 | Bacteria | 57454 |
| 368 | Ga0495625_0029493 | 3300046660 | Bacteria | 4101 |
| 369 | Ga0495635_0392574 | 3300046663 | Bacteria | 922 |
| 370 | Ga0495588_0041285 | 3300046674 | Bacteria | 2355 |
| 371 | Ga0495588_0071976 | 3300046674 | Bacteria | 1798 |
| 372 | Ga0495588_0128908 | 3300046674 | Bacteria | 1334 |
| 373 | Ga0495658_0177510 | 3300046683 | Bacteria | 1320 |
| 374 | Ga0495670_0148287 | 3300046691 | Bacteria | 1229 |
| 375 | Ga0495670_0204869 | 3300046691 | Bacteria | 1045 |
| 376 | Ga0495649_0001080 | 3300046694 | Bacteria | 21269 |
| 377 | Ga0495600_0106613 | 3300046809 | Bacteria | 1826 |
| 378 | Ga0495660_0020612 | 3300046810 | Bacteria | 3779 |
| 379 | Ga0495660_0064522 | 3300046810 | Bacteria | 1957 |
| 380 | Ga0495676_0022695 | 3300047321 | Bacteria | 5455 |
| 381 | Ga0495676_0298171 | 3300047321 | Bacteria | 1088 |
| 382 | Ga0495687_000272 | 3300047443 | Bacteria | 68390 |
| 383 | Ga0495593_0012215 | 3300047673 | Bacteria | 4909 |
| 384 | Ga0495614_0090506 | 3300048089 | Bacteria | 1331 |
| 385 | Ga0495615_0010264 | 3300048090 | Bacteria | 1867 |
| 386 | Ga0495626_0066150 | 3300048091 | Bacteria | 1635 |
| 387 | Ga0496100_0198877 | 3300048903 | Bacteria | 1459 |
| 388 | Ga0496101_0096258 | 3300048904 | Bacteria | 2209 |
| 389 | Ga0496101_0098900 | 3300048904 | Bacteria | 2180 |
| 390 | Ga0496102_0005135 | 3300048905 | Bacteria | 11100 |
| 391 | Ga0496103_0014998 | 3300048906 | Bacteria | 4607 |
| 392 | Ga0496104_0105218 | 3300048907 | Bacteria | 2704 |
| 393 | Ga0496105_0001109 | 3300048908 | Bacteria | 18738 |
| 394 | Ga0496106_0006787 | 3300048909 | Bacteria | 8474 |
| 395 | Ga0496106_0087770 | 3300048909 | Bacteria | 2397 |
| 396 | Ga0496108_0451274 | 3300048911 | Bacteria | 1123 |
| 397 | Ga0496110_0184631 | 3300048913 | Bacteria | 1893 |
| 398 | Ga0496114_0370558 | 3300048917 | Bacteria | 1267 |
| 399 | Ga0496114_0397605 | 3300048917 | Bacteria | 1220 |
| 400 | Ga0496116_0011655 | 3300048919 | Bacteria | 7252 |
| 401 | Ga0496117_0084603 | 3300048920 | Bacteria | 2068 |
| 402 | Ga0496117_0147247 | 3300048920 | Bacteria | 1399 |
| 403 | Ga0496118_0004893 | 3300048921 | Bacteria | 15574 |
| 404 | Ga0496118_0026096 | 3300048921 | Bacteria | 4987 |
| 405 | Ga0496118_0218196 | 3300048921 | Bacteria | 1112 |
| 406 | Ga0496119_0057030 | 3300048922 | Bacteria | 2363 |
| 407 | Ga0496121_0001309 | 3300048924 | Bacteria | 42638 |
| 408 | Ga0496122_0001818 | 3300048925 | Bacteria | 32577 |
| 409 | Ga0496122_0085851 | 3300048925 | Bacteria | 2169 |
| 410 | Ga0496122_0100304 | 3300048925 | Bacteria | 1938 |
| 411 | Ga0496122_0151288 | 3300048925 | Bacteria | 1432 |
| 412 | Ga0496122_0196795 | 3300048925 | Bacteria | 1183 |
| 413 | Ga0496122_0371253 | 3300048925 | Bacteria | 738 |
| 414 | Ga0496123_0000264 | 3300048926 | Bacteria | 105015 |
| 415 | Ga0496123_0032215 | 3300048926 | Bacteria | 3800 |
| 416 | Ga0496123_0078037 | 3300048926 | Bacteria | 2031 |
| 417 | Ga0496123_0083030 | 3300048926 | Bacteria | 1939 |
| 418 | Ga0496124_0130381 | 3300048927 | Bacteria | 1998 |
| 419 | Ga0496125_0001110 | 3300048928 | Bacteria | 41331 |
| 420 | Ga0496125_0142462 | 3300048928 | Bacteria | 1664 |
| 421 | Ga0496125_0165387 | 3300048928 | Bacteria | 1496 |
| 422 | Ga0496125_0224682 | 3300048928 | Bacteria | 1206 |
| 423 | Ga0501249_004814 | 3300049679 | Bacteria | 2747 |
| 424 | Ga0501262_002439 | 3300049759 | Bacteria | 2107 |
| 425 | Ga0501263_010652 | 3300049760 | Bacteria | 1131 |
| 426 | nmdc:mga03683_10368_c1 | 3300050489 | Bacteria | 3341 |
| 427 | nmdc:mga03683_27519_c1 | 3300050489 | Bacteria | 1867 |
| 428 | nmdc:mga03683_712_c1 | 3300050489 | Bacteria | 9551 |
| 429 | nmdc:mga03n38_44743_c1 | 3300050490 | Bacteria | 1946 |
| 430 | nmdc:mga03n38_50311_c1 | 3300050490 | Bacteria | 1857 |
| 431 | nmdc:mga03n38_88379_c1 | 3300050490 | Bacteria | 1470 |
| 432 | nmdc:mga00v17_23380_c1 | 3300050491 | Bacteria | 3575 |
| 433 | nmdc:mga00v17_96146_c1 | 3300050491 | Bacteria | 1865 |
| 434 | nmdc:mga0yw44_106034_c1 | 3300050492 | Bacteria | 1796 |
| 435 | nmdc:mga0k408_16011_c1 | 3300050493 | Bacteria | 4153 |
| 436 | nmdc:mga0k408_17022_c1 | 3300050493 | Bacteria | 4041 |
| 437 | nmdc:mga0k408_24756_c1 | 3300050493 | Bacteria | 3396 |
| 438 | nmdc:mga0k408_267_c1 | 3300050493 | Bacteria | 28555 |
| 439 | nmdc:mga0k408_78316_c1 | 3300050493 | Bacteria | 1933 |
| 440 | nmdc:mga04h51_83933_c1 | 3300050495 | Bacteria | 1135 |
| 441 | nmdc:mga07m45_216288_c1 | 3300050496 | Bacteria | 1115 |
| 442 | nmdc:mga07m45_2251_c2 | 3300050496 | Bacteria | 6619 |
| 443 | nmdc:mga07m45_23114_c1 | 3300050496 | Bacteria | 3396 |
| 444 | nmdc:mga07m45_29845_c1 | 3300050496 | Bacteria | 3019 |
| 445 | nmdc:mga07m45_56772_c1 | 3300050496 | Bacteria | 2213 |
| 446 | nmdc:mga05p37_288989_c1 | 3300050507 | Bacteria | 1952 |
| 447 | nmdc:mga09592_579_c1 | 3300050508 | Bacteria | 27730 |
| 448 | Ga0500610_0022871 | 3300053079 | Bacteria | 3087 |
| 449 | Ga0495655_0045875 | 3300053083 | Bacteria | 1137 |
| 450 | Ga0500643_016032 | 3300053087 | Bacteria | 2553 |
| 451 | Ga0500646_0039208 | 3300053090 | Bacteria | 1328 |
| 452 | Ga0500651_0003470 | 3300053093 | Bacteria | 8619 |
| 453 | Ga0500555_030455 | 3300053103 | Bacteria | 1532 |
| 454 | Ga0500562_044505 | 3300053108 | Bacteria | 1182 |
| 455 | Ga0500571_053220 | 3300053110 | Bacteria | 2115 |
| 456 | Ga0500592_002657 | 3300053116 | Bacteria | 2873 |
| 457 | Ga0500593_000323 | 3300053117 | Bacteria | 19241 |
| 458 | Ga0500594_0024727 | 3300053118 | Bacteria | 1533 |
| 459 | Ga0500595_103324 | 3300053119 | Bacteria | 815 |
| 460 | Ga0500607_024443 | 3300053121 | Bacteria | 3374 |
| 461 | Ga0500608_028679 | 3300053122 | Bacteria | 2628 |
| 462 | Ga0500608_046813 | 3300053122 | Bacteria | 2078 |
| 463 | Ga0500618_037970 | 3300053125 | Bacteria | 1112 |
| 464 | Ga0500655_015829 | 3300053133 | Bacteria | 1385 |
| 465 | Ga0500658_0000096 | 3300053134 | Bacteria | 40172 |
| 466 | Ga0500658_0000100 | 3300053134 | Bacteria | 39487 |
| 467 | Ga0500559_0002108 | 3300053136 | Bacteria | 10590 |
| 468 | Ga0500559_0211174 | 3300053136 | Bacteria | 915 |
| 469 | Ga0500564_052788 | 3300053138 | Bacteria | 1857 |
| 470 | Ga0500568_0008698 | 3300053139 | Bacteria | 4871 |
| 471 | Ga0500574_005670 | 3300053141 | Bacteria | 2451 |
| 472 | Ga0500616_0082659 | 3300053153 | Bacteria | 1610 |
| 473 | Ga0500619_000142 | 3300053154 | Bacteria | 17663 |
| 474 | Ga0500627_0009428 | 3300053158 | Bacteria | 3515 |
| 475 | Ga0500634_0000918 | 3300053161 | Bacteria | 10553 |
| 476 | Ga0500634_0057644 | 3300053161 | Bacteria | 2072 |
| 477 | Ga0590071_001729 | 3300059421 | Bacteria | 5637 |
| 478 | 2513227864 | 2513020051 | Bacteria | 6053213 |
| 479 | 2599622001 | 2599185214 | Bacteria | 8209958 |
| 480 | 2599676834 | 2599185226 | Bacteria | 8233575 |
| 481 | 2599685194 | 2599185227 | Bacteria | 8246414 |
| 482 | 2599691511 | 2599185229 | Bacteria | 8216126 |
| 483 | 2644161547 | 2643221628 | Bacteria | 5745828 |
| 484 | 2644326949 | 2643221658 | Bacteria | 6064537 |
| 485 | 2644398747 | 2643221672 | Bacteria | 6322190 |
| 486 | 2644466433 | 2643221683 | Bacteria | 5749203 |
| 487 | 2722883217 | 2721755523 | Bacteria | 6430384 |
| 488 | 2738721970 | 2738541277 | Bacteria | 7458140 |
| 489 | 2738882138 | 2738541307 | Bacteria | 8606193 |
| 490 | 2739249589 | 2738543013 | Bacteria | 5618633 |
| 491 | 2739282334 | 2738543019 | Bacteria | 7459457 |
| 492 | 2819598073 | 2818991446 | Bacteria | 7757362 |
| 493 | 2831269062 | 2831265667 | Bacteria | 7184833 |
| 494 | 2838058484 | 2838054893 | Bacteria | 7451788 |
| 495 | 2839143594 | 2839138175 | Bacteria | 6549354 |
| 496 | 2842682683 | 2842677519 | Bacteria | 5615038 |
| 497 | 2842752185 | 2842747753 | Bacteria | 5578255 |
| 498 | 2885194146 | 2885192300 | Bacteria | 5882526 |
| 499 | 2885203763 | 2885198086 | Bacteria | 7212419 |
| 500 | 2885217902 | 2885211737 | Bacteria | 7212420 |
| 501 | 2899929490 | 2899924645 | Bacteria | 7487985 |
| 502 | 2904451023 | 2904449895 | Bacteria | 6927402 |
| 503 | 2904457879 | 2904456579 | Bacteria | 6819253 |
| 504 | 2904543371 | 2904541872 | Bacteria | 8915136 |
| 505 | 2919465764 | 2919462493 | Bacteria | 5817112 |
| 506 | 2928040064 | 2928037797 | Bacteria | 7273642 |
| 507 | 2928047187 | 2928044640 | Bacteria | 7271509 |
| 508 | 2928057612 | 2928051484 | Bacteria | 7773759 |
| 509 | 2928068006 | 2928064002 | Bacteria | 7419480 |
| 510 | 2928072582 | 2928070936 | Bacteria | 8062541 |
| 511 | 2928085757 | 2928084124 | Bacteria | 7159212 |
| 512 | 2928119350 | 2928115317 | Bacteria | 6477646 |
| 513 | 2929160604 | 2929160207 | Bacteria | 9075316 |
| 514 | 2929523698 | 2929520902 | Bacteria | 6765052 |
| 515 | 2945914910 | 2945909444 | Bacteria | 7065066 |
| 516 | 2945951055 | 2945945610 | Bacteria | 5951079 |
| 517 | 2945974287 | 2945972063 | Bacteria | 6086495 |
| 518 | 2945989694 | 2945984333 | Bacteria | 7358892 |
| 519 | 2954769545 | 2954767861 | Bacteria | 5535784 |
| 520 | Ga0500607_005859 | |||
| 521 | JGI24740J21852_10058899 | |||
| 522 | JGI24739J22299_10024071 | |||
| 523 | JGI24735J21928_10087803 | |||
| 524 | JGI25158J39367_1003572 | |||
| 525 | JGI25152J39213_1007449 | |||
| 526 | JGI25152J39213_1009752 | |||
| 527 | JGI25152J39213_1021572 | |||
| 528 | JGI25150J39212_1000718 | |||
| 529 | JGI25150J39212_1003558 | |||
| 530 | JGI25150J39212_1007071 | |||
| 531 | JGI25159J45721_1006329 | |||
| 532 | JGI25159J45721_1007465 | |||
| 533 | JGI25159J45721_1017077 | |||
| 534 | JGI25151J46595_10002213 | |||
| 535 | JGI25151J46595_10008367 | |||
| 536 | JGI25151J46595_10009581 | |||
| 537 | JGI25151J46595_10028103 | |||
| 538 | JGI25153J46596_10012560 | |||
| 539 | rootH1_10013655 | |||
| 540 | rootL2_10142366 | |||
| 541 | rootH1_10030043 | |||
| 542 | JGI25160J50197_1008199 | |||
| 543 | JGI25160J50197_1008298 | |||
| 544 | JGI25161J50226_1002701 | |||
| 545 | JGI25161J50226_1004046 | |||
| 546 | Ga0006562J51391_1112371 | |||
| 547 | Ga0006562J51391_1112372 | |||
| 548 | Ga0006562J51391_1181373 | |||
| 549 | Ga0006562J51391_1181374 | |||
| 550 | Ga0055535_1002469 | |||
| 551 | Ga0055542_1000003 | |||
| 552 | Ga0055526_1013030 | |||
| 553 | Ga0055537_1000819 | |||
| 554 | Ga0055537_1003007 | |||
| 555 | Ga0055524_1011028 | |||
| 556 | Ga0055524_1013422 | |||
| 557 | Ga0055536_1006783 | |||
| 558 | Ga0055536_1009299 | |||
| 559 | Ga0055536_1010143 | |||
| 560 | Ga0055534_1001205 | |||
| 561 | Ga0055534_1003154 | |||
| 562 | Ga0055528_1006417 | |||
| 563 | Ga0055528_1007537 | |||
| 564 | Ga0055530_10004055 | |||
| 565 | Ga0055530_10008763 | |||
| 566 | Ga0055540_1006642 | |||
| 567 | Ga0055540_1007817 | |||
| 568 | Ga0055540_1008258 | |||
| 569 | Ga0055540_1008834 | |||
| 570 | Ga0055531_10008762 | |||
| 571 | Ga0055531_10009563 | |||
| 572 | Ga0055531_10022162 | |||
| 573 | Ga0055531_10025590 | |||
| 574 | Ga0055543_1003699 | |||
| 575 | Ga0055543_1012629 | |||
| 576 | Ga0065165_1012771 | |||
| 577 | Ga0065165_1012863 | |||
| 578 | Ga0065165_1013939 | |||
| 579 | Ga0065714_10082236 | |||
| 580 | Ga0070677_10019494 | |||
| 581 | Ga0068869_100153808 | |||
| 582 | Ga0070666_10176868 | |||
| 583 | Ga0070660_100378137 | |||
| 584 | Ga0070668_100151171 | |||
| 585 | Ga0070669_100131374 | |||
| 586 | Ga0070674_100060272 | |||
| 587 | Ga0070673_100072689 | |||
| 588 | Ga0070659_100468388 | |||
| 589 | Ga0070667_100008514 | |||
| 590 | Ga0070667_100070420 | |||
| 591 | Ga0070678_100018582 | |||
| 592 | Ga0070678_100314913 | |||
| 593 | Ga0070662_100015807 | |||
| 594 | Ga0070662_100097017 | |||
| 595 | Ga0068867_100418224 | |||
| 596 | Ga0068853_100024482 | |||
| 597 | Ga0068853_100545391 | |||
| 598 | Ga0070665_100014019 | |||
| 599 | Ga0070665_100063617 | |||
| 600 | Ga0070665_100076707 | |||
| 601 | Ga0070665_100157994 | |||
| 602 | Ga0070665_100225190 | |||
| 603 | Ga0068855_100023604 | |||
| 604 | Ga0070664_100015785 | |||
| 605 | Ga0070664_100158382 | |||
| 606 | Ga0068854_100085141 | |||
| 607 | Ga0068852_100094223 | |||
| 608 | Ga0068852_100106171 | |||
| 609 | Ga0068852_100652271 | |||
| 610 | Ga0068851_10003855 | |||
| 611 | Ga0068862_100056123 | |||
| 612 | Ga0075365_10075163 | |||
| 613 | Ga0075363_100009573 | |||
| 614 | Ga0075363_100029571 | |||
| 615 | Ga0075363_100086724 | |||
| 616 | Ga0075364_10019647 | |||
| 617 | Ga0075364_10257974 | |||
| 618 | Ga0075432_10014618 | |||
| 619 | Ga0075432_10067177 | |||
| 620 | Ga0075362_10002300 | |||
| 621 | Ga0075362_10004470 | |||
| 622 | Ga0075362_10008027 | |||
| 623 | Ga0075362_10052028 | |||
| 624 | Ga0075367_10061213 | |||
| 625 | Ga0075369_10124818 | |||
| 626 | Ga0075366_10000230 | |||
| 627 | Ga0075366_10016881 | |||
| 628 | Ga0075366_10025184 | |||
| 629 | Ga0075366_10053055 | |||
| 630 | Ga0097621_100563732 | |||
| 631 | Ga0075370_10007439 | |||
| 632 | Ga0075370_10019410 | |||
| 633 | Ga0075370_10028947 | |||
| 634 | Ga0075370_10061716 | |||
| 635 | Ga0075370_10071425 | |||
| 636 | Ga0075370_10088022 | |||
| 637 | Ga0068871_100309202 | |||
| 638 | Ga0075429_100002953 | |||
| 639 | Ga0079104_1000007 | |||
| 640 | Ga0099826_10018393 | |||
| 641 | Ga0105244_10004236 | |||
| 642 | Ga0105250_10023612 | |||
| 643 | Ga0105240_10013451 | |||
| 644 | Ga0105240_10110778 | |||
| 645 | Ga0105245_10076221 | |||
| 646 | Ga0114129_10005410 | |||
| 647 | Ga0105243_10001699 | |||
| 648 | Ga0105243_10007111 | |||
| 649 | Ga0105243_10008605 | |||
| 650 | Ga0105243_10998959 | |||
| 651 | Ga0105241_10210253 | |||
| 652 | Ga0105242_10264021 | |||
| 653 | Ga0105237_10052161 | |||
| 654 | Ga0105237_10072710 | |||
| 655 | Ga0105237_10207520 | |||
| 656 | Ga0105238_10631243 | |||
| 657 | Ga0105239_10263890 | |||
| 658 | Ga0105246_10105320 | |||
| 659 | Ga0105246_10141748 | |||
| 660 | Ga0105246_10452686 | |||
| 661 | Ga0157371_10347267 | |||
| 662 | Ga0157370_10033743 | |||
| 663 | Ga0157370_10039885 | |||
| 664 | Ga0157369_10009750 | |||
| 665 | Ga0163162_10041677 | |||
| 666 | Ga0163162_10256317 | |||
| 667 | Ga0157372_10069886 | |||
| 668 | Ga0157375_10424402 | |||
| 669 | Ga0157375_10489923 | |||
| 670 | Ga0182008_10000398 | |||
| 671 | Ga0182008_10004701 | |||
| 672 | Ga0182008_10015360 | |||
| 673 | Ga0182008_10018484 | |||
| 674 | Ga0157376_10089275 | |||
| 675 | Ga0157376_10421900 | |||
| 676 | Ga0182006_1028315 | |||
| 677 | Ga0182007_10002765 | |||
| 678 | Ga0182007_10003853 | |||
| 679 | Ga0183362_10007 | |||
| 680 | Ga0163161_10000657 | |||
| 681 | Ga0163161_10046748 | |||
| 682 | Ga0163161_10053045 | |||
| 683 | Ga0163161_10061392 | |||
| 684 | Ga0163161_10103716 | |||
| 685 | Ga0209436_105391 | |||
| 686 | Ga0209436_110139 | |||
| 687 | Ga0209672_100354 | |||
| 688 | Ga0209147_100439 | |||
| 689 | Ga0209258_100015 | |||
| 690 | Ga0207425_1003301 | |||
| 691 | Ga0207425_1005498 | |||
| 692 | Ga0209148_1000028 | |||
| 693 | Ga0209129_1000049 | |||
| 694 | Ga0209129_1004227 | |||
| 695 | Ga0209129_1006576 | |||
| 696 | Ga0209565_1000108 | |||
| 697 | Ga0209565_1000337 | |||
| 698 | Ga0209565_1002917 | |||
| 699 | Ga0209673_1000193 | |||
| 700 | Ga0209673_1000477 | |||
| 701 | Ga0209673_1000817 | |||
| 702 | Ga0209673_1006865 | |||
| 703 | Ga0209130_1000267 | |||
| 704 | Ga0209130_1001005 | |||
| 705 | Ga0209130_1002152 | |||
| 706 | Ga0209130_1007173 | |||
| 707 | Ga0209675_1000163 | |||
| 708 | Ga0209675_1000398 | |||
| 709 | Ga0209675_1003839 | |||
| 710 | Ga0209675_1007351 | |||
| 711 | Ga0209675_1020329 | |||
| 712 | Ga0209675_1038029 | |||
| 713 | Ga0209676_1000137 | |||
| 714 | Ga0209676_1000416 | |||
| 715 | Ga0209676_1000903 | |||
| 716 | Ga0209676_1004657 | |||
| 717 | Ga0209676_1006031 | |||
| 718 | Ga0209676_1026321 | |||
| 719 | Ga0209025_1000313 | |||
| 720 | Ga0209025_1000481 | |||
| 721 | Ga0209025_1000707 | |||
| 722 | Ga0209025_1005768 | |||
| 723 | Ga0209025_1011103 | |||
| 724 | Ga0209025_1019867 | |||
| 725 | Ga0209025_1022920 | |||
| 726 | Ga0209564_1000232 | |||
| 727 | Ga0209564_1000303 | |||
| 728 | Ga0209758_1000135 | |||
| 729 | Ga0209758_1016690 | |||
| 730 | Ga0209050_1000015 | |||
| 731 | Ga0209050_1000936 | |||
| 732 | Ga0209050_1013627 | |||
| 733 | Ga0209050_1014845 | |||
| 734 | Ga0209256_1000129 | |||
| 735 | Ga0207426_1000171 | |||
| 736 | Ga0207426_1000185 | |||
| 737 | Ga0207426_1012604 | |||
| 738 | Ga0209051_1000010 | |||
| 739 | Ga0209051_1000137 | |||
| 740 | Ga0209051_1000556 | |||
| 741 | Ga0209051_1001027 | |||
| 742 | Ga0209051_1003312 | |||
| 743 | Ga0209257_1000026 | |||
| 744 | Ga0209257_1000205 | |||
| 745 | Ga0209257_1000643 | |||
| 746 | Ga0209257_1009941 | |||
| 747 | Ga0209257_1010007 | |||
| 748 | Ga0209257_1016166 | |||
| 749 | Ga0207696_1018230 | |||
| 750 | Ga0207655_1009809 | |||
| 751 | Ga0207680_10124578 | |||
| 752 | Ga0207695_10055810 | |||
| 753 | Ga0207671_10237511 | |||
| 754 | Ga0207681_10026583 | |||
| 755 | Ga0207694_10115658 | |||
| 756 | Ga0207690_10256663 | |||
| 757 | Ga0207706_10002998 | |||
| 758 | Ga0207706_10100068 | |||
| 759 | Ga0207709_10000155 | |||
| 760 | Ga0207709_10000195 | |||
| 761 | Ga0207709_10002722 | |||
| 762 | Ga0207709_10079477 | |||
| 763 | Ga0207691_10091012 | |||
| 764 | Ga0207667_10091141 | |||
| 765 | Ga0207651_10275456 | |||
| 766 | Ga0207668_10118539 | |||
| 767 | Ga0207640_10158681 | |||
| 768 | Ga0207658_10469305 | |||
| 769 | Ga0207658_10510450 | |||
| 770 | Ga0207639_10124794 | |||
| 771 | Ga0207639_10237715 | |||
| 772 | Ga0207702_10083457 | |||
| 773 | Ga0207648_10621863 | |||
| 774 | Ga0207674_10010090 | |||
| 775 | Ga0207674_10188189 | |||
| 776 | Ga0207683_10028105 | |||
| 777 | Ga0207683_10180112 | |||
| 778 | Ga0209281_1000020 | |||
| 779 | Ga0209281_1007055 | |||
| 780 | Ga0209983_1031613 | |||
| 781 | Ga0209282_1000919 | |||
| 782 | Ga0268266_10117350 | |||
| 783 | Ga0268266_10293697 | |||
| 784 | Ga0268266_10310480 | |||
| 785 | Ga0268266_10346995 | |||
| 786 | Ga0268265_10048845 | |||
| 787 | Ga0307515_10000063 | |||
| 788 | Ga0307515_10017802 | |||
| 789 | Ga0307515_10168247 | |||
| 790 | Ga0316176_1075838 | |||
| 791 | Ga0316178_1084819 | |||
| 792 | Ga0316181_1146937 | |||
| 793 | Ga0316182_1171931 | |||
| 794 | Ga0265327_10006483 | |||
| 795 | Ga0265327_10029195 | |||
| 796 | Ga0307513_10110680 | |||
| 797 | Ga0307513_10188632 | |||
| 798 | Ga0307513_10224055 | |||
| 799 | Ga0307408_100118324 | |||
| 800 | Ga0307408_100195394 | |||
| 801 | Ga0307408_100307443 | |||
| 802 | Ga0307408_100570036 | |||
| 803 | Ga0307514_10006305 | |||
| 804 | Ga0307516_10000360 | |||
| 805 | Ga0307516_10026971 | |||
| 806 | Ga0307405_10030099 | |||
| 807 | Ga0307405_10068715 | |||
| 808 | Ga0307405_10110497 | |||
| 809 | Ga0307413_10072881 | |||
| 810 | Ga0307412_10026702 | |||
| 811 | Ga0307412_10352946 | |||
| 812 | Ga0307416_100018352 | |||
| 813 | Ga0307416_100235703 | |||
| 814 | Ga0307414_10488259 | |||
| 815 | Ga0307411_10064000 | |||
| 816 | Ga0307411_10151633 | |||
| 817 | Ga0395900_0146234 | |||
| 818 | Ga0395898_0055016 | |||
| 819 | Ga0395905_0007343 | |||
| 820 | Ga0395905_0039209 | |||
| 821 | Ga0395905_0043843 | |||
| 822 | Ga0395905_0096191 | |||
| 823 | Ga0439436_0001547 | |||
| 824 | Ga0439436_0003450 | |||
| 825 | Ga0439439_0001042 | |||
| 826 | Ga0439447_019122 | |||
| 827 | Ga0439461_0012437 | |||
| 828 | Ga0439466_0006006 | |||
| 829 | Ga0439466_0007950 | |||
| 830 | Ga0439466_0069912 | |||
| 831 | Ga0439465_0001706 | |||
| 832 | Ga0439465_0025901 | |||
| 833 | Ga0451791_0271330 | |||
| 834 | Ga0439433_0001126 | |||
| 835 | Ga0439433_0005304 | |||
| 836 | Ga0439433_0034047 | |||
| 837 | Ga0439442_005026 | |||
| 838 | Ga0439442_009616 | |||
| 839 | Ga0439445_0015973 | |||
| 840 | Ga0439445_0016457 | |||
| 841 | Ga0439449_0001898 | |||
| 842 | Ga0439449_0004383 | |||
| 843 | Ga0439449_0017756 | |||
| 844 | Ga0439449_0056924 | |||
| 845 | Ga0439452_003600 | |||
| 846 | Ga0439457_008454 | |||
| 847 | Ga0439457_028703 | |||
| 848 | Ga0439462_0002073 | |||
| 849 | Ga0439462_0002470 | |||
| 850 | Ga0439462_0004189 | |||
| 851 | Ga0450921_000255 | |||
| 852 | Ga0450923_011942 | |||
| 853 | Ga0450890_013022 | |||
| 854 | Ga0450894_010332 | |||
| 855 | Ga0450896_002471 | |||
| 856 | Ga0450906_000981 | |||
| 857 | Ga0450906_035222 | |||
| 858 | Ga0439446_0004350 | |||
| 859 | Ga0450908_013206 | |||
| 860 | Ga0450909_005551 | |||
| 861 | Ga0439434_0001921 | |||
| 862 | Ga0450893_0003245 | |||
| 863 | Ga0451577_0019663 | |||
| 864 | Ga0451577_0159908 | |||
| 865 | Ga0466969_0110498 | |||
| 866 | Ga0466972_0002649 | |||
| 867 | Ga0466966_0030507 | |||
| 868 | Ga0466961_0002048 | |||
| 869 | Ga0466959_0000990 | |||
| 870 | Ga0495651_0249468 | |||
| 871 | Ga0495606_0027176 | |||
| 872 | Ga0495610_0016012 | |||
| 873 | Ga0495616_0006735 | |||
| 874 | Ga0495620_0029880 | |||
| 875 | Ga0495631_0000568 | |||
| 876 | Ga0495632_0034174 | |||
| 877 | Ga0495637_0016644 | |||
| 878 | Ga0495637_0025889 | |||
| 879 | Ga0495654_0047432 | |||
| 880 | Ga0495621_0003634 | |||
| 881 | Ga0495621_0009953 | |||
| 882 | Ga0495597_0005867 | |||
| 883 | Ga0495622_0181402 | |||
| 884 | Ga0495633_0102441 | |||
| 885 | Ga0495656_0000049 | |||
| 886 | Ga0495625_0000510 | |||
| 887 | Ga0495625_0029493 | |||
| 888 | Ga0495635_0392574 | |||
| 889 | Ga0495588_0041285 | |||
| 890 | Ga0495588_0071976 | |||
| 891 | Ga0495588_0128908 | |||
| 892 | Ga0495658_0177510 | |||
| 893 | Ga0495670_0148287 | |||
| 894 | Ga0495670_0204869 | |||
| 895 | Ga0495649_0001080 | |||
| 896 | Ga0495600_0106613 | |||
| 897 | Ga0495660_0020612 | |||
| 898 | Ga0495660_0064522 | |||
| 899 | Ga0495676_0022695 | |||
| 900 | Ga0495676_0298171 | |||
| 901 | Ga0495687_000272 | |||
| 902 | Ga0495593_0012215 | |||
| 903 | Ga0495614_0090506 | |||
| 904 | Ga0495615_0010264 | |||
| 905 | Ga0495626_0066150 | |||
| 906 | Ga0496100_0198877 | |||
| 907 | Ga0496101_0096258 | |||
| 908 | Ga0496101_0098900 | |||
| 909 | Ga0496102_0005135 | |||
| 910 | Ga0496103_0014998 | |||
| 911 | Ga0496104_0105218 | |||
| 912 | Ga0496105_0001109 | |||
| 913 | Ga0496106_0006787 | |||
| 914 | Ga0496106_0087770 | |||
| 915 | Ga0496108_0451274 | |||
| 916 | Ga0496110_0184631 | |||
| 917 | Ga0496114_0370558 | |||
| 918 | Ga0496114_0397605 | |||
| 919 | Ga0496116_0011655 | |||
| 920 | Ga0496117_0084603 | |||
| 921 | Ga0496117_0147247 | |||
| 922 | Ga0496118_0004893 | |||
| 923 | Ga0496118_0026096 | |||
| 924 | Ga0496118_0218196 | |||
| 925 | Ga0496119_0057030 | |||
| 926 | Ga0496121_0001309 | |||
| 927 | Ga0496122_0001818 | |||
| 928 | Ga0496122_0085851 | |||
| 929 | Ga0496122_0100304 | |||
| 930 | Ga0496122_0151288 | |||
| 931 | Ga0496122_0196795 | |||
| 932 | Ga0496122_0371253 | |||
| 933 | Ga0496123_0000264 | |||
| 934 | Ga0496123_0032215 | |||
| 935 | Ga0496123_0078037 | |||
| 936 | Ga0496123_0083030 | |||
| 937 | Ga0496124_0130381 | |||
| 938 | Ga0496125_0001110 | |||
| 939 | Ga0496125_0142462 | |||
| 940 | Ga0496125_0165387 | |||
| 941 | Ga0496125_0224682 | |||
| 942 | Ga0501249_004814 | |||
| 943 | Ga0501262_002439 | |||
| 944 | Ga0501263_010652 | |||
| 945 | nmdc:mga03683_10368_c1 | |||
| 946 | nmdc:mga03683_27519_c1 | |||
| 947 | nmdc:mga03683_712_c1 | |||
| 948 | nmdc:mga03n38_44743_c1 | |||
| 949 | nmdc:mga03n38_50311_c1 | |||
| 950 | nmdc:mga03n38_88379_c1 | |||
| 951 | nmdc:mga00v17_23380_c1 | |||
| 952 | nmdc:mga00v17_96146_c1 | |||
| 953 | nmdc:mga0yw44_106034_c1 | |||
| 954 | nmdc:mga0k408_16011_c1 | |||
| 955 | nmdc:mga0k408_17022_c1 | |||
| 956 | nmdc:mga0k408_24756_c1 | |||
| 957 | nmdc:mga0k408_267_c1 | |||
| 958 | nmdc:mga0k408_78316_c1 | |||
| 959 | nmdc:mga04h51_83933_c1 | |||
| 960 | nmdc:mga07m45_216288_c1 | |||
| 961 | nmdc:mga07m45_2251_c2 | |||
| 962 | nmdc:mga07m45_23114_c1 | |||
| 963 | nmdc:mga07m45_29845_c1 | |||
| 964 | nmdc:mga07m45_56772_c1 | |||
| 965 | nmdc:mga05p37_288989_c1 | |||
| 966 | nmdc:mga09592_579_c1 | |||
| 967 | Ga0500610_0022871 | |||
| 968 | Ga0495655_0045875 | |||
| 969 | Ga0500643_016032 | |||
| 970 | Ga0500646_0039208 | |||
| 971 | Ga0500651_0003470 | |||
| 972 | Ga0500555_030455 | |||
| 973 | Ga0500562_044505 | |||
| 974 | Ga0500571_053220 | |||
| 975 | Ga0500592_002657 | |||
| 976 | Ga0500593_000323 | |||
| 977 | Ga0500594_0024727 | |||
| 978 | Ga0500595_103324 | |||
| 979 | Ga0500607_024443 | |||
| 980 | Ga0500608_028679 | |||
| 981 | Ga0500608_046813 | |||
| 982 | Ga0500618_037970 | |||
| 983 | Ga0500655_015829 | |||
| 984 | Ga0500658_0000096 | |||
| 985 | Ga0500658_0000100 | |||
| 986 | Ga0500559_0002108 | |||
| 987 | Ga0500559_0211174 | |||
| 988 | Ga0500564_052788 | |||
| 989 | Ga0500568_0008698 | |||
| 990 | Ga0500574_005670 | |||
| 991 | Ga0500616_0082659 | |||
| 992 | Ga0500619_000142 | |||
| 993 | Ga0500627_0009428 | |||
| 994 | Ga0500634_0000918 | |||
| 995 | Ga0500634_0057644 | |||
| 996 | Ga0590071_001729 | |||
| 997 | 2513227864 | |||
| 998 | 2599622001 | |||
| 999 | 2599676834 | |||
| 1000 | 2599685194 | |||
| 1001 | 2599691511 | |||
| 1002 | 2644161547 | |||
| 1003 | 2644326949 | |||
| 1004 | 2644398747 | |||
| 1005 | 2644466433 | |||
| 1006 | 2722883217 | |||
| 1007 | 2738721970 | |||
| 1008 | 2738882138 | |||
| 1009 | 2739249589 | |||
| 1010 | 2739282334 | |||
| 1011 | 2819598073 | |||
| 1012 | 2831269062 | |||
| 1013 | 2838058484 | |||
| 1014 | 2839143594 | |||
| 1015 | 2842682683 | |||
| 1016 | 2842752185 | |||
| 1017 | 2885194146 | |||
| 1018 | 2885203763 | |||
| 1019 | 2885217902 | |||
| 1020 | 2899929490 | |||
| 1021 | 2904451023 | |||
| 1022 | 2904457879 | |||
| 1023 | 2904543371 | |||
| 1024 | 2919465764 | |||
| 1025 | 2928040064 | |||
| 1026 | 2928047187 | |||
| 1027 | 2928057612 | |||
| 1028 | 2928068006 | |||
| 1029 | 2928072582 | |||
| 1030 | 2928085757 | |||
| 1031 | 2928119350 | |||
| 1032 | 2929160604 | |||
| 1033 | 2929523698 | |||
| 1034 | 2945914910 | |||
| 1035 | 2945951055 | |||
| 1036 | 2945974287 | |||
| 1037 | 2945989694 | |||
| 1038 | 2954769545 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6i6v-assembly1.cif.gz_A | sepiapterin reductase in complex with compound 6 | 0.8835 | 2 | 252 |
| 1nas-assembly1.cif.gz_A | sepiapterin reductase complexed with n-acetyl serotonin | 0.8776 | 1 | 252 |
| 3tfo-assembly1.cif.gz_D | crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti | 0.8734 | 1 | 249 |
| 7e28-assembly1.cif.gz_A | crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium | 0.8733 | 4 | 242 |
| 7e28-assembly1.cif.gz_B | crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium | 0.8724 | 5 | 249 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8994 | 97 | 194 | 3.40.50.720 |
| af_Q53LS6_31_305_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8818 | 3 | 194 | 3.40.50.720 |
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.879 | 2 | 188 | 3.40.50.720 |
| af_Q2QLP7_18_222_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8778 | 6 | 193 | 3.40.50.720 |
| 2et6A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8759 | 3 | 191 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8G1T0-F1-model_v4 | Benzil reductase ((S)-benzoin forming) | 0.9852 | 1 | 254 |
GO:0016491
GO:0052689 |
| AF-A0A3N1X8W5-F1-model_v4 | NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) | 0.9849 | 2 | 252 |
GO:0004757
GO:0005737 GO:0006729 |
| AF-A0A7V8G1T0-F1-model_v4 | Benzil reductase ((S)-benzoin forming) | 0.9814 | 1 | 254 |
GO:0016491
GO:0052689 |
| AF-A0A258P2T2-F1-model_v4 | Short-chain dehydrogenase | 0.9787 | 3 | 252 |
GO:0004757
GO:0005737 GO:0006729 |
| AF-A0A1J5ST53-F1-model_v4 | Benzil reductase ((S)-benzoin forming) (EC 1.1.1.320) | 0.975 | 5 | 254 |
GO:0004757
GO:0005737 GO:0006729 GO:0102306 |