F458476

General Info

Members Datasets Scaffolds Average Seq Length
519 311 1038 253

Family's Representative Sequence

Representative Sequence 3300053121|Ga0500607_005859|Ga0500607_005859_1955_2872
Length 297
Sequence MVYGDVESTSRSVAPFRPGMRNNEHLLYLPQSSNGSPRIHGSQVSFHFHRTMPISHLTLITGASRGLGRAMAEQLLQAGHVVLGISRKQDPQLAELAKAAGAELTQWEQDLSDPVAASARVSAWLKTIDPQRFDSVTLINNAGTVGNPAPLASAVGAELEAPMLLTAAVLGATREWRGARKVLNISSGLGRNAMGSQAPYCAAKAGMDHFSRAVALEEAAAPNGARIVSLAPGIIDTDMQVQLRGASAENFPDRTRFVSMKEEGRLDSPATAAAKVLKYLARADFGNNPVADVRDPA

Samples

Sample ID Description Type Environment
1 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
132 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
138 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
139 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
140 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
156 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
157 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
158 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
159 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
162 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
163 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
167 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
168 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
169 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
170 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
171 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
172 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
173 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
174 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
177 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
213 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
234 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
235 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
236 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
246 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
247 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
248 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
249 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
250 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
251 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
252 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
253 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
254 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
255 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
258 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
259 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
260 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
263 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
264 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
267 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
268 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
269 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
271 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
272 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
273 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
274 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
275 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
276 2643221658 Variovorax sp. Root411 Isolate Unclassified
277 2643221672 Variovorax sp. Root434 Isolate Unclassified
278 2643221683 Variovorax sp. Root473 Isolate Unclassified
279 2721755523 Delftia sp. HK171 Isolate Unclassified
280 2738541277 Variovorax sp. GV051 Isolate Unclassified
281 2738541307 Variovorax sp. GV008 Isolate Unclassified
282 2738543013 Variovorax sp. BT01 Isolate Unclassified
283 2738543019 Variovorax sp. GV040 Isolate Unclassified
284 2818991446 Variovorax sp. 1180 Isolate Unclassified
285 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
286 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
287 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
288 2842677519 Variovorax sp. R-72495 Isolate Unclassified
289 2842747753 Variovorax sp. R-72060 Isolate Unclassified
290 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
291 2885198086 Variovorax sp. 679 Isolate Unclassified
292 2885211737 Variovorax sp. 553 Isolate Unclassified
293 2899924645 Variovorax sp. 369 Isolate Unclassified
294 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
295 2904456579 Variovorax sp. 2002 Isolate Unclassified
296 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
297 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
298 2928037797 Variovorax sp. 1126 Isolate Unclassified
299 2928044640 Variovorax sp. 1128 Isolate Unclassified
300 2928051484 Variovorax sp. 1133 Isolate Unclassified
301 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
302 2928070936 Variovorax gossypii 1167 Isolate Unclassified
303 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
304 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
305 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
306 2929520902 Variovorax beijingensis 502 Isolate Unclassified
307 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
308 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
309 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
310 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
311 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.14
Metatranscriptomes 0.77
Isolates 8.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.45
Nodule 1.16
Rhizoplane 3.28
Rhizosphere 48.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500607_005859 3300053121 Bacteria 7913
2 JGI24740J21852_10058899 3300001979 Bacteria 1066
3 JGI24739J22299_10024071 3300001989 Bacteria 2149
4 JGI24735J21928_10087803 3300002067 Bacteria 891
5 JGI25158J39367_1003572 3300002739 Bacteria 2390
6 JGI25152J39213_1007449 3300002773 Bacteria 2832
7 JGI25152J39213_1009752 3300002773 Bacteria 2254
8 JGI25152J39213_1021572 3300002773 Bacteria 1127
9 JGI25150J39212_1000718 3300002774 Bacteria 11846
10 JGI25150J39212_1003558 3300002774 Bacteria 3636
11 JGI25150J39212_1007071 3300002774 Bacteria 2278
12 JGI25159J45721_1006329 3300002987 Bacteria 3558
13 JGI25159J45721_1007465 3300002987 Bacteria 3131
14 JGI25159J45721_1017077 3300002987 Bacteria 1516
15 JGI25151J46595_10002213 3300003187 Bacteria 12014
16 JGI25151J46595_10008367 3300003187 Bacteria 4982
17 JGI25151J46595_10009581 3300003187 Bacteria 4570
18 JGI25151J46595_10028103 3300003187 Bacteria 2244
19 JGI25153J46596_10012560 3300003215 Bacteria 3644
20 rootH1_10013655 3300003316 Bacteria 6605
21 rootL2_10142366 3300003322 Bacteria 2711
22 rootH1_10030043 3300003323 Bacteria 4714
23 JGI25160J50197_1008199 3300003354 Bacteria 4002
24 JGI25160J50197_1008298 3300003354 Bacteria 3966
25 JGI25161J50226_1002701 3300003374 Bacteria 4397
26 JGI25161J50226_1004046 3300003374 Bacteria 3160
27 Ga0006562J51391_1112371 3300003578 Bacteria 3710
28 Ga0006562J51391_1112372 3300003578 Bacteria 2544
29 Ga0006562J51391_1181373 3300003578 Bacteria 1810
30 Ga0006562J51391_1181374 3300003578 Bacteria 1630
31 Ga0055535_1002469 3300003761 Bacteria 6411
32 Ga0055542_1000003 3300003762 Bacteria 582721
33 Ga0055526_1013030 3300003771 Bacteria 3558
34 Ga0055537_1000819 3300003773 Bacteria 15272
35 Ga0055537_1003007 3300003773 Bacteria 5332
36 Ga0055524_1011028 3300003775 Bacteria 3558
37 Ga0055524_1013422 3300003775 Bacteria 3088
38 Ga0055536_1006783 3300003781 Bacteria 5243
39 Ga0055536_1009299 3300003781 Bacteria 4082
40 Ga0055536_1010143 3300003781 Bacteria 3781
41 Ga0055534_1001205 3300003784 Bacteria 10841
42 Ga0055534_1003154 3300003784 Bacteria 5336
43 Ga0055528_1006417 3300003790 Bacteria 5336
44 Ga0055528_1007537 3300003790 Bacteria 4799
45 Ga0055530_10004055 3300003791 Bacteria 7855
46 Ga0055530_10008763 3300003791 Bacteria 3998
47 Ga0055540_1006642 3300003792 Bacteria 4544
48 Ga0055540_1007817 3300003792 Bacteria 3961
49 Ga0055540_1008258 3300003792 Bacteria 3775
50 Ga0055540_1008834 3300003792 Bacteria 3572
51 Ga0055531_10008762 3300003794 Bacteria 5278
52 Ga0055531_10009563 3300003794 Bacteria 4942
53 Ga0055531_10022162 3300003794 Bacteria 2432
54 Ga0055531_10025590 3300003794 Bacteria 2137
55 Ga0055543_1003699 3300004625 Bacteria 4390
56 Ga0055543_1012629 3300004625 Bacteria 1690
57 Ga0065165_1012771 3300005262 Bacteria 3395
58 Ga0065165_1012863 3300005262 Bacteria 3373
59 Ga0065165_1013939 3300005262 Bacteria 3151
60 Ga0065714_10082236 3300005288 Bacteria 2321
61 Ga0070677_10019494 3300005333 Bacteria 2457
62 Ga0068869_100153808 3300005334 Bacteria 1786
63 Ga0070666_10176868 3300005335 Bacteria 1496
64 Ga0070660_100378137 3300005339 Bacteria 1169
65 Ga0070668_100151171 3300005347 Bacteria 1878
66 Ga0070669_100131374 3300005353 Bacteria 1921
67 Ga0070674_100060272 3300005356 Bacteria 2645
68 Ga0070673_100072689 3300005364 Bacteria 2766
69 Ga0070659_100468388 3300005366 Bacteria 1071
70 Ga0070667_100008514 3300005367 Bacteria 8502
71 Ga0070667_100070420 3300005367 Bacteria 2977
72 Ga0070678_100018582 3300005456 Bacteria 4507
73 Ga0070678_100314913 3300005456 Bacteria 1334
74 Ga0070662_100015807 3300005457 Bacteria 5061
75 Ga0070662_100097017 3300005457 Bacteria 2224
76 Ga0068867_100418224 3300005459 Bacteria 1135
77 Ga0068853_100024482 3300005539 Bacteria 5061
78 Ga0068853_100545391 3300005539 Bacteria 1098
79 Ga0070665_100014019 3300005548 Bacteria 8058
80 Ga0070665_100063617 3300005548 Bacteria 3699
81 Ga0070665_100076707 3300005548 Bacteria 3349
82 Ga0070665_100157994 3300005548 Bacteria 2269
83 Ga0070665_100225190 3300005548 Bacteria 1875
84 Ga0068855_100023604 3300005563 Bacteria 7366
85 Ga0070664_100015785 3300005564 Bacteria 6182
86 Ga0070664_100158382 3300005564 Bacteria 2002
87 Ga0068854_100085141 3300005578 Bacteria 2341
88 Ga0068852_100094223 3300005616 Bacteria 2686
89 Ga0068852_100106171 3300005616 Bacteria 2545
90 Ga0068852_100652271 3300005616 Bacteria 1060
91 Ga0068851_10003855 3300005834 Bacteria 6711
92 Ga0068862_100056123 3300005844 Bacteria 3374
93 Ga0075365_10075163 3300006038 Bacteria 2279
94 Ga0075363_100009573 3300006048 Bacteria 4560
95 Ga0075363_100029571 3300006048 Bacteria 2830
96 Ga0075363_100086724 3300006048 Bacteria 1719
97 Ga0075364_10019647 3300006051 Bacteria 4241
98 Ga0075364_10257974 3300006051 Bacteria 1185
99 Ga0075432_10014618 3300006058 Bacteria 2672
100 Ga0075432_10067177 3300006058 Bacteria 1284
101 Ga0075362_10002300 3300006177 Bacteria 6384
102 Ga0075362_10004470 3300006177 Bacteria 5032
103 Ga0075362_10008027 3300006177 Bacteria 4022
104 Ga0075362_10052028 3300006177 Bacteria 1834
105 Ga0075367_10061213 3300006178 Bacteria 2246
106 Ga0075369_10124818 3300006186 Bacteria 1167
107 Ga0075366_10000230 3300006195 Bacteria 24874
108 Ga0075366_10016881 3300006195 Bacteria 4195
109 Ga0075366_10025184 3300006195 Bacteria 3473
110 Ga0075366_10053055 3300006195 Bacteria 2408
111 Ga0097621_100563732 3300006237 Bacteria 1038
112 Ga0075370_10007439 3300006353 Bacteria 5579
113 Ga0075370_10019410 3300006353 Bacteria 3702
114 Ga0075370_10028947 3300006353 Bacteria 3082
115 Ga0075370_10061716 3300006353 Bacteria 2135
116 Ga0075370_10071425 3300006353 Bacteria 1986
117 Ga0075370_10088022 3300006353 Bacteria 1790
118 Ga0068871_100309202 3300006358 Bacteria 1389
119 Ga0075429_100002953 3300006880 Bacteria 14422
120 Ga0079104_1000007 3300006946 Bacteria 390531
121 Ga0099826_10018393 3300006948 Bacteria 5273
122 Ga0105244_10004236 3300009036 Bacteria 9954
123 Ga0105250_10023612 3300009092 Bacteria 2478
124 Ga0105240_10013451 3300009093 Bacteria 11239
125 Ga0105240_10110778 3300009093 Bacteria 3322
126 Ga0105245_10076221 3300009098 Bacteria 3055
127 Ga0114129_10005410 3300009147 Bacteria 18033
128 Ga0105243_10001699 3300009148 Bacteria 18975
129 Ga0105243_10007111 3300009148 Bacteria 8607
130 Ga0105243_10008605 3300009148 Bacteria 7829
131 Ga0105243_10998959 3300009148 Bacteria 839
132 Ga0105241_10210253 3300009174 Bacteria 1630
133 Ga0105242_10264021 3300009176 Bacteria 1556
134 Ga0105237_10052161 3300009545 Bacteria 4107
135 Ga0105237_10072710 3300009545 Bacteria 3432
136 Ga0105237_10207520 3300009545 Bacteria 1959
137 Ga0105238_10631243 3300009551 Bacteria 1080
138 Ga0105239_10263890 3300010375 Bacteria 1936
139 Ga0105246_10105320 3300011119 Bacteria 2061
140 Ga0105246_10141748 3300011119 Bacteria 1808
141 Ga0105246_10452686 3300011119 Bacteria 1079
142 Ga0157371_10347267 3300013102 Bacteria 1080
143 Ga0157370_10033743 3300013104 Bacteria 4988
144 Ga0157370_10039885 3300013104 Bacteria 4535
145 Ga0157369_10009750 3300013105 Bacteria 10984
146 Ga0163162_10041677 3300013306 Bacteria 4594
147 Ga0163162_10256317 3300013306 Bacteria 1881
148 Ga0157372_10069886 3300013307 Bacteria 3950
149 Ga0157375_10424402 3300013308 Bacteria 1496
150 Ga0157375_10489923 3300013308 Bacteria 1394
151 Ga0182008_10000398 3300014497 Bacteria 33725
152 Ga0182008_10004701 3300014497 Bacteria 7921
153 Ga0182008_10015360 3300014497 Bacteria 3995
154 Ga0182008_10018484 3300014497 Bacteria 3608
155 Ga0157376_10089275 3300014969 Bacteria 2665
156 Ga0157376_10421900 3300014969 Bacteria 1295
157 Ga0182006_1028315 3300015261 Bacteria 2279
158 Ga0182007_10002765 3300015262 Bacteria 8568
159 Ga0182007_10003853 3300015262 Bacteria 6972
160 Ga0183362_10007 3300015683 Bacteria 240101
161 Ga0163161_10000657 3300017792 Bacteria 27646
162 Ga0163161_10046748 3300017792 Bacteria 3123
163 Ga0163161_10053045 3300017792 Bacteria 2940
164 Ga0163161_10061392 3300017792 Bacteria 2736
165 Ga0163161_10103716 3300017792 Bacteria 2119
166 Ga0209436_105391 3300025208 Bacteria 2955
167 Ga0209436_110139 3300025208 Bacteria 1741
168 Ga0209672_100354 3300025228 Bacteria 29117
169 Ga0209147_100439 3300025229 Bacteria 26588
170 Ga0209258_100015 3300025242 Bacteria 706310
171 Ga0207425_1003301 3300025245 Bacteria 5231
172 Ga0207425_1005498 3300025245 Bacteria 3601
173 Ga0209148_1000028 3300025254 Bacteria 582773
174 Ga0209129_1000049 3300025258 Bacteria 268086
175 Ga0209129_1004227 3300025258 Bacteria 5752
176 Ga0209129_1006576 3300025258 Bacteria 3710
177 Ga0209565_1000108 3300025263 Bacteria 120719
178 Ga0209565_1000337 3300025263 Bacteria 41609
179 Ga0209565_1002917 3300025263 Bacteria 5830
180 Ga0209673_1000193 3300025273 Bacteria 123134
181 Ga0209673_1000477 3300025273 Bacteria 66849
182 Ga0209673_1000817 3300025273 Bacteria 41131
183 Ga0209673_1006865 3300025273 Bacteria 5396
184 Ga0209130_1000267 3300025284 Bacteria 65435
185 Ga0209130_1001005 3300025284 Bacteria 21918
186 Ga0209130_1002152 3300025284 Bacteria 10404
187 Ga0209130_1007173 3300025284 Bacteria 3490
188 Ga0209675_1000163 3300025291 Bacteria 81884
189 Ga0209675_1000398 3300025291 Bacteria 36047
190 Ga0209675_1003839 3300025291 Bacteria 6929
191 Ga0209675_1007351 3300025291 Bacteria 4237
192 Ga0209675_1020329 3300025291 Bacteria 1803
193 Ga0209675_1038029 3300025291 Bacteria 1076
194 Ga0209676_1000137 3300025292 Bacteria 179437
195 Ga0209676_1000416 3300025292 Bacteria 76249
196 Ga0209676_1000903 3300025292 Bacteria 37397
197 Ga0209676_1004657 3300025292 Bacteria 7535
198 Ga0209676_1006031 3300025292 Bacteria 6111
199 Ga0209676_1026321 3300025292 Bacteria 1849
200 Ga0209025_1000313 3300025294 Bacteria 107850
201 Ga0209025_1000481 3300025294 Bacteria 77405
202 Ga0209025_1000707 3300025294 Bacteria 56879
203 Ga0209025_1005768 3300025294 Bacteria 9932
204 Ga0209025_1011103 3300025294 Bacteria 5997
205 Ga0209025_1019867 3300025294 Bacteria 3710
206 Ga0209025_1022920 3300025294 Bacteria 3289
207 Ga0209564_1000232 3300025295 Bacteria 122080
208 Ga0209564_1000303 3300025295 Bacteria 97431
209 Ga0209758_1000135 3300025297 Bacteria 177753
210 Ga0209758_1016690 3300025297 Bacteria 3710
211 Ga0209050_1000015 3300025298 Bacteria 759102
212 Ga0209050_1000936 3300025298 Bacteria 38151
213 Ga0209050_1013627 3300025298 Bacteria 3592
214 Ga0209050_1014845 3300025298 Bacteria 3320
215 Ga0209256_1000129 3300025299 Bacteria 163766
216 Ga0207426_1000171 3300025302 Bacteria 163766
217 Ga0207426_1000185 3300025302 Bacteria 154146
218 Ga0207426_1012604 3300025302 Bacteria 3169
219 Ga0209051_1000010 3300025303 Bacteria 641298
220 Ga0209051_1000137 3300025303 Bacteria 137784
221 Ga0209051_1000556 3300025303 Bacteria 45471
222 Ga0209051_1001027 3300025303 Bacteria 26555
223 Ga0209051_1003312 3300025303 Bacteria 10670
224 Ga0209257_1000026 3300025304 Bacteria 723225
225 Ga0209257_1000205 3300025304 Bacteria 143735
226 Ga0209257_1000643 3300025304 Bacteria 55819
227 Ga0209257_1009941 3300025304 Bacteria 4948
228 Ga0209257_1010007 3300025304 Bacteria 4917
229 Ga0209257_1016166 3300025304 Bacteria 3041
230 Ga0207696_1018230 3300025711 Bacteria 2308
231 Ga0207655_1009809 3300025728 Bacteria 5901
232 Ga0207680_10124578 3300025903 Bacteria 1690
233 Ga0207695_10055810 3300025913 Bacteria 4114
234 Ga0207671_10237511 3300025914 Bacteria 1431
235 Ga0207681_10026583 3300025923 Bacteria 3734
236 Ga0207694_10115658 3300025924 Bacteria 2137
237 Ga0207690_10256663 3300025932 Bacteria 1353
238 Ga0207706_10002998 3300025933 Bacteria 16269
239 Ga0207706_10100068 3300025933 Bacteria 2551
240 Ga0207709_10000155 3300025935 Bacteria 93200
241 Ga0207709_10000195 3300025935 Bacteria 80988
242 Ga0207709_10002722 3300025935 Bacteria 10913
243 Ga0207709_10079477 3300025935 Bacteria 2109
244 Ga0207691_10091012 3300025940 Bacteria 2734
245 Ga0207667_10091141 3300025949 Bacteria 3149
246 Ga0207651_10275456 3300025960 Bacteria 1388
247 Ga0207668_10118539 3300025972 Bacteria 2000
248 Ga0207640_10158681 3300025981 Bacteria 1671
249 Ga0207658_10469305 3300025986 Bacteria 1117
250 Ga0207658_10510450 3300025986 Bacteria 1072
251 Ga0207639_10124794 3300026041 Bacteria 2121
252 Ga0207639_10237715 3300026041 Bacteria 1582
253 Ga0207702_10083457 3300026078 Bacteria 2780
254 Ga0207648_10621863 3300026089 Bacteria 997
255 Ga0207674_10010090 3300026116 Bacteria 10739
256 Ga0207674_10188189 3300026116 Bacteria 2014
257 Ga0207683_10028105 3300026121 Bacteria 4863
258 Ga0207683_10180112 3300026121 Bacteria 1916
259 Ga0209281_1000020 3300027111 Bacteria 575972
260 Ga0209281_1007055 3300027111 Bacteria 2847
261 Ga0209983_1031613 3300027665 Bacteria 1129
262 Ga0209282_1000919 3300027666 Bacteria 15361
263 Ga0268266_10117350 3300028379 Bacteria 2365
264 Ga0268266_10293697 3300028379 Bacteria 1514
265 Ga0268266_10310480 3300028379 Bacteria 1473
266 Ga0268266_10346995 3300028379 Bacteria 1394
267 Ga0268265_10048845 3300028380 Bacteria 3179
268 Ga0307515_10000063 3300028794 Bacteria 245504
269 Ga0307515_10017802 3300028794 Bacteria 12919
270 Ga0307515_10168247 3300028794 Bacteria 2199
271 Ga0316176_1075838 3300030732 Bacteria 1322
272 Ga0316178_1084819 3300030735 Bacteria 1245
273 Ga0316181_1146937 3300030744 Bacteria 3882
274 Ga0316182_1171931 3300030745 Bacteria 4104
275 Ga0265327_10006483 3300031251 Bacteria 9343
276 Ga0265327_10029195 3300031251 Bacteria 3140
277 Ga0307513_10110680 3300031456 Bacteria 2741
278 Ga0307513_10188632 3300031456 Bacteria 1916
279 Ga0307513_10224055 3300031456 Bacteria 1699
280 Ga0307408_100118324 3300031548 Bacteria 2048
281 Ga0307408_100195394 3300031548 Bacteria 1633
282 Ga0307408_100307443 3300031548 Bacteria 1330
283 Ga0307408_100570036 3300031548 Bacteria 1002
284 Ga0307514_10006305 3300031649 Bacteria 10376
285 Ga0307516_10000360 3300031730 Bacteria 59179
286 Ga0307516_10026971 3300031730 Bacteria 5829
287 Ga0307405_10030099 3300031731 Bacteria 3180
288 Ga0307405_10068715 3300031731 Bacteria 2268
289 Ga0307405_10110497 3300031731 Bacteria 1861
290 Ga0307413_10072881 3300031824 Bacteria 2169
291 Ga0307412_10026702 3300031911 Bacteria 3592
292 Ga0307412_10352946 3300031911 Bacteria 1181
293 Ga0307416_100018352 3300032002 Bacteria 4926
294 Ga0307416_100235703 3300032002 Bacteria 1768
295 Ga0307414_10488259 3300032004 Bacteria 1087
296 Ga0307411_10064000 3300032005 Bacteria 2460
297 Ga0307411_10151633 3300032005 Bacteria 1723
298 Ga0395900_0146234 3300037418 Bacteria 2417
299 Ga0395898_0055016 3300037466 Bacteria 3882
300 Ga0395905_0007343 3300037471 Bacteria 10975
301 Ga0395905_0039209 3300037471 Bacteria 4444
302 Ga0395905_0043843 3300037471 Bacteria 4197
303 Ga0395905_0096191 3300037471 Bacteria 2780
304 Ga0439436_0001547 3300041404 Bacteria 6694
305 Ga0439436_0003450 3300041404 Bacteria 4805
306 Ga0439439_0001042 3300041406 Bacteria 5246
307 Ga0439447_019122 3300041407 Bacteria 1831
308 Ga0439461_0012437 3300041410 Bacteria 1593
309 Ga0439466_0006006 3300041411 Bacteria 4622
310 Ga0439466_0007950 3300041411 Bacteria 3999
311 Ga0439466_0069912 3300041411 Bacteria 1119
312 Ga0439465_0001706 3300041413 Bacteria 7176
313 Ga0439465_0025901 3300041413 Bacteria 1853
314 Ga0451791_0271330 3300041451 Bacteria 852
315 Ga0439433_0001126 3300041999 Bacteria 5456
316 Ga0439433_0005304 3300041999 Bacteria 2769
317 Ga0439433_0034047 3300041999 Bacteria 1172
318 Ga0439442_005026 3300042002 Bacteria 2641
319 Ga0439442_009616 3300042002 Bacteria 1954
320 Ga0439445_0015973 3300042004 Bacteria 1843
321 Ga0439445_0016457 3300042004 Bacteria 1819
322 Ga0439449_0001898 3300042007 Bacteria 8215
323 Ga0439449_0004383 3300042007 Bacteria 5443
324 Ga0439449_0017756 3300042007 Bacteria 2671
325 Ga0439449_0056924 3300042007 Bacteria 1444
326 Ga0439452_003600 3300042010 Bacteria 5399
327 Ga0439457_008454 3300042014 Bacteria 2428
328 Ga0439457_028703 3300042014 Bacteria 1232
329 Ga0439462_0002073 3300042015 Bacteria 4601
330 Ga0439462_0002470 3300042015 Bacteria 4299
331 Ga0439462_0004189 3300042015 Bacteria 3508
332 Ga0450921_000255 3300042123 Bacteria 2267
333 Ga0450923_011942 3300042125 Bacteria 1572
334 Ga0450890_013022 3300042127 Bacteria 1083
335 Ga0450894_010332 3300042131 Bacteria 1212
336 Ga0450896_002471 3300042133 Bacteria 2388
337 Ga0450906_000981 3300042145 Bacteria 6272
338 Ga0450906_035222 3300042145 Bacteria 884
339 Ga0439446_0004350 3300042156 Bacteria 3589
340 Ga0450908_013206 3300042184 Bacteria 1491
341 Ga0450909_005551 3300042185 Bacteria 1814
342 Ga0439434_0001921 3300042435 Bacteria 6024
343 Ga0450893_0003245 3300042532 Bacteria 2556
344 Ga0451577_0019663 3300042876 Bacteria 6207
345 Ga0451577_0159908 3300042876 Bacteria 2028
346 Ga0466969_0110498 3300044656 Bacteria 1287
347 Ga0466972_0002649 3300044658 Bacteria 8859
348 Ga0466966_0030507 3300044684 Bacteria 3501
349 Ga0466961_0002048 3300044693 Bacteria 12550
350 Ga0466959_0000990 3300045049 Bacteria 16905
351 Ga0495651_0249468 3300046462 Bacteria 1213
352 Ga0495606_0027176 3300046507 Bacteria 4063
353 Ga0495610_0016012 3300046512 Bacteria 4334
354 Ga0495616_0006735 3300046513 Bacteria 6927
355 Ga0495620_0029880 3300046515 Bacteria 2516
356 Ga0495631_0000568 3300046518 Bacteria 24838
357 Ga0495632_0034174 3300046519 Bacteria 2604
358 Ga0495637_0016644 3300046520 Bacteria 3435
359 Ga0495637_0025889 3300046520 Bacteria 2640
360 Ga0495654_0047432 3300046530 Bacteria 2111
361 Ga0495621_0003634 3300046539 Bacteria 4259
362 Ga0495621_0009953 3300046539 Bacteria 2901
363 Ga0495597_0005867 3300046542 Bacteria 6419
364 Ga0495622_0181402 3300046557 Bacteria 944
365 Ga0495633_0102441 3300046558 Bacteria 1329
366 Ga0495656_0000049 3300046615 Bacteria 56829
367 Ga0495625_0000510 3300046660 Bacteria 57454
368 Ga0495625_0029493 3300046660 Bacteria 4101
369 Ga0495635_0392574 3300046663 Bacteria 922
370 Ga0495588_0041285 3300046674 Bacteria 2355
371 Ga0495588_0071976 3300046674 Bacteria 1798
372 Ga0495588_0128908 3300046674 Bacteria 1334
373 Ga0495658_0177510 3300046683 Bacteria 1320
374 Ga0495670_0148287 3300046691 Bacteria 1229
375 Ga0495670_0204869 3300046691 Bacteria 1045
376 Ga0495649_0001080 3300046694 Bacteria 21269
377 Ga0495600_0106613 3300046809 Bacteria 1826
378 Ga0495660_0020612 3300046810 Bacteria 3779
379 Ga0495660_0064522 3300046810 Bacteria 1957
380 Ga0495676_0022695 3300047321 Bacteria 5455
381 Ga0495676_0298171 3300047321 Bacteria 1088
382 Ga0495687_000272 3300047443 Bacteria 68390
383 Ga0495593_0012215 3300047673 Bacteria 4909
384 Ga0495614_0090506 3300048089 Bacteria 1331
385 Ga0495615_0010264 3300048090 Bacteria 1867
386 Ga0495626_0066150 3300048091 Bacteria 1635
387 Ga0496100_0198877 3300048903 Bacteria 1459
388 Ga0496101_0096258 3300048904 Bacteria 2209
389 Ga0496101_0098900 3300048904 Bacteria 2180
390 Ga0496102_0005135 3300048905 Bacteria 11100
391 Ga0496103_0014998 3300048906 Bacteria 4607
392 Ga0496104_0105218 3300048907 Bacteria 2704
393 Ga0496105_0001109 3300048908 Bacteria 18738
394 Ga0496106_0006787 3300048909 Bacteria 8474
395 Ga0496106_0087770 3300048909 Bacteria 2397
396 Ga0496108_0451274 3300048911 Bacteria 1123
397 Ga0496110_0184631 3300048913 Bacteria 1893
398 Ga0496114_0370558 3300048917 Bacteria 1267
399 Ga0496114_0397605 3300048917 Bacteria 1220
400 Ga0496116_0011655 3300048919 Bacteria 7252
401 Ga0496117_0084603 3300048920 Bacteria 2068
402 Ga0496117_0147247 3300048920 Bacteria 1399
403 Ga0496118_0004893 3300048921 Bacteria 15574
404 Ga0496118_0026096 3300048921 Bacteria 4987
405 Ga0496118_0218196 3300048921 Bacteria 1112
406 Ga0496119_0057030 3300048922 Bacteria 2363
407 Ga0496121_0001309 3300048924 Bacteria 42638
408 Ga0496122_0001818 3300048925 Bacteria 32577
409 Ga0496122_0085851 3300048925 Bacteria 2169
410 Ga0496122_0100304 3300048925 Bacteria 1938
411 Ga0496122_0151288 3300048925 Bacteria 1432
412 Ga0496122_0196795 3300048925 Bacteria 1183
413 Ga0496122_0371253 3300048925 Bacteria 738
414 Ga0496123_0000264 3300048926 Bacteria 105015
415 Ga0496123_0032215 3300048926 Bacteria 3800
416 Ga0496123_0078037 3300048926 Bacteria 2031
417 Ga0496123_0083030 3300048926 Bacteria 1939
418 Ga0496124_0130381 3300048927 Bacteria 1998
419 Ga0496125_0001110 3300048928 Bacteria 41331
420 Ga0496125_0142462 3300048928 Bacteria 1664
421 Ga0496125_0165387 3300048928 Bacteria 1496
422 Ga0496125_0224682 3300048928 Bacteria 1206
423 Ga0501249_004814 3300049679 Bacteria 2747
424 Ga0501262_002439 3300049759 Bacteria 2107
425 Ga0501263_010652 3300049760 Bacteria 1131
426 nmdc:mga03683_10368_c1 3300050489 Bacteria 3341
427 nmdc:mga03683_27519_c1 3300050489 Bacteria 1867
428 nmdc:mga03683_712_c1 3300050489 Bacteria 9551
429 nmdc:mga03n38_44743_c1 3300050490 Bacteria 1946
430 nmdc:mga03n38_50311_c1 3300050490 Bacteria 1857
431 nmdc:mga03n38_88379_c1 3300050490 Bacteria 1470
432 nmdc:mga00v17_23380_c1 3300050491 Bacteria 3575
433 nmdc:mga00v17_96146_c1 3300050491 Bacteria 1865
434 nmdc:mga0yw44_106034_c1 3300050492 Bacteria 1796
435 nmdc:mga0k408_16011_c1 3300050493 Bacteria 4153
436 nmdc:mga0k408_17022_c1 3300050493 Bacteria 4041
437 nmdc:mga0k408_24756_c1 3300050493 Bacteria 3396
438 nmdc:mga0k408_267_c1 3300050493 Bacteria 28555
439 nmdc:mga0k408_78316_c1 3300050493 Bacteria 1933
440 nmdc:mga04h51_83933_c1 3300050495 Bacteria 1135
441 nmdc:mga07m45_216288_c1 3300050496 Bacteria 1115
442 nmdc:mga07m45_2251_c2 3300050496 Bacteria 6619
443 nmdc:mga07m45_23114_c1 3300050496 Bacteria 3396
444 nmdc:mga07m45_29845_c1 3300050496 Bacteria 3019
445 nmdc:mga07m45_56772_c1 3300050496 Bacteria 2213
446 nmdc:mga05p37_288989_c1 3300050507 Bacteria 1952
447 nmdc:mga09592_579_c1 3300050508 Bacteria 27730
448 Ga0500610_0022871 3300053079 Bacteria 3087
449 Ga0495655_0045875 3300053083 Bacteria 1137
450 Ga0500643_016032 3300053087 Bacteria 2553
451 Ga0500646_0039208 3300053090 Bacteria 1328
452 Ga0500651_0003470 3300053093 Bacteria 8619
453 Ga0500555_030455 3300053103 Bacteria 1532
454 Ga0500562_044505 3300053108 Bacteria 1182
455 Ga0500571_053220 3300053110 Bacteria 2115
456 Ga0500592_002657 3300053116 Bacteria 2873
457 Ga0500593_000323 3300053117 Bacteria 19241
458 Ga0500594_0024727 3300053118 Bacteria 1533
459 Ga0500595_103324 3300053119 Bacteria 815
460 Ga0500607_024443 3300053121 Bacteria 3374
461 Ga0500608_028679 3300053122 Bacteria 2628
462 Ga0500608_046813 3300053122 Bacteria 2078
463 Ga0500618_037970 3300053125 Bacteria 1112
464 Ga0500655_015829 3300053133 Bacteria 1385
465 Ga0500658_0000096 3300053134 Bacteria 40172
466 Ga0500658_0000100 3300053134 Bacteria 39487
467 Ga0500559_0002108 3300053136 Bacteria 10590
468 Ga0500559_0211174 3300053136 Bacteria 915
469 Ga0500564_052788 3300053138 Bacteria 1857
470 Ga0500568_0008698 3300053139 Bacteria 4871
471 Ga0500574_005670 3300053141 Bacteria 2451
472 Ga0500616_0082659 3300053153 Bacteria 1610
473 Ga0500619_000142 3300053154 Bacteria 17663
474 Ga0500627_0009428 3300053158 Bacteria 3515
475 Ga0500634_0000918 3300053161 Bacteria 10553
476 Ga0500634_0057644 3300053161 Bacteria 2072
477 Ga0590071_001729 3300059421 Bacteria 5637
478 2513227864 2513020051 Bacteria 6053213
479 2599622001 2599185214 Bacteria 8209958
480 2599676834 2599185226 Bacteria 8233575
481 2599685194 2599185227 Bacteria 8246414
482 2599691511 2599185229 Bacteria 8216126
483 2644161547 2643221628 Bacteria 5745828
484 2644326949 2643221658 Bacteria 6064537
485 2644398747 2643221672 Bacteria 6322190
486 2644466433 2643221683 Bacteria 5749203
487 2722883217 2721755523 Bacteria 6430384
488 2738721970 2738541277 Bacteria 7458140
489 2738882138 2738541307 Bacteria 8606193
490 2739249589 2738543013 Bacteria 5618633
491 2739282334 2738543019 Bacteria 7459457
492 2819598073 2818991446 Bacteria 7757362
493 2831269062 2831265667 Bacteria 7184833
494 2838058484 2838054893 Bacteria 7451788
495 2839143594 2839138175 Bacteria 6549354
496 2842682683 2842677519 Bacteria 5615038
497 2842752185 2842747753 Bacteria 5578255
498 2885194146 2885192300 Bacteria 5882526
499 2885203763 2885198086 Bacteria 7212419
500 2885217902 2885211737 Bacteria 7212420
501 2899929490 2899924645 Bacteria 7487985
502 2904451023 2904449895 Bacteria 6927402
503 2904457879 2904456579 Bacteria 6819253
504 2904543371 2904541872 Bacteria 8915136
505 2919465764 2919462493 Bacteria 5817112
506 2928040064 2928037797 Bacteria 7273642
507 2928047187 2928044640 Bacteria 7271509
508 2928057612 2928051484 Bacteria 7773759
509 2928068006 2928064002 Bacteria 7419480
510 2928072582 2928070936 Bacteria 8062541
511 2928085757 2928084124 Bacteria 7159212
512 2928119350 2928115317 Bacteria 6477646
513 2929160604 2929160207 Bacteria 9075316
514 2929523698 2929520902 Bacteria 6765052
515 2945914910 2945909444 Bacteria 7065066
516 2945951055 2945945610 Bacteria 5951079
517 2945974287 2945972063 Bacteria 6086495
518 2945989694 2945984333 Bacteria 7358892
519 2954769545 2954767861 Bacteria 5535784
520 Ga0500607_005859
521 JGI24740J21852_10058899
522 JGI24739J22299_10024071
523 JGI24735J21928_10087803
524 JGI25158J39367_1003572
525 JGI25152J39213_1007449
526 JGI25152J39213_1009752
527 JGI25152J39213_1021572
528 JGI25150J39212_1000718
529 JGI25150J39212_1003558
530 JGI25150J39212_1007071
531 JGI25159J45721_1006329
532 JGI25159J45721_1007465
533 JGI25159J45721_1017077
534 JGI25151J46595_10002213
535 JGI25151J46595_10008367
536 JGI25151J46595_10009581
537 JGI25151J46595_10028103
538 JGI25153J46596_10012560
539 rootH1_10013655
540 rootL2_10142366
541 rootH1_10030043
542 JGI25160J50197_1008199
543 JGI25160J50197_1008298
544 JGI25161J50226_1002701
545 JGI25161J50226_1004046
546 Ga0006562J51391_1112371
547 Ga0006562J51391_1112372
548 Ga0006562J51391_1181373
549 Ga0006562J51391_1181374
550 Ga0055535_1002469
551 Ga0055542_1000003
552 Ga0055526_1013030
553 Ga0055537_1000819
554 Ga0055537_1003007
555 Ga0055524_1011028
556 Ga0055524_1013422
557 Ga0055536_1006783
558 Ga0055536_1009299
559 Ga0055536_1010143
560 Ga0055534_1001205
561 Ga0055534_1003154
562 Ga0055528_1006417
563 Ga0055528_1007537
564 Ga0055530_10004055
565 Ga0055530_10008763
566 Ga0055540_1006642
567 Ga0055540_1007817
568 Ga0055540_1008258
569 Ga0055540_1008834
570 Ga0055531_10008762
571 Ga0055531_10009563
572 Ga0055531_10022162
573 Ga0055531_10025590
574 Ga0055543_1003699
575 Ga0055543_1012629
576 Ga0065165_1012771
577 Ga0065165_1012863
578 Ga0065165_1013939
579 Ga0065714_10082236
580 Ga0070677_10019494
581 Ga0068869_100153808
582 Ga0070666_10176868
583 Ga0070660_100378137
584 Ga0070668_100151171
585 Ga0070669_100131374
586 Ga0070674_100060272
587 Ga0070673_100072689
588 Ga0070659_100468388
589 Ga0070667_100008514
590 Ga0070667_100070420
591 Ga0070678_100018582
592 Ga0070678_100314913
593 Ga0070662_100015807
594 Ga0070662_100097017
595 Ga0068867_100418224
596 Ga0068853_100024482
597 Ga0068853_100545391
598 Ga0070665_100014019
599 Ga0070665_100063617
600 Ga0070665_100076707
601 Ga0070665_100157994
602 Ga0070665_100225190
603 Ga0068855_100023604
604 Ga0070664_100015785
605 Ga0070664_100158382
606 Ga0068854_100085141
607 Ga0068852_100094223
608 Ga0068852_100106171
609 Ga0068852_100652271
610 Ga0068851_10003855
611 Ga0068862_100056123
612 Ga0075365_10075163
613 Ga0075363_100009573
614 Ga0075363_100029571
615 Ga0075363_100086724
616 Ga0075364_10019647
617 Ga0075364_10257974
618 Ga0075432_10014618
619 Ga0075432_10067177
620 Ga0075362_10002300
621 Ga0075362_10004470
622 Ga0075362_10008027
623 Ga0075362_10052028
624 Ga0075367_10061213
625 Ga0075369_10124818
626 Ga0075366_10000230
627 Ga0075366_10016881
628 Ga0075366_10025184
629 Ga0075366_10053055
630 Ga0097621_100563732
631 Ga0075370_10007439
632 Ga0075370_10019410
633 Ga0075370_10028947
634 Ga0075370_10061716
635 Ga0075370_10071425
636 Ga0075370_10088022
637 Ga0068871_100309202
638 Ga0075429_100002953
639 Ga0079104_1000007
640 Ga0099826_10018393
641 Ga0105244_10004236
642 Ga0105250_10023612
643 Ga0105240_10013451
644 Ga0105240_10110778
645 Ga0105245_10076221
646 Ga0114129_10005410
647 Ga0105243_10001699
648 Ga0105243_10007111
649 Ga0105243_10008605
650 Ga0105243_10998959
651 Ga0105241_10210253
652 Ga0105242_10264021
653 Ga0105237_10052161
654 Ga0105237_10072710
655 Ga0105237_10207520
656 Ga0105238_10631243
657 Ga0105239_10263890
658 Ga0105246_10105320
659 Ga0105246_10141748
660 Ga0105246_10452686
661 Ga0157371_10347267
662 Ga0157370_10033743
663 Ga0157370_10039885
664 Ga0157369_10009750
665 Ga0163162_10041677
666 Ga0163162_10256317
667 Ga0157372_10069886
668 Ga0157375_10424402
669 Ga0157375_10489923
670 Ga0182008_10000398
671 Ga0182008_10004701
672 Ga0182008_10015360
673 Ga0182008_10018484
674 Ga0157376_10089275
675 Ga0157376_10421900
676 Ga0182006_1028315
677 Ga0182007_10002765
678 Ga0182007_10003853
679 Ga0183362_10007
680 Ga0163161_10000657
681 Ga0163161_10046748
682 Ga0163161_10053045
683 Ga0163161_10061392
684 Ga0163161_10103716
685 Ga0209436_105391
686 Ga0209436_110139
687 Ga0209672_100354
688 Ga0209147_100439
689 Ga0209258_100015
690 Ga0207425_1003301
691 Ga0207425_1005498
692 Ga0209148_1000028
693 Ga0209129_1000049
694 Ga0209129_1004227
695 Ga0209129_1006576
696 Ga0209565_1000108
697 Ga0209565_1000337
698 Ga0209565_1002917
699 Ga0209673_1000193
700 Ga0209673_1000477
701 Ga0209673_1000817
702 Ga0209673_1006865
703 Ga0209130_1000267
704 Ga0209130_1001005
705 Ga0209130_1002152
706 Ga0209130_1007173
707 Ga0209675_1000163
708 Ga0209675_1000398
709 Ga0209675_1003839
710 Ga0209675_1007351
711 Ga0209675_1020329
712 Ga0209675_1038029
713 Ga0209676_1000137
714 Ga0209676_1000416
715 Ga0209676_1000903
716 Ga0209676_1004657
717 Ga0209676_1006031
718 Ga0209676_1026321
719 Ga0209025_1000313
720 Ga0209025_1000481
721 Ga0209025_1000707
722 Ga0209025_1005768
723 Ga0209025_1011103
724 Ga0209025_1019867
725 Ga0209025_1022920
726 Ga0209564_1000232
727 Ga0209564_1000303
728 Ga0209758_1000135
729 Ga0209758_1016690
730 Ga0209050_1000015
731 Ga0209050_1000936
732 Ga0209050_1013627
733 Ga0209050_1014845
734 Ga0209256_1000129
735 Ga0207426_1000171
736 Ga0207426_1000185
737 Ga0207426_1012604
738 Ga0209051_1000010
739 Ga0209051_1000137
740 Ga0209051_1000556
741 Ga0209051_1001027
742 Ga0209051_1003312
743 Ga0209257_1000026
744 Ga0209257_1000205
745 Ga0209257_1000643
746 Ga0209257_1009941
747 Ga0209257_1010007
748 Ga0209257_1016166
749 Ga0207696_1018230
750 Ga0207655_1009809
751 Ga0207680_10124578
752 Ga0207695_10055810
753 Ga0207671_10237511
754 Ga0207681_10026583
755 Ga0207694_10115658
756 Ga0207690_10256663
757 Ga0207706_10002998
758 Ga0207706_10100068
759 Ga0207709_10000155
760 Ga0207709_10000195
761 Ga0207709_10002722
762 Ga0207709_10079477
763 Ga0207691_10091012
764 Ga0207667_10091141
765 Ga0207651_10275456
766 Ga0207668_10118539
767 Ga0207640_10158681
768 Ga0207658_10469305
769 Ga0207658_10510450
770 Ga0207639_10124794
771 Ga0207639_10237715
772 Ga0207702_10083457
773 Ga0207648_10621863
774 Ga0207674_10010090
775 Ga0207674_10188189
776 Ga0207683_10028105
777 Ga0207683_10180112
778 Ga0209281_1000020
779 Ga0209281_1007055
780 Ga0209983_1031613
781 Ga0209282_1000919
782 Ga0268266_10117350
783 Ga0268266_10293697
784 Ga0268266_10310480
785 Ga0268266_10346995
786 Ga0268265_10048845
787 Ga0307515_10000063
788 Ga0307515_10017802
789 Ga0307515_10168247
790 Ga0316176_1075838
791 Ga0316178_1084819
792 Ga0316181_1146937
793 Ga0316182_1171931
794 Ga0265327_10006483
795 Ga0265327_10029195
796 Ga0307513_10110680
797 Ga0307513_10188632
798 Ga0307513_10224055
799 Ga0307408_100118324
800 Ga0307408_100195394
801 Ga0307408_100307443
802 Ga0307408_100570036
803 Ga0307514_10006305
804 Ga0307516_10000360
805 Ga0307516_10026971
806 Ga0307405_10030099
807 Ga0307405_10068715
808 Ga0307405_10110497
809 Ga0307413_10072881
810 Ga0307412_10026702
811 Ga0307412_10352946
812 Ga0307416_100018352
813 Ga0307416_100235703
814 Ga0307414_10488259
815 Ga0307411_10064000
816 Ga0307411_10151633
817 Ga0395900_0146234
818 Ga0395898_0055016
819 Ga0395905_0007343
820 Ga0395905_0039209
821 Ga0395905_0043843
822 Ga0395905_0096191
823 Ga0439436_0001547
824 Ga0439436_0003450
825 Ga0439439_0001042
826 Ga0439447_019122
827 Ga0439461_0012437
828 Ga0439466_0006006
829 Ga0439466_0007950
830 Ga0439466_0069912
831 Ga0439465_0001706
832 Ga0439465_0025901
833 Ga0451791_0271330
834 Ga0439433_0001126
835 Ga0439433_0005304
836 Ga0439433_0034047
837 Ga0439442_005026
838 Ga0439442_009616
839 Ga0439445_0015973
840 Ga0439445_0016457
841 Ga0439449_0001898
842 Ga0439449_0004383
843 Ga0439449_0017756
844 Ga0439449_0056924
845 Ga0439452_003600
846 Ga0439457_008454
847 Ga0439457_028703
848 Ga0439462_0002073
849 Ga0439462_0002470
850 Ga0439462_0004189
851 Ga0450921_000255
852 Ga0450923_011942
853 Ga0450890_013022
854 Ga0450894_010332
855 Ga0450896_002471
856 Ga0450906_000981
857 Ga0450906_035222
858 Ga0439446_0004350
859 Ga0450908_013206
860 Ga0450909_005551
861 Ga0439434_0001921
862 Ga0450893_0003245
863 Ga0451577_0019663
864 Ga0451577_0159908
865 Ga0466969_0110498
866 Ga0466972_0002649
867 Ga0466966_0030507
868 Ga0466961_0002048
869 Ga0466959_0000990
870 Ga0495651_0249468
871 Ga0495606_0027176
872 Ga0495610_0016012
873 Ga0495616_0006735
874 Ga0495620_0029880
875 Ga0495631_0000568
876 Ga0495632_0034174
877 Ga0495637_0016644
878 Ga0495637_0025889
879 Ga0495654_0047432
880 Ga0495621_0003634
881 Ga0495621_0009953
882 Ga0495597_0005867
883 Ga0495622_0181402
884 Ga0495633_0102441
885 Ga0495656_0000049
886 Ga0495625_0000510
887 Ga0495625_0029493
888 Ga0495635_0392574
889 Ga0495588_0041285
890 Ga0495588_0071976
891 Ga0495588_0128908
892 Ga0495658_0177510
893 Ga0495670_0148287
894 Ga0495670_0204869
895 Ga0495649_0001080
896 Ga0495600_0106613
897 Ga0495660_0020612
898 Ga0495660_0064522
899 Ga0495676_0022695
900 Ga0495676_0298171
901 Ga0495687_000272
902 Ga0495593_0012215
903 Ga0495614_0090506
904 Ga0495615_0010264
905 Ga0495626_0066150
906 Ga0496100_0198877
907 Ga0496101_0096258
908 Ga0496101_0098900
909 Ga0496102_0005135
910 Ga0496103_0014998
911 Ga0496104_0105218
912 Ga0496105_0001109
913 Ga0496106_0006787
914 Ga0496106_0087770
915 Ga0496108_0451274
916 Ga0496110_0184631
917 Ga0496114_0370558
918 Ga0496114_0397605
919 Ga0496116_0011655
920 Ga0496117_0084603
921 Ga0496117_0147247
922 Ga0496118_0004893
923 Ga0496118_0026096
924 Ga0496118_0218196
925 Ga0496119_0057030
926 Ga0496121_0001309
927 Ga0496122_0001818
928 Ga0496122_0085851
929 Ga0496122_0100304
930 Ga0496122_0151288
931 Ga0496122_0196795
932 Ga0496122_0371253
933 Ga0496123_0000264
934 Ga0496123_0032215
935 Ga0496123_0078037
936 Ga0496123_0083030
937 Ga0496124_0130381
938 Ga0496125_0001110
939 Ga0496125_0142462
940 Ga0496125_0165387
941 Ga0496125_0224682
942 Ga0501249_004814
943 Ga0501262_002439
944 Ga0501263_010652
945 nmdc:mga03683_10368_c1
946 nmdc:mga03683_27519_c1
947 nmdc:mga03683_712_c1
948 nmdc:mga03n38_44743_c1
949 nmdc:mga03n38_50311_c1
950 nmdc:mga03n38_88379_c1
951 nmdc:mga00v17_23380_c1
952 nmdc:mga00v17_96146_c1
953 nmdc:mga0yw44_106034_c1
954 nmdc:mga0k408_16011_c1
955 nmdc:mga0k408_17022_c1
956 nmdc:mga0k408_24756_c1
957 nmdc:mga0k408_267_c1
958 nmdc:mga0k408_78316_c1
959 nmdc:mga04h51_83933_c1
960 nmdc:mga07m45_216288_c1
961 nmdc:mga07m45_2251_c2
962 nmdc:mga07m45_23114_c1
963 nmdc:mga07m45_29845_c1
964 nmdc:mga07m45_56772_c1
965 nmdc:mga05p37_288989_c1
966 nmdc:mga09592_579_c1
967 Ga0500610_0022871
968 Ga0495655_0045875
969 Ga0500643_016032
970 Ga0500646_0039208
971 Ga0500651_0003470
972 Ga0500555_030455
973 Ga0500562_044505
974 Ga0500571_053220
975 Ga0500592_002657
976 Ga0500593_000323
977 Ga0500594_0024727
978 Ga0500595_103324
979 Ga0500607_024443
980 Ga0500608_028679
981 Ga0500608_046813
982 Ga0500618_037970
983 Ga0500655_015829
984 Ga0500658_0000096
985 Ga0500658_0000100
986 Ga0500559_0002108
987 Ga0500559_0211174
988 Ga0500564_052788
989 Ga0500568_0008698
990 Ga0500574_005670
991 Ga0500616_0082659
992 Ga0500619_000142
993 Ga0500627_0009428
994 Ga0500634_0000918
995 Ga0500634_0057644
996 Ga0590071_001729
997 2513227864
998 2599622001
999 2599676834
1000 2599685194
1001 2599691511
1002 2644161547
1003 2644326949
1004 2644398747
1005 2644466433
1006 2722883217
1007 2738721970
1008 2738882138
1009 2739249589
1010 2739282334
1011 2819598073
1012 2831269062
1013 2838058484
1014 2839143594
1015 2842682683
1016 2842752185
1017 2885194146
1018 2885203763
1019 2885217902
1020 2899929490
1021 2904451023
1022 2904457879
1023 2904543371
1024 2919465764
1025 2928040064
1026 2928047187
1027 2928057612
1028 2928068006
1029 2928072582
1030 2928085757
1031 2928119350
1032 2929160604
1033 2929523698
1034 2945914910
1035 2945951055
1036 2945974287
1037 2945989694
1038 2954769545

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

56

248

0.87

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

62

292

0.83

PF08659

KR

KR domain

57

223

0.79

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

58

230

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i6v-assembly1.cif.gz_A sepiapterin reductase in complex with compound 6 0.8835 2 252
1nas-assembly1.cif.gz_A sepiapterin reductase complexed with n-acetyl serotonin 0.8776 1 252
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.8734 1 249
7e28-assembly1.cif.gz_A crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.8733 4 242
7e28-assembly1.cif.gz_B crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.8724 5 249
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8994 97 194 3.40.50.720
af_Q53LS6_31_305_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8818 3 194 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.879 2 188 3.40.50.720
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8778 6 193 3.40.50.720
2et6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8759 3 191 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V8G1T0-F1-model_v4 Benzil reductase ((S)-benzoin forming) 0.9852 1 254 GO:0016491
GO:0052689
AF-A0A3N1X8W5-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9849 2 252 GO:0004757
GO:0005737
GO:0006729
AF-A0A7V8G1T0-F1-model_v4 Benzil reductase ((S)-benzoin forming) 0.9814 1 254 GO:0016491
GO:0052689
AF-A0A258P2T2-F1-model_v4 Short-chain dehydrogenase 0.9787 3 252 GO:0004757
GO:0005737
GO:0006729
AF-A0A1J5ST53-F1-model_v4 Benzil reductase ((S)-benzoin forming) (EC 1.1.1.320) 0.975 5 254 GO:0004757
GO:0005737
GO:0006729
GO:0102306

Map