F458463
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 519 | 381 | 1038 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300048925|Ga0496122_0075275|Ga0496122_0075275_2044_2373 |
| Length | 109 |
| Sequence | MTLTAIIFIHPDGKSVRVESSDGESVMQAATRHGLDGILAECGGNAMCATCHVYVDEDWLTRLPDISDDEDALLEGVATDRLPNSRLSCQIHVTSHLDGMVLRLPERQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 36 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 37 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 40 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 41 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 42 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 47 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 48 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 49 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 50 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 71 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 72 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 73 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 74 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 75 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 113 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 114 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 115 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 116 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 123 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 124 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 126 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 129 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 130 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 131 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 134 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 135 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 136 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 137 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 138 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 139 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 142 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 143 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 144 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 145 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 146 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 147 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 148 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 149 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 150 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 151 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 152 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 153 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 198 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 199 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 200 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 203 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 204 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 205 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 206 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 207 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 208 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 209 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 210 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 211 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 212 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 213 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 214 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 215 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 216 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 217 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 218 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 219 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 220 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 221 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 222 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 223 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 224 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 225 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 226 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 227 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 228 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 229 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 230 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 231 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 232 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 233 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 234 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 235 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 236 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 237 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 238 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 239 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 240 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 241 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 242 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 243 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 244 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 245 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 246 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 247 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 248 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 249 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 250 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 251 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 252 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 253 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 254 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 255 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 256 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 257 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 258 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 259 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 260 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 261 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 262 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 263 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 264 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 265 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 266 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 267 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 268 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 269 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 270 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 271 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 272 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 273 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 274 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 275 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 276 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 277 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 278 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 279 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 280 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 281 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 282 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 283 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 284 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 285 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 286 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 287 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 288 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 289 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 290 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 291 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 292 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 293 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 294 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 295 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 296 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 297 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 298 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 299 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 300 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 301 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 302 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 303 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 304 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 305 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 306 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 307 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 308 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 309 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 310 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 311 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 312 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 313 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 314 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 315 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 316 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 317 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 318 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 319 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 320 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 321 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 322 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 323 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 324 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 325 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 326 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 327 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 328 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 329 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 330 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 331 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 332 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 333 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 334 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 335 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 336 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 337 | 2922368715 | |||
| 338 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 339 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 340 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 341 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 342 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 343 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 344 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 345 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 346 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 347 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 348 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 349 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 350 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 351 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 352 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 353 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 354 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 355 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 356 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 357 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 358 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 359 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 360 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 361 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 362 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 363 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 364 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 365 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 366 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 367 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 368 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 369 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 370 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 371 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 372 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 373 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 374 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 375 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 376 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 377 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 378 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 379 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 380 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 381 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.38 |
| Metatranscriptomes | 0 |
| Isolates | 21.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.85 |
| Nodule | 16.18 |
| Rhizoplane | 4.43 |
| Rhizosphere | 39.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496122_0075275 | 3300048925 | Bacteria | 2383 |
| 2 | LJNas_1030696 | 3300000546 | Bacteria | 578 |
| 3 | JGI25153J46596_10001692 | 3300003215 | Bacteria | 13083 |
| 4 | JGI25153J46596_10011110 | 3300003215 | Bacteria | 4008 |
| 5 | JGI25153J46596_10026722 | 3300003215 | Bacteria | 2038 |
| 6 | JGI25160J50197_1001280 | 3300003354 | Bacteria | 12763 |
| 7 | Ga0055526_1029663 | 3300003771 | Bacteria | 1618 |
| 8 | Ga0055531_10005988 | 3300003794 | Bacteria | 6983 |
| 9 | Ga0065165_1016260 | 3300005262 | Bacteria | 2793 |
| 10 | Ga0065165_1095705 | 3300005262 | Bacteria | 750 |
| 11 | Ga0068868_100255534 | 3300005338 | Bacteria | 1476 |
| 12 | Ga0070660_101392752 | 3300005339 | Bacteria | 596 |
| 13 | Ga0070668_101016616 | 3300005347 | Bacteria | 745 |
| 14 | Ga0070673_102227978 | 3300005364 | Bacteria | 521 |
| 15 | Ga0070659_100853790 | 3300005366 | Bacteria | 794 |
| 16 | Ga0070667_100773347 | 3300005367 | Bacteria | 891 |
| 17 | Ga0070714_100597601 | 3300005435 | Bacteria | 1059 |
| 18 | Ga0070714_101146532 | 3300005435 | Bacteria | 758 |
| 19 | Ga0070713_100010044 | 3300005436 | Bacteria | 6823 |
| 20 | Ga0070710_11188953 | 3300005437 | Bacteria | 563 |
| 21 | Ga0070711_100757420 | 3300005439 | Bacteria | 821 |
| 22 | Ga0070663_100477569 | 3300005455 | Bacteria | 1031 |
| 23 | Ga0070678_100748835 | 3300005456 | Bacteria | 884 |
| 24 | Ga0070662_100115123 | 3300005457 | Bacteria | 2054 |
| 25 | Ga0070685_11439477 | 3300005466 | Bacteria | 530 |
| 26 | Ga0070684_100589830 | 3300005535 | Bacteria | 1033 |
| 27 | Ga0068853_100089449 | 3300005539 | Bacteria | 2704 |
| 28 | Ga0070665_100048058 | 3300005548 | Bacteria | 4284 |
| 29 | Ga0070665_100480978 | 3300005548 | Bacteria | 1253 |
| 30 | Ga0070665_101447709 | 3300005548 | Bacteria | 696 |
| 31 | Ga0068855_100012149 | 3300005563 | Bacteria | 10404 |
| 32 | Ga0068855_100481657 | 3300005563 | Bacteria | 1350 |
| 33 | Ga0068854_100511522 | 3300005578 | Bacteria | 1013 |
| 34 | Ga0068856_100627377 | 3300005614 | Bacteria | 1096 |
| 35 | Ga0068852_100699554 | 3300005616 | Bacteria | 1023 |
| 36 | Ga0068864_101343605 | 3300005618 | Bacteria | 716 |
| 37 | Ga0068851_10343482 | 3300005834 | Bacteria | 867 |
| 38 | Ga0068851_10413349 | 3300005834 | Bacteria | 796 |
| 39 | Ga0068858_100806652 | 3300005842 | Bacteria | 916 |
| 40 | Ga0068860_100002058 | 3300005843 | Bacteria | 21189 |
| 41 | Ga0081455_10019582 | 3300005937 | Bacteria | 6397 |
| 42 | Ga0081455_10092640 | 3300005937 | Bacteria | 2445 |
| 43 | Ga0070717_10090247 | 3300006028 | Bacteria | 2586 |
| 44 | Ga0070717_11143528 | 3300006028 | Bacteria | 709 |
| 45 | Ga0075365_10055985 | 3300006038 | Bacteria | 2621 |
| 46 | Ga0075364_10804476 | 3300006051 | Bacteria | 641 |
| 47 | Ga0070716_100308549 | 3300006173 | Bacteria | 1104 |
| 48 | Ga0070712_100459808 | 3300006175 | Bacteria | 1061 |
| 49 | Ga0070712_101164831 | 3300006175 | Bacteria | 670 |
| 50 | Ga0070712_101343882 | 3300006175 | Bacteria | 623 |
| 51 | Ga0075362_10181495 | 3300006177 | Bacteria | 1020 |
| 52 | Ga0075367_10219437 | 3300006178 | Bacteria | 1190 |
| 53 | Ga0075367_10241969 | 3300006178 | Bacteria | 1131 |
| 54 | Ga0075367_10339947 | 3300006178 | Bacteria | 947 |
| 55 | Ga0075369_10007794 | 3300006186 | Bacteria | 4095 |
| 56 | Ga0075369_10043640 | 3300006186 | Bacteria | 1925 |
| 57 | Ga0075369_10164979 | 3300006186 | Bacteria | 1016 |
| 58 | Ga0075366_10929898 | 3300006195 | Bacteria | 542 |
| 59 | Ga0097621_101017096 | 3300006237 | Bacteria | 776 |
| 60 | Ga0075370_10296526 | 3300006353 | Bacteria | 961 |
| 61 | Ga0075370_10640889 | 3300006353 | Bacteria | 645 |
| 62 | Ga0068871_101799406 | 3300006358 | Bacteria | 582 |
| 63 | Ga0099825_1028838 | 3300006941 | Bacteria | 2646 |
| 64 | Ga0099824_1004372 | 3300006942 | Bacteria | 20372 |
| 65 | Ga0099823_1025568 | 3300006944 | Bacteria | 5274 |
| 66 | Ga0099795_10022883 | 3300007788 | Bacteria | 2068 |
| 67 | Ga0099795_10093190 | 3300007788 | Bacteria | 1170 |
| 68 | Ga0105250_10215780 | 3300009092 | Bacteria | 812 |
| 69 | Ga0105240_10007827 | 3300009093 | Bacteria | 15427 |
| 70 | Ga0105240_11028514 | 3300009093 | Bacteria | 880 |
| 71 | Ga0105245_11517001 | 3300009098 | Bacteria | 721 |
| 72 | Ga0105247_10147544 | 3300009101 | Bacteria | 1547 |
| 73 | Ga0105243_10250773 | 3300009148 | Bacteria | 1580 |
| 74 | Ga0105241_10071726 | 3300009174 | Bacteria | 2690 |
| 75 | Ga0105241_10652125 | 3300009174 | Bacteria | 956 |
| 76 | Ga0105248_10669826 | 3300009177 | Bacteria | 1171 |
| 77 | Ga0105237_10019431 | 3300009545 | Bacteria | 7016 |
| 78 | Ga0105237_10132914 | 3300009545 | Bacteria | 2483 |
| 79 | Ga0105238_10007870 | 3300009551 | Bacteria | 10662 |
| 80 | Ga0105238_10908028 | 3300009551 | Bacteria | 899 |
| 81 | Ga0099796_10114791 | 3300010159 | Bacteria | 1029 |
| 82 | Ga0099796_10225365 | 3300010159 | Bacteria | 770 |
| 83 | Ga0105239_10016692 | 3300010375 | Bacteria | 8116 |
| 84 | Ga0105239_10079186 | 3300010375 | Bacteria | 3616 |
| 85 | Ga0105239_10092022 | 3300010375 | Bacteria | 3347 |
| 86 | Ga0105239_10151651 | 3300010375 | Bacteria | 2587 |
| 87 | Ga0105246_10354582 | 3300011119 | Bacteria | 1203 |
| 88 | Ga0157374_10202276 | 3300013296 | Bacteria | 1945 |
| 89 | Ga0157374_10653640 | 3300013296 | Bacteria | 1063 |
| 90 | Ga0163162_10278070 | 3300013306 | Bacteria | 1806 |
| 91 | Ga0163162_10504831 | 3300013306 | Bacteria | 1340 |
| 92 | Ga0157372_12085171 | 3300013307 | Bacteria | 651 |
| 93 | Ga0157375_10128833 | 3300013308 | Bacteria | 2649 |
| 94 | Ga0163163_10155692 | 3300014325 | Bacteria | 2330 |
| 95 | Ga0182008_10682220 | 3300014497 | Bacteria | 585 |
| 96 | Ga0157376_11218059 | 3300014969 | Bacteria | 781 |
| 97 | Ga0157376_11906787 | 3300014969 | Bacteria | 631 |
| 98 | Ga0163161_10959385 | 3300017792 | Bacteria | 728 |
| 99 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 100 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 101 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 102 | Ga0214545_1037165 | 3300021324 | Bacteria | 1494 |
| 103 | Ga0214543_1000007 | 3300021327 | Bacteria | 414744 |
| 104 | Ga0213876_10002313 | 3300021384 | Bacteria | 11242 |
| 105 | Ga0209233_1062543 | 3300025261 | Bacteria | 714 |
| 106 | Ga0209673_1029096 | 3300025273 | Bacteria | 1764 |
| 107 | Ga0209025_1124256 | 3300025294 | Bacteria | 764 |
| 108 | Ga0209564_1013475 | 3300025295 | Bacteria | 3468 |
| 109 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 110 | Ga0209758_1001252 | 3300025297 | Bacteria | 31479 |
| 111 | Ga0209758_1001829 | 3300025297 | Bacteria | 23439 |
| 112 | Ga0209758_1005164 | 3300025297 | Bacteria | 10270 |
| 113 | Ga0209758_1033529 | 3300025297 | Bacteria | 2059 |
| 114 | Ga0209256_1006017 | 3300025299 | Bacteria | 6638 |
| 115 | Ga0207426_1000585 | 3300025302 | Bacteria | 48529 |
| 116 | Ga0207426_1006102 | 3300025302 | Bacteria | 5308 |
| 117 | Ga0209257_1001348 | 3300025304 | Bacteria | 29776 |
| 118 | Ga0209257_1031969 | 3300025304 | Bacteria | 1674 |
| 119 | Ga0207710_10131336 | 3300025900 | Bacteria | 1203 |
| 120 | Ga0207647_10549741 | 3300025904 | Bacteria | 640 |
| 121 | Ga0207654_10041745 | 3300025911 | Bacteria | 2593 |
| 122 | Ga0207695_10000548 | 3300025913 | Bacteria | 77673 |
| 123 | Ga0207695_10161116 | 3300025913 | Bacteria | 2175 |
| 124 | Ga0207671_10006410 | 3300025914 | Bacteria | 10483 |
| 125 | Ga0207671_10009328 | 3300025914 | Bacteria | 8213 |
| 126 | Ga0207671_10243876 | 3300025914 | Bacteria | 1412 |
| 127 | Ga0207671_11212082 | 3300025914 | Bacteria | 590 |
| 128 | Ga0207693_10184496 | 3300025915 | Bacteria | 1642 |
| 129 | Ga0207657_10640765 | 3300025919 | Bacteria | 828 |
| 130 | Ga0207694_10010496 | 3300025924 | Bacteria | 6988 |
| 131 | Ga0207650_11394595 | 3300025925 | Bacteria | 596 |
| 132 | Ga0207687_11479088 | 3300025927 | Bacteria | 584 |
| 133 | Ga0207700_10007140 | 3300025928 | Bacteria | 6808 |
| 134 | Ga0207690_10586698 | 3300025932 | Bacteria | 909 |
| 135 | Ga0207706_10416526 | 3300025933 | Bacteria | 1164 |
| 136 | Ga0207665_10319165 | 3300025939 | Bacteria | 1165 |
| 137 | Ga0207711_10962285 | 3300025941 | Bacteria | 793 |
| 138 | Ga0207667_10057124 | 3300025949 | Bacteria | 4097 |
| 139 | Ga0207667_10549600 | 3300025949 | Bacteria | 1168 |
| 140 | Ga0207668_10040472 | 3300025972 | Bacteria | 3145 |
| 141 | Ga0207668_10558188 | 3300025972 | Bacteria | 993 |
| 142 | Ga0207640_10496564 | 3300025981 | Bacteria | 1015 |
| 143 | Ga0207640_10527131 | 3300025981 | Bacteria | 988 |
| 144 | Ga0207658_10541359 | 3300025986 | Bacteria | 1041 |
| 145 | Ga0207677_10376278 | 3300026023 | Bacteria | 1197 |
| 146 | Ga0207703_10730652 | 3300026035 | Bacteria | 943 |
| 147 | Ga0207703_10887070 | 3300026035 | Bacteria | 854 |
| 148 | Ga0207703_11525691 | 3300026035 | Bacteria | 643 |
| 149 | Ga0207639_10270453 | 3300026041 | Bacteria | 1490 |
| 150 | Ga0207639_10520855 | 3300026041 | Bacteria | 1089 |
| 151 | Ga0207678_10021859 | 3300026067 | Bacteria | 5610 |
| 152 | Ga0207641_11148933 | 3300026088 | Bacteria | 776 |
| 153 | Ga0207648_10146186 | 3300026089 | Bacteria | 2085 |
| 154 | Ga0207676_11926309 | 3300026095 | Bacteria | 590 |
| 155 | Ga0207675_101425447 | 3300026118 | Bacteria | 713 |
| 156 | Ga0207683_10718681 | 3300026121 | Bacteria | 926 |
| 157 | Ga0207698_10039537 | 3300026142 | Bacteria | 3496 |
| 158 | Ga0209389_1000015 | 3300027296 | Bacteria | 188311 |
| 159 | Ga0209389_1000029 | 3300027296 | Bacteria | 140337 |
| 160 | Ga0209589_1000012 | 3300027357 | Bacteria | 229451 |
| 161 | Ga0209589_1000013 | 3300027357 | Bacteria | 229273 |
| 162 | Ga0209489_100013 | 3300027361 | Bacteria | 229831 |
| 163 | Ga0209489_100072 | 3300027361 | Bacteria | 138111 |
| 164 | Ga0209700_100034 | 3300027363 | Bacteria | 197276 |
| 165 | Ga0209179_1036438 | 3300027512 | Bacteria | 1025 |
| 166 | Ga0209588_1023187 | 3300027671 | Bacteria | 1955 |
| 167 | Ga0268266_10081037 | 3300028379 | Bacteria | 2829 |
| 168 | Ga0268266_11254151 | 3300028379 | Bacteria | 716 |
| 169 | Ga0268264_10000049 | 3300028381 | Bacteria | 329992 |
| 170 | Ga0265330_10061488 | 3300031235 | Bacteria | 1634 |
| 171 | Ga0265332_10010078 | 3300031238 | Bacteria | 4208 |
| 172 | Ga0265328_10019935 | 3300031239 | Bacteria | 2570 |
| 173 | Ga0265325_10032926 | 3300031241 | Bacteria | 2765 |
| 174 | Ga0265329_10211603 | 3300031242 | Bacteria | 640 |
| 175 | Ga0265340_10208915 | 3300031247 | Bacteria | 877 |
| 176 | Ga0265339_10045684 | 3300031249 | Bacteria | 2410 |
| 177 | Ga0265331_10049017 | 3300031250 | Bacteria | 2030 |
| 178 | Ga0265316_10249261 | 3300031344 | Bacteria | 1304 |
| 179 | Ga0307509_10022323 | 3300031507 | Bacteria | 7137 |
| 180 | Ga0307509_10449967 | 3300031507 | Bacteria | 982 |
| 181 | Ga0307508_10000046 | 3300031616 | Bacteria | 139709 |
| 182 | Ga0307508_10176880 | 3300031616 | Bacteria | 1737 |
| 183 | Ga0307508_10443372 | 3300031616 | Bacteria | 890 |
| 184 | Ga0265314_10166526 | 3300031711 | Bacteria | 1335 |
| 185 | Ga0265314_10594883 | 3300031711 | Bacteria | 570 |
| 186 | Ga0265342_10216067 | 3300031712 | Bacteria | 1035 |
| 187 | Ga0307516_10542842 | 3300031730 | Bacteria | 816 |
| 188 | Ga0307412_10021329 | 3300031911 | Bacteria | 3956 |
| 189 | Ga0307507_10010582 | 3300033179 | Bacteria | 11885 |
| 190 | Ga0316212_1048739 | 3300033547 | Bacteria | 602 |
| 191 | Ga0373935_0480597 | 3300035692 | Bacteria | 900 |
| 192 | Ga0373927_0082091 | 3300035695 | Bacteria | 2089 |
| 193 | Ga0395905_0002607 | 3300037471 | Bacteria | 19855 |
| 194 | Ga0395905_0919694 | 3300037471 | Bacteria | 778 |
| 195 | Ga0395901_0380831 | 3300038443 | Bacteria | 1452 |
| 196 | Ga0395901_0833300 | 3300038443 | Bacteria | 909 |
| 197 | Ga0436365_0989879 | 3300039437 | Bacteria | 21862 |
| 198 | Ga0439446_0278489 | 3300042156 | Bacteria | 583 |
| 199 | Ga0466969_0008112 | 3300044656 | Bacteria | 5575 |
| 200 | Ga0466972_0004158 | 3300044658 | Bacteria | 7224 |
| 201 | Ga0466972_0075631 | 3300044658 | Bacteria | 1605 |
| 202 | Ga0466972_0262536 | 3300044658 | Bacteria | 807 |
| 203 | Ga0466965_0076432 | 3300044683 | Bacteria | 1690 |
| 204 | Ga0466965_0083061 | 3300044683 | Bacteria | 1621 |
| 205 | Ga0466965_0184644 | 3300044683 | Bacteria | 1101 |
| 206 | Ga0466966_0000238 | 3300044684 | Bacteria | 36401 |
| 207 | Ga0466961_0000044 | 3300044693 | Bacteria | 76071 |
| 208 | Ga0466964_0176080 | 3300044706 | Bacteria | 1011 |
| 209 | Ga0466964_0317715 | 3300044706 | Bacteria | 790 |
| 210 | Ga0466968_0020935 | 3300044735 | Bacteria | 2644 |
| 211 | Ga0466970_0440606 | 3300044765 | Bacteria | 746 |
| 212 | Ga0466960_0004740 | 3300044901 | Bacteria | 5342 |
| 213 | Ga0466960_0086072 | 3300044901 | Bacteria | 1593 |
| 214 | Ga0466960_0841481 | 3300044901 | Bacteria | 557 |
| 215 | Ga0466959_0000963 | 3300045049 | Bacteria | 17121 |
| 216 | Ga0495629_0546964 | 3300046459 | Bacteria | 777 |
| 217 | Ga0495638_0046390 | 3300046460 | Bacteria | 2729 |
| 218 | Ga0495651_0122593 | 3300046462 | Bacteria | 1907 |
| 219 | Ga0495639_0541176 | 3300046475 | Bacteria | 596 |
| 220 | Ga0495664_0158930 | 3300046477 | Bacteria | 1371 |
| 221 | Ga0495585_0438682 | 3300046492 | Bacteria | 626 |
| 222 | Ga0495594_0730347 | 3300046499 | Bacteria | 559 |
| 223 | Ga0495596_0180228 | 3300046500 | Bacteria | 821 |
| 224 | Ga0495607_0171007 | 3300046501 | Bacteria | 1097 |
| 225 | Ga0495607_0243049 | 3300046501 | Bacteria | 870 |
| 226 | Ga0495583_0089330 | 3300046506 | Bacteria | 1329 |
| 227 | Ga0495606_0046405 | 3300046507 | Bacteria | 2872 |
| 228 | Ga0495606_0113838 | 3300046507 | Bacteria | 1628 |
| 229 | Ga0495610_0368979 | 3300046512 | Bacteria | 536 |
| 230 | Ga0495616_0042119 | 3300046513 | Bacteria | 2326 |
| 231 | Ga0495620_0020355 | 3300046515 | Bacteria | 3242 |
| 232 | Ga0495632_0053579 | 3300046519 | Bacteria | 1981 |
| 233 | Ga0495643_0062009 | 3300046522 | Bacteria | 1981 |
| 234 | Ga0495643_0129445 | 3300046522 | Bacteria | 1268 |
| 235 | Ga0495648_0001433 | 3300046524 | Bacteria | 23346 |
| 236 | Ga0495648_0082093 | 3300046524 | Bacteria | 1831 |
| 237 | Ga0495648_0157191 | 3300046524 | Bacteria | 1179 |
| 238 | Ga0495652_0055076 | 3300046529 | Bacteria | 3384 |
| 239 | Ga0495654_0009803 | 3300046530 | Bacteria | 5235 |
| 240 | Ga0495622_0117176 | 3300046557 | Bacteria | 1217 |
| 241 | Ga0495668_0092366 | 3300046616 | Bacteria | 1658 |
| 242 | Ga0495668_0161919 | 3300046616 | Bacteria | 1226 |
| 243 | Ga0495668_0187758 | 3300046616 | Bacteria | 1132 |
| 244 | Ga0495611_0027324 | 3300046648 | Bacteria | 2494 |
| 245 | Ga0495611_0162027 | 3300046648 | Bacteria | 1045 |
| 246 | Ga0495625_0014301 | 3300046660 | Bacteria | 6341 |
| 247 | Ga0495625_0846440 | 3300046660 | Bacteria | 528 |
| 248 | Ga0495661_0297885 | 3300046665 | Bacteria | 808 |
| 249 | Ga0495588_0021077 | 3300046674 | Bacteria | 3208 |
| 250 | Ga0495588_0209136 | 3300046674 | Bacteria | 1030 |
| 251 | Ga0495599_0633468 | 3300046678 | Bacteria | 621 |
| 252 | Ga0495624_0118741 | 3300046690 | Bacteria | 1625 |
| 253 | Ga0495670_0010379 | 3300046691 | Bacteria | 4575 |
| 254 | Ga0495671_0164005 | 3300046692 | Bacteria | 1081 |
| 255 | Ga0495649_0044277 | 3300046694 | Bacteria | 2430 |
| 256 | Ga0495589_0178241 | 3300046794 | Bacteria | 1009 |
| 257 | Ga0495589_0305604 | 3300046794 | Bacteria | 737 |
| 258 | Ga0495604_0411784 | 3300047317 | Bacteria | 889 |
| 259 | Ga0495672_0399120 | 3300047320 | Bacteria | 629 |
| 260 | Ga0495672_0556898 | 3300047320 | Bacteria | 502 |
| 261 | Ga0495677_0060051 | 3300047445 | Bacteria | 1409 |
| 262 | Ga0495673_0168243 | 3300047469 | Bacteria | 837 |
| 263 | Ga0495681_0118997 | 3300047470 | Bacteria | 1135 |
| 264 | Ga0495686_0130058 | 3300047472 | Bacteria | 1493 |
| 265 | Ga0495686_0251196 | 3300047472 | Bacteria | 994 |
| 266 | Ga0495614_0192017 | 3300048089 | Bacteria | 922 |
| 267 | Ga0495626_0151617 | 3300048091 | Bacteria | 977 |
| 268 | Ga0496100_0199540 | 3300048903 | Bacteria | 1457 |
| 269 | Ga0496100_0571970 | 3300048903 | Bacteria | 876 |
| 270 | Ga0496101_0521291 | 3300048904 | Bacteria | 939 |
| 271 | Ga0496102_0253775 | 3300048905 | Bacteria | 1658 |
| 272 | Ga0496102_1625759 | 3300048905 | Bacteria | 564 |
| 273 | Ga0496103_0538701 | 3300048906 | Bacteria | 746 |
| 274 | Ga0496104_0469990 | 3300048907 | Bacteria | 1169 |
| 275 | Ga0496105_0458340 | 3300048908 | Bacteria | 1005 |
| 276 | Ga0496106_0001452 | 3300048909 | Bacteria | 17800 |
| 277 | Ga0496106_0190724 | 3300048909 | Bacteria | 1629 |
| 278 | Ga0496107_0924167 | 3300048910 | Bacteria | 635 |
| 279 | Ga0496108_0173658 | 3300048911 | Bacteria | 1865 |
| 280 | Ga0496108_0473137 | 3300048911 | Bacteria | 1095 |
| 281 | Ga0496109_0541762 | 3300048912 | Bacteria | 1098 |
| 282 | Ga0496110_0048909 | 3300048913 | Bacteria | 3708 |
| 283 | Ga0496111_0298750 | 3300048914 | Bacteria | 1194 |
| 284 | Ga0496112_0248293 | 3300048915 | Bacteria | 1731 |
| 285 | Ga0496113_0287642 | 3300048916 | Bacteria | 1315 |
| 286 | Ga0496113_0686848 | 3300048916 | Bacteria | 817 |
| 287 | Ga0496114_0113764 | 3300048917 | Bacteria | 2320 |
| 288 | Ga0496114_0830960 | 3300048917 | Bacteria | 803 |
| 289 | Ga0496115_0117181 | 3300048918 | Bacteria | 2191 |
| 290 | Ga0496116_0006682 | 3300048919 | Bacteria | 10401 |
| 291 | Ga0496116_0044872 | 3300048919 | Bacteria | 2997 |
| 292 | Ga0496116_0149352 | 3300048919 | Bacteria | 1301 |
| 293 | Ga0496117_0035646 | 3300048920 | Bacteria | 3732 |
| 294 | Ga0496117_0096481 | 3300048920 | Bacteria | 1886 |
| 295 | Ga0496117_0109611 | 3300048920 | Bacteria | 1723 |
| 296 | Ga0496117_0121561 | 3300048920 | Bacteria | 1603 |
| 297 | Ga0496117_0600970 | 3300048920 | Bacteria | 514 |
| 298 | Ga0496118_0009493 | 3300048921 | Bacteria | 9812 |
| 299 | Ga0496118_0072113 | 3300048921 | Bacteria | 2482 |
| 300 | Ga0496118_0072195 | 3300048921 | Bacteria | 2480 |
| 301 | Ga0496118_0078253 | 3300048921 | Bacteria | 2341 |
| 302 | Ga0496118_0178736 | 3300048921 | Bacteria | 1285 |
| 303 | Ga0496118_0295041 | 3300048921 | Bacteria | 893 |
| 304 | Ga0496119_0096735 | 3300048922 | Bacteria | 1665 |
| 305 | Ga0496119_0108773 | 3300048922 | Bacteria | 1543 |
| 306 | Ga0496119_0118559 | 3300048922 | Bacteria | 1458 |
| 307 | Ga0496120_0484259 | 3300048923 | Bacteria | 534 |
| 308 | Ga0496121_0000261 | 3300048924 | Bacteria | 110085 |
| 309 | Ga0496121_0028610 | 3300048924 | Bacteria | 5184 |
| 310 | Ga0496121_0047604 | 3300048924 | Bacteria | 3656 |
| 311 | Ga0496121_0061363 | 3300048924 | Bacteria | 3085 |
| 312 | Ga0496121_0209964 | 3300048924 | Bacteria | 1380 |
| 313 | Ga0496121_0482125 | 3300048924 | Bacteria | 792 |
| 314 | Ga0496122_0050542 | 3300048925 | Bacteria | 3169 |
| 315 | Ga0496122_0209247 | 3300048925 | Bacteria | 1131 |
| 316 | Ga0496123_0055443 | 3300048926 | Bacteria | 2600 |
| 317 | Ga0496123_0131684 | 3300048926 | Bacteria | 1384 |
| 318 | Ga0496123_0271951 | 3300048926 | Bacteria | 824 |
| 319 | Ga0496123_0383686 | 3300048926 | Bacteria | 644 |
| 320 | Ga0496124_0002998 | 3300048927 | Bacteria | 21122 |
| 321 | Ga0496124_0211266 | 3300048927 | Bacteria | 1468 |
| 322 | Ga0496124_0306189 | 3300048927 | Bacteria | 1145 |
| 323 | Ga0496125_0000210 | 3300048928 | Bacteria | 121786 |
| 324 | Ga0496125_0059133 | 3300048928 | Bacteria | 3090 |
| 325 | Ga0496125_0065440 | 3300048928 | Bacteria | 2880 |
| 326 | Ga0496125_0067620 | 3300048928 | Bacteria | 2814 |
| 327 | Ga0496125_0123562 | 3300048928 | Bacteria | 1840 |
| 328 | Ga0496125_0244787 | 3300048928 | Bacteria | 1136 |
| 329 | Ga0496125_0573660 | 3300048928 | Bacteria | 621 |
| 330 | Ga0496126_0008831 | 3300048929 | Bacteria | 10808 |
| 331 | Ga0496126_0139264 | 3300048929 | Bacteria | 2090 |
| 332 | Ga0496126_0143953 | 3300048929 | Bacteria | 2049 |
| 333 | Ga0496126_0146174 | 3300048929 | Bacteria | 2030 |
| 334 | Ga0496126_0176256 | 3300048929 | Bacteria | 1818 |
| 335 | Ga0496126_0322426 | 3300048929 | Bacteria | 1269 |
| 336 | Ga0496126_0659818 | 3300048929 | Bacteria | 817 |
| 337 | Ga0496126_1248316 | 3300048929 | Bacteria | 544 |
| 338 | nmdc:mga03683_221736_c1 | 3300050489 | Bacteria | 872 |
| 339 | nmdc:mga03683_553775_c1 | 3300050489 | Bacteria | 560 |
| 340 | nmdc:mga03n38_852652_c1 | 3300050490 | Bacteria | 533 |
| 341 | nmdc:mga0yw44_219630_c1 | 3300050492 | Bacteria | 1259 |
| 342 | nmdc:mga0yw44_3707_c1 | 3300050492 | Bacteria | 6839 |
| 343 | nmdc:mga0yw44_75963_c1 | 3300050492 | Bacteria | 2096 |
| 344 | nmdc:mga0k408_366744_c1 | 3300050493 | Bacteria | 858 |
| 345 | nmdc:mga0k408_906164_c1 | 3300050493 | Bacteria | 511 |
| 346 | nmdc:mga06z11_277537_c2 | 3300050494 | Bacteria | 691 |
| 347 | nmdc:mga06z11_452929_c1 | 3300050494 | Bacteria | 775 |
| 348 | nmdc:mga06z11_663371_c1 | 3300050494 | Bacteria | 635 |
| 349 | nmdc:mga06z11_864994_c1 | 3300050494 | Bacteria | 551 |
| 350 | nmdc:mga07m45_123339_c1 | 3300050496 | Bacteria | 1497 |
| 351 | nmdc:mga07m45_253660_c1 | 3300050496 | Bacteria | 1023 |
| 352 | nmdc:mga07m45_335114_c1 | 3300050496 | Bacteria | 879 |
| 353 | nmdc:mga0sz30_235976_c1 | 3300050516 | Bacteria | 814 |
| 354 | nmdc:mga0sz30_31850_c1 | 3300050516 | Bacteria | 2184 |
| 355 | Ga0500635_0028832 | 3300053080 | Bacteria | 1777 |
| 356 | Ga0500578_0077233 | 3300053086 | Bacteria | 2120 |
| 357 | Ga0500578_0126089 | 3300053086 | Bacteria | 1608 |
| 358 | Ga0500643_012149 | 3300053087 | Bacteria | 3097 |
| 359 | Ga0500644_0038249 | 3300053088 | Bacteria | 1573 |
| 360 | Ga0500581_141858 | 3300053089 | Bacteria | 1137 |
| 361 | Ga0500646_0101751 | 3300053090 | Bacteria | 903 |
| 362 | Ga0500583_0384255 | 3300053092 | Bacteria | 676 |
| 363 | Ga0500651_0028799 | 3300053093 | Bacteria | 3491 |
| 364 | Ga0500651_0411874 | 3300053093 | Bacteria | 758 |
| 365 | Ga0500566_0000990 | 3300053094 | Bacteria | 16360 |
| 366 | Ga0500641_0150850 | 3300053096 | Bacteria | 1003 |
| 367 | Ga0500648_062965 | 3300053097 | Bacteria | 2102 |
| 368 | Ga0500650_0001012 | 3300053098 | Bacteria | 7987 |
| 369 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 370 | Ga0500558_205550 | 3300053106 | Bacteria | 682 |
| 371 | Ga0500562_086308 | 3300053108 | Bacteria | 850 |
| 372 | Ga0500569_043784 | 3300053109 | Bacteria | 1323 |
| 373 | Ga0500592_031992 | 3300053116 | Bacteria | 849 |
| 374 | Ga0500594_0127038 | 3300053118 | Bacteria | 805 |
| 375 | Ga0500595_107825 | 3300053119 | Bacteria | 794 |
| 376 | Ga0500607_033478 | 3300053121 | Bacteria | 2816 |
| 377 | Ga0500608_001204 | 3300053122 | Bacteria | 9253 |
| 378 | Ga0500621_222912 | 3300053126 | Bacteria | 652 |
| 379 | Ga0500642_0000093 | 3300053130 | Bacteria | 44347 |
| 380 | Ga0500642_0014309 | 3300053130 | Bacteria | 2947 |
| 381 | Ga0500652_006685 | 3300053131 | Bacteria | 3729 |
| 382 | Ga0500655_099205 | 3300053133 | Bacteria | 609 |
| 383 | Ga0500658_0077605 | 3300053134 | Bacteria | 1414 |
| 384 | Ga0500559_0000512 | 3300053136 | Bacteria | 27276 |
| 385 | Ga0500559_0287988 | 3300053136 | Bacteria | 772 |
| 386 | Ga0500568_0000835 | 3300053139 | Bacteria | 21662 |
| 387 | Ga0500577_0129607 | 3300053142 | Bacteria | 1056 |
| 388 | Ga0500586_002762 | 3300053145 | Bacteria | 4033 |
| 389 | Ga0500590_208486 | 3300053148 | Bacteria | 819 |
| 390 | Ga0500604_0002705 | 3300053151 | Bacteria | 4821 |
| 391 | Ga0500616_0000069 | 3300053153 | Bacteria | 234334 |
| 392 | Ga0500619_192987 | 3300053154 | Bacteria | 685 |
| 393 | Ga0500622_0020172 | 3300053156 | Bacteria | 3539 |
| 394 | Ga0500633_0051468 | 3300053160 | Bacteria | 1422 |
| 395 | Ga0500633_0292055 | 3300053160 | Bacteria | 601 |
| 396 | Ga0500634_0335094 | 3300053161 | Bacteria | 584 |
| 397 | Ga0500638_052841 | 3300053162 | Bacteria | 1962 |
| 398 | Ga0500636_0074071 | 3300053177 | Bacteria | 1971 |
| 399 | Ga0500636_0080807 | 3300053177 | Bacteria | 1872 |
| 400 | Ga0500636_0147954 | 3300053177 | Bacteria | 1292 |
| 401 | Ga0500636_0259053 | 3300053177 | Bacteria | 881 |
| 402 | Ga0500637_0041196 | 3300053178 | Bacteria | 2611 |
| 403 | Ga0500645_110601 | 3300053730 | Bacteria | 771 |
| 404 | Ga0500609_041537 | 3300053731 | Bacteria | 636 |
| 405 | Ga0500552_052726 | 3300053733 | Bacteria | 693 |
| 406 | Ga0500596_002248 | 3300053735 | Bacteria | 3832 |
| 407 | 2513648001 | 2513237095 | Bacteria | 8976980 |
| 408 | 2513674011 | 2513237098 | Bacteria | 9902361 |
| 409 | 2513702881 | 2513237102 | Bacteria | 7703324 |
| 410 | 2513715670 | 2513237104 | Bacteria | 10034502 |
| 411 | 2513873951 | 2513237139 | Bacteria | 8737671 |
| 412 | 2514012925 | 2513237161 | Bacteria | 8871253 |
| 413 | 2517102427 | 2517093001 | Bacteria | 9002274 |
| 414 | 2524435705 | 2524023205 | Bacteria | 8918781 |
| 415 | 2524470001 | 2524023210 | Bacteria | 9029266 |
| 416 | 2528850361 | 2528768022 | Bacteria | 10457665 |
| 417 | 2603858924 | 2602042107 | Bacteria | 6226103 |
| 418 | 2617351663 | 2617270735 | Bacteria | 9163226 |
| 419 | 2617374169 | 2617270741 | Bacteria | 8201522 |
| 420 | 2723842068 | 2721755755 | Bacteria | 8322773 |
| 421 | 2745079001 | 2744054633 | Bacteria | 8678936 |
| 422 | 2793063138 | 2791355196 | Bacteria | 7323613 |
| 423 | 2805919462 | 2802429603 | Bacteria | 8777136 |
| 424 | 2818237240 | 2816332527 | Bacteria | 8933356 |
| 425 | 2824602537 | 2824600985 | Bacteria | 8488197 |
| 426 | 2824612683 | 2824609381 | Bacteria | 8672835 |
| 427 | 2824624791 | 2824617872 | Bacteria | 8814715 |
| 428 | 2824633663 | 2824626560 | Bacteria | 8813858 |
| 429 | 2824641533 | 2824635225 | Bacteria | 8785348 |
| 430 | 2824651928 | 2824644064 | Bacteria | 8743947 |
| 431 | 2824654497 | 2824653114 | Bacteria | 8493680 |
| 432 | 2824663625 | 2824661429 | Bacteria | 9877870 |
| 433 | 2824674893 | 2824671348 | Bacteria | 8369588 |
| 434 | 2824686670 | 2824679649 | Bacteria | 8248951 |
| 435 | 2824695387 | 2824687955 | Bacteria | 8360029 |
| 436 | 2824700450 | 2824696289 | Bacteria | 8335049 |
| 437 | 2824709441 | 2824704595 | Bacteria | 9667483 |
| 438 | 2824722161 | 2824714736 | Bacteria | 8717648 |
| 439 | 2824731946 | 2824723954 | Bacteria | 8758240 |
| 440 | 2824734829 | 2824732956 | Bacteria | 7810675 |
| 441 | 2824748165 | 2824746037 | Bacteria | 7911610 |
| 442 | 2824758454 | 2824753945 | Bacteria | 9787441 |
| 443 | 2824768844 | 2824763712 | Bacteria | 9792355 |
| 444 | 2824774981 | 2824773399 | Bacteria | 8360218 |
| 445 | 2828309487 | 2828305725 | Bacteria | 4916900 |
| 446 | 2838129519 | 2838122688 | Bacteria | 8803140 |
| 447 | 2841951561 | 2841949485 | Bacteria | 8680857 |
| 448 | 2841964652 | 2841957949 | Bacteria | 8652217 |
| 449 | 2841969197 | 2841966195 | Bacteria | 8673214 |
| 450 | 2841991056 | 2841983080 | Bacteria | 8395090 |
| 451 | 2842043921 | 2842038055 | Bacteria | 8002051 |
| 452 | 2842052089 | 2842045827 | Bacteria | 8006841 |
| 453 | 2847939755 | 2847930680 | Bacteria | 9342022 |
| 454 | 2847941715 | 2847939898 | Bacteria | 8606328 |
| 455 | 2857511530 | 2857509624 | Bacteria | 7472071 |
| 456 | 2857527970 | 2857524615 | Bacteria | 6615449 |
| 457 | 2874617958 | 2874612657 | Bacteria | 8252029 |
| 458 | 2874624383 | 2874620515 | Bacteria | 8290088 |
| 459 | 2876765003 | 2876761206 | Bacteria | 10111113 |
| 460 | 2879089985 | 2879083081 | Bacteria | 8587928 |
| 461 | 2879101285 | 2879099564 | Bacteria | 10442239 |
| 462 | 2881672906 | 2881665667 | Bacteria | 8175609 |
| 463 | 2885371434 | 2885366525 | Bacteria | 8326213 |
| 464 | 2885387705 | 2885383462 | Bacteria | 9473874 |
| 465 | 2888380006 | 2888378607 | Bacteria | 9652610 |
| 466 | 2888420810 | 2888419890 | Bacteria | 7857137 |
| 467 | 2893068386 | 2893066018 | Bacteria | 6158120 |
| 468 | 2903771376 | 2903768456 | Bacteria | 9749579 |
| 469 | 2904672278 | 2904666416 | Bacteria | 8226587 |
| 470 | 2904716007 | 2904711408 | Bacteria | 9771557 |
| 471 | 2906634423 | 2906626472 | Bacteria | 8826946 |
| 472 | 2906651697 | 2906643746 | Bacteria | 8722424 |
| 473 | 2908776644 | 2908775508 | Bacteria | 8092255 |
| 474 | 2919075370 | 2919073203 | Bacteria | 6531949 |
| 475 | 2922378389 | |||
| 476 | 2922400327 | 2922393267 | Bacteria | 8285685 |
| 477 | 2929622512 | 2929615660 | Bacteria | 9193770 |
| 478 | 2929631270 | 2929624759 | Bacteria | 9339455 |
| 479 | 2932786308 | 2932784394 | Bacteria | 9704911 |
| 480 | 2932812617 | 2932809354 | Bacteria | 9135765 |
| 481 | 2932822979 | 2932818245 | Bacteria | 9955613 |
| 482 | 2932829546 | 2932828146 | Bacteria | 9745859 |
| 483 | 2933584409 | 2933577622 | Bacteria | 9116884 |
| 484 | 2935618064 | 2935616580 | Bacteria | 9032984 |
| 485 | 2935641538 | 2935638405 | Bacteria | 10015038 |
| 486 | 2935669404 | 2935665750 | Bacteria | 9571747 |
| 487 | 2935677998 | 2935675223 | Bacteria | 9928132 |
| 488 | 2935693681 | 2935684952 | Bacteria | 9590419 |
| 489 | 2935701763 | 2935694250 | Bacteria | 9291695 |
| 490 | 2935707228 | 2935703347 | Bacteria | 10242284 |
| 491 | 2935717070 | 2935713505 | Bacteria | 9608509 |
| 492 | 2935730096 | 2935722832 | Bacteria | 9608746 |
| 493 | 2935738484 | 2935732158 | Bacteria | 9706831 |
| 494 | 2935750272 | 2935741537 | Bacteria | 9707219 |
| 495 | 2935759866 | 2935750917 | Bacteria | 9590372 |
| 496 | 2935764482 | 2935760218 | Bacteria | 9817913 |
| 497 | 2935804392 | 2935801545 | Bacteria | 9301974 |
| 498 | 2935817253 | 2935810662 | Bacteria | 9401221 |
| 499 | 2935831269 | 2935827899 | Bacteria | 10038562 |
| 500 | 2935841878 | 2935837841 | Bacteria | 9454360 |
| 501 | 2935856437 | 2935855204 | Bacteria | 9035059 |
| 502 | 2935871040 | 2935864058 | Bacteria | 9784707 |
| 503 | 2935874537 | 2935873716 | Bacteria | 9632195 |
| 504 | 2935993998 | 2935992306 | Bacteria | 9802711 |
| 505 | 2936004991 | 2936002035 | Bacteria | 9362176 |
| 506 | 2936044049 | 2936037263 | Bacteria | 9446081 |
| 507 | 2940565680 | 2940556831 | Bacteria | 9590747 |
| 508 | 2941543951 | 2941538514 | Bacteria | 9402094 |
| 509 | 3005594179 | 3005587118 | Bacteria | 7794411 |
| 510 | 3005597804 | 3005594810 | Bacteria | 8716512 |
| 511 | 8016518682 | 8016511872 | Bacteria | 9921665 |
| 512 | 8016586863 | 8016583857 | Bacteria | 10421953 |
| 513 | 8017057991 | 8017057580 | Bacteria | 10023680 |
| 514 | 8019577729 | 8019576017 | Bacteria | 10049540 |
| 515 | 8019605930 | 8019597564 | Bacteria | 10041141 |
| 516 | 8019612603 | 8019608314 | Bacteria | 10042931 |
| 517 | 8055750963 | 8055742211 | Bacteria | 9226248 |
| 518 | 8056677773 | 8056673599 | Bacteria | 7871253 |
| 519 | 8056683119 | 8056681323 | Bacteria | 8472857 |
| 520 | Ga0496122_0075275 | |||
| 521 | LJNas_1030696 | |||
| 522 | JGI25153J46596_10001692 | |||
| 523 | JGI25153J46596_10011110 | |||
| 524 | JGI25153J46596_10026722 | |||
| 525 | JGI25160J50197_1001280 | |||
| 526 | Ga0055526_1029663 | |||
| 527 | Ga0055531_10005988 | |||
| 528 | Ga0065165_1016260 | |||
| 529 | Ga0065165_1095705 | |||
| 530 | Ga0068868_100255534 | |||
| 531 | Ga0070660_101392752 | |||
| 532 | Ga0070668_101016616 | |||
| 533 | Ga0070673_102227978 | |||
| 534 | Ga0070659_100853790 | |||
| 535 | Ga0070667_100773347 | |||
| 536 | Ga0070714_100597601 | |||
| 537 | Ga0070714_101146532 | |||
| 538 | Ga0070713_100010044 | |||
| 539 | Ga0070710_11188953 | |||
| 540 | Ga0070711_100757420 | |||
| 541 | Ga0070663_100477569 | |||
| 542 | Ga0070678_100748835 | |||
| 543 | Ga0070662_100115123 | |||
| 544 | Ga0070685_11439477 | |||
| 545 | Ga0070684_100589830 | |||
| 546 | Ga0068853_100089449 | |||
| 547 | Ga0070665_100048058 | |||
| 548 | Ga0070665_100480978 | |||
| 549 | Ga0070665_101447709 | |||
| 550 | Ga0068855_100012149 | |||
| 551 | Ga0068855_100481657 | |||
| 552 | Ga0068854_100511522 | |||
| 553 | Ga0068856_100627377 | |||
| 554 | Ga0068852_100699554 | |||
| 555 | Ga0068864_101343605 | |||
| 556 | Ga0068851_10343482 | |||
| 557 | Ga0068851_10413349 | |||
| 558 | Ga0068858_100806652 | |||
| 559 | Ga0068860_100002058 | |||
| 560 | Ga0081455_10019582 | |||
| 561 | Ga0081455_10092640 | |||
| 562 | Ga0070717_10090247 | |||
| 563 | Ga0070717_11143528 | |||
| 564 | Ga0075365_10055985 | |||
| 565 | Ga0075364_10804476 | |||
| 566 | Ga0070716_100308549 | |||
| 567 | Ga0070712_100459808 | |||
| 568 | Ga0070712_101164831 | |||
| 569 | Ga0070712_101343882 | |||
| 570 | Ga0075362_10181495 | |||
| 571 | Ga0075367_10219437 | |||
| 572 | Ga0075367_10241969 | |||
| 573 | Ga0075367_10339947 | |||
| 574 | Ga0075369_10007794 | |||
| 575 | Ga0075369_10043640 | |||
| 576 | Ga0075369_10164979 | |||
| 577 | Ga0075366_10929898 | |||
| 578 | Ga0097621_101017096 | |||
| 579 | Ga0075370_10296526 | |||
| 580 | Ga0075370_10640889 | |||
| 581 | Ga0068871_101799406 | |||
| 582 | Ga0099825_1028838 | |||
| 583 | Ga0099824_1004372 | |||
| 584 | Ga0099823_1025568 | |||
| 585 | Ga0099795_10022883 | |||
| 586 | Ga0099795_10093190 | |||
| 587 | Ga0105250_10215780 | |||
| 588 | Ga0105240_10007827 | |||
| 589 | Ga0105240_11028514 | |||
| 590 | Ga0105245_11517001 | |||
| 591 | Ga0105247_10147544 | |||
| 592 | Ga0105243_10250773 | |||
| 593 | Ga0105241_10071726 | |||
| 594 | Ga0105241_10652125 | |||
| 595 | Ga0105248_10669826 | |||
| 596 | Ga0105237_10019431 | |||
| 597 | Ga0105237_10132914 | |||
| 598 | Ga0105238_10007870 | |||
| 599 | Ga0105238_10908028 | |||
| 600 | Ga0099796_10114791 | |||
| 601 | Ga0099796_10225365 | |||
| 602 | Ga0105239_10016692 | |||
| 603 | Ga0105239_10079186 | |||
| 604 | Ga0105239_10092022 | |||
| 605 | Ga0105239_10151651 | |||
| 606 | Ga0105246_10354582 | |||
| 607 | Ga0157374_10202276 | |||
| 608 | Ga0157374_10653640 | |||
| 609 | Ga0163162_10278070 | |||
| 610 | Ga0163162_10504831 | |||
| 611 | Ga0157372_12085171 | |||
| 612 | Ga0157375_10128833 | |||
| 613 | Ga0163163_10155692 | |||
| 614 | Ga0182008_10682220 | |||
| 615 | Ga0157376_11218059 | |||
| 616 | Ga0157376_11906787 | |||
| 617 | Ga0163161_10959385 | |||
| 618 | Ga0214544_1000003 | |||
| 619 | Ga0214542_1000003 | |||
| 620 | Ga0214545_1000004 | |||
| 621 | Ga0214545_1037165 | |||
| 622 | Ga0214543_1000007 | |||
| 623 | Ga0213876_10002313 | |||
| 624 | Ga0209233_1062543 | |||
| 625 | Ga0209673_1029096 | |||
| 626 | Ga0209025_1124256 | |||
| 627 | Ga0209564_1013475 | |||
| 628 | Ga0209758_1000015 | |||
| 629 | Ga0209758_1001252 | |||
| 630 | Ga0209758_1001829 | |||
| 631 | Ga0209758_1005164 | |||
| 632 | Ga0209758_1033529 | |||
| 633 | Ga0209256_1006017 | |||
| 634 | Ga0207426_1000585 | |||
| 635 | Ga0207426_1006102 | |||
| 636 | Ga0209257_1001348 | |||
| 637 | Ga0209257_1031969 | |||
| 638 | Ga0207710_10131336 | |||
| 639 | Ga0207647_10549741 | |||
| 640 | Ga0207654_10041745 | |||
| 641 | Ga0207695_10000548 | |||
| 642 | Ga0207695_10161116 | |||
| 643 | Ga0207671_10006410 | |||
| 644 | Ga0207671_10009328 | |||
| 645 | Ga0207671_10243876 | |||
| 646 | Ga0207671_11212082 | |||
| 647 | Ga0207693_10184496 | |||
| 648 | Ga0207657_10640765 | |||
| 649 | Ga0207694_10010496 | |||
| 650 | Ga0207650_11394595 | |||
| 651 | Ga0207687_11479088 | |||
| 652 | Ga0207700_10007140 | |||
| 653 | Ga0207690_10586698 | |||
| 654 | Ga0207706_10416526 | |||
| 655 | Ga0207665_10319165 | |||
| 656 | Ga0207711_10962285 | |||
| 657 | Ga0207667_10057124 | |||
| 658 | Ga0207667_10549600 | |||
| 659 | Ga0207668_10040472 | |||
| 660 | Ga0207668_10558188 | |||
| 661 | Ga0207640_10496564 | |||
| 662 | Ga0207640_10527131 | |||
| 663 | Ga0207658_10541359 | |||
| 664 | Ga0207677_10376278 | |||
| 665 | Ga0207703_10730652 | |||
| 666 | Ga0207703_10887070 | |||
| 667 | Ga0207703_11525691 | |||
| 668 | Ga0207639_10270453 | |||
| 669 | Ga0207639_10520855 | |||
| 670 | Ga0207678_10021859 | |||
| 671 | Ga0207641_11148933 | |||
| 672 | Ga0207648_10146186 | |||
| 673 | Ga0207676_11926309 | |||
| 674 | Ga0207675_101425447 | |||
| 675 | Ga0207683_10718681 | |||
| 676 | Ga0207698_10039537 | |||
| 677 | Ga0209389_1000015 | |||
| 678 | Ga0209389_1000029 | |||
| 679 | Ga0209589_1000012 | |||
| 680 | Ga0209589_1000013 | |||
| 681 | Ga0209489_100013 | |||
| 682 | Ga0209489_100072 | |||
| 683 | Ga0209700_100034 | |||
| 684 | Ga0209179_1036438 | |||
| 685 | Ga0209588_1023187 | |||
| 686 | Ga0268266_10081037 | |||
| 687 | Ga0268266_11254151 | |||
| 688 | Ga0268264_10000049 | |||
| 689 | Ga0265330_10061488 | |||
| 690 | Ga0265332_10010078 | |||
| 691 | Ga0265328_10019935 | |||
| 692 | Ga0265325_10032926 | |||
| 693 | Ga0265329_10211603 | |||
| 694 | Ga0265340_10208915 | |||
| 695 | Ga0265339_10045684 | |||
| 696 | Ga0265331_10049017 | |||
| 697 | Ga0265316_10249261 | |||
| 698 | Ga0307509_10022323 | |||
| 699 | Ga0307509_10449967 | |||
| 700 | Ga0307508_10000046 | |||
| 701 | Ga0307508_10176880 | |||
| 702 | Ga0307508_10443372 | |||
| 703 | Ga0265314_10166526 | |||
| 704 | Ga0265314_10594883 | |||
| 705 | Ga0265342_10216067 | |||
| 706 | Ga0307516_10542842 | |||
| 707 | Ga0307412_10021329 | |||
| 708 | Ga0307507_10010582 | |||
| 709 | Ga0316212_1048739 | |||
| 710 | Ga0373935_0480597 | |||
| 711 | Ga0373927_0082091 | |||
| 712 | Ga0395905_0002607 | |||
| 713 | Ga0395905_0919694 | |||
| 714 | Ga0395901_0380831 | |||
| 715 | Ga0395901_0833300 | |||
| 716 | Ga0436365_0989879 | |||
| 717 | Ga0439446_0278489 | |||
| 718 | Ga0466969_0008112 | |||
| 719 | Ga0466972_0004158 | |||
| 720 | Ga0466972_0075631 | |||
| 721 | Ga0466972_0262536 | |||
| 722 | Ga0466965_0076432 | |||
| 723 | Ga0466965_0083061 | |||
| 724 | Ga0466965_0184644 | |||
| 725 | Ga0466966_0000238 | |||
| 726 | Ga0466961_0000044 | |||
| 727 | Ga0466964_0176080 | |||
| 728 | Ga0466964_0317715 | |||
| 729 | Ga0466968_0020935 | |||
| 730 | Ga0466970_0440606 | |||
| 731 | Ga0466960_0004740 | |||
| 732 | Ga0466960_0086072 | |||
| 733 | Ga0466960_0841481 | |||
| 734 | Ga0466959_0000963 | |||
| 735 | Ga0495629_0546964 | |||
| 736 | Ga0495638_0046390 | |||
| 737 | Ga0495651_0122593 | |||
| 738 | Ga0495639_0541176 | |||
| 739 | Ga0495664_0158930 | |||
| 740 | Ga0495585_0438682 | |||
| 741 | Ga0495594_0730347 | |||
| 742 | Ga0495596_0180228 | |||
| 743 | Ga0495607_0171007 | |||
| 744 | Ga0495607_0243049 | |||
| 745 | Ga0495583_0089330 | |||
| 746 | Ga0495606_0046405 | |||
| 747 | Ga0495606_0113838 | |||
| 748 | Ga0495610_0368979 | |||
| 749 | Ga0495616_0042119 | |||
| 750 | Ga0495620_0020355 | |||
| 751 | Ga0495632_0053579 | |||
| 752 | Ga0495643_0062009 | |||
| 753 | Ga0495643_0129445 | |||
| 754 | Ga0495648_0001433 | |||
| 755 | Ga0495648_0082093 | |||
| 756 | Ga0495648_0157191 | |||
| 757 | Ga0495652_0055076 | |||
| 758 | Ga0495654_0009803 | |||
| 759 | Ga0495622_0117176 | |||
| 760 | Ga0495668_0092366 | |||
| 761 | Ga0495668_0161919 | |||
| 762 | Ga0495668_0187758 | |||
| 763 | Ga0495611_0027324 | |||
| 764 | Ga0495611_0162027 | |||
| 765 | Ga0495625_0014301 | |||
| 766 | Ga0495625_0846440 | |||
| 767 | Ga0495661_0297885 | |||
| 768 | Ga0495588_0021077 | |||
| 769 | Ga0495588_0209136 | |||
| 770 | Ga0495599_0633468 | |||
| 771 | Ga0495624_0118741 | |||
| 772 | Ga0495670_0010379 | |||
| 773 | Ga0495671_0164005 | |||
| 774 | Ga0495649_0044277 | |||
| 775 | Ga0495589_0178241 | |||
| 776 | Ga0495589_0305604 | |||
| 777 | Ga0495604_0411784 | |||
| 778 | Ga0495672_0399120 | |||
| 779 | Ga0495672_0556898 | |||
| 780 | Ga0495677_0060051 | |||
| 781 | Ga0495673_0168243 | |||
| 782 | Ga0495681_0118997 | |||
| 783 | Ga0495686_0130058 | |||
| 784 | Ga0495686_0251196 | |||
| 785 | Ga0495614_0192017 | |||
| 786 | Ga0495626_0151617 | |||
| 787 | Ga0496100_0199540 | |||
| 788 | Ga0496100_0571970 | |||
| 789 | Ga0496101_0521291 | |||
| 790 | Ga0496102_0253775 | |||
| 791 | Ga0496102_1625759 | |||
| 792 | Ga0496103_0538701 | |||
| 793 | Ga0496104_0469990 | |||
| 794 | Ga0496105_0458340 | |||
| 795 | Ga0496106_0001452 | |||
| 796 | Ga0496106_0190724 | |||
| 797 | Ga0496107_0924167 | |||
| 798 | Ga0496108_0173658 | |||
| 799 | Ga0496108_0473137 | |||
| 800 | Ga0496109_0541762 | |||
| 801 | Ga0496110_0048909 | |||
| 802 | Ga0496111_0298750 | |||
| 803 | Ga0496112_0248293 | |||
| 804 | Ga0496113_0287642 | |||
| 805 | Ga0496113_0686848 | |||
| 806 | Ga0496114_0113764 | |||
| 807 | Ga0496114_0830960 | |||
| 808 | Ga0496115_0117181 | |||
| 809 | Ga0496116_0006682 | |||
| 810 | Ga0496116_0044872 | |||
| 811 | Ga0496116_0149352 | |||
| 812 | Ga0496117_0035646 | |||
| 813 | Ga0496117_0096481 | |||
| 814 | Ga0496117_0109611 | |||
| 815 | Ga0496117_0121561 | |||
| 816 | Ga0496117_0600970 | |||
| 817 | Ga0496118_0009493 | |||
| 818 | Ga0496118_0072113 | |||
| 819 | Ga0496118_0072195 | |||
| 820 | Ga0496118_0078253 | |||
| 821 | Ga0496118_0178736 | |||
| 822 | Ga0496118_0295041 | |||
| 823 | Ga0496119_0096735 | |||
| 824 | Ga0496119_0108773 | |||
| 825 | Ga0496119_0118559 | |||
| 826 | Ga0496120_0484259 | |||
| 827 | Ga0496121_0000261 | |||
| 828 | Ga0496121_0028610 | |||
| 829 | Ga0496121_0047604 | |||
| 830 | Ga0496121_0061363 | |||
| 831 | Ga0496121_0209964 | |||
| 832 | Ga0496121_0482125 | |||
| 833 | Ga0496122_0050542 | |||
| 834 | Ga0496122_0209247 | |||
| 835 | Ga0496123_0055443 | |||
| 836 | Ga0496123_0131684 | |||
| 837 | Ga0496123_0271951 | |||
| 838 | Ga0496123_0383686 | |||
| 839 | Ga0496124_0002998 | |||
| 840 | Ga0496124_0211266 | |||
| 841 | Ga0496124_0306189 | |||
| 842 | Ga0496125_0000210 | |||
| 843 | Ga0496125_0059133 | |||
| 844 | Ga0496125_0065440 | |||
| 845 | Ga0496125_0067620 | |||
| 846 | Ga0496125_0123562 | |||
| 847 | Ga0496125_0244787 | |||
| 848 | Ga0496125_0573660 | |||
| 849 | Ga0496126_0008831 | |||
| 850 | Ga0496126_0139264 | |||
| 851 | Ga0496126_0143953 | |||
| 852 | Ga0496126_0146174 | |||
| 853 | Ga0496126_0176256 | |||
| 854 | Ga0496126_0322426 | |||
| 855 | Ga0496126_0659818 | |||
| 856 | Ga0496126_1248316 | |||
| 857 | nmdc:mga03683_221736_c1 | |||
| 858 | nmdc:mga03683_553775_c1 | |||
| 859 | nmdc:mga03n38_852652_c1 | |||
| 860 | nmdc:mga0yw44_219630_c1 | |||
| 861 | nmdc:mga0yw44_3707_c1 | |||
| 862 | nmdc:mga0yw44_75963_c1 | |||
| 863 | nmdc:mga0k408_366744_c1 | |||
| 864 | nmdc:mga0k408_906164_c1 | |||
| 865 | nmdc:mga06z11_277537_c2 | |||
| 866 | nmdc:mga06z11_452929_c1 | |||
| 867 | nmdc:mga06z11_663371_c1 | |||
| 868 | nmdc:mga06z11_864994_c1 | |||
| 869 | nmdc:mga07m45_123339_c1 | |||
| 870 | nmdc:mga07m45_253660_c1 | |||
| 871 | nmdc:mga07m45_335114_c1 | |||
| 872 | nmdc:mga0sz30_235976_c1 | |||
| 873 | nmdc:mga0sz30_31850_c1 | |||
| 874 | Ga0500635_0028832 | |||
| 875 | Ga0500578_0077233 | |||
| 876 | Ga0500578_0126089 | |||
| 877 | Ga0500643_012149 | |||
| 878 | Ga0500644_0038249 | |||
| 879 | Ga0500581_141858 | |||
| 880 | Ga0500646_0101751 | |||
| 881 | Ga0500583_0384255 | |||
| 882 | Ga0500651_0028799 | |||
| 883 | Ga0500651_0411874 | |||
| 884 | Ga0500566_0000990 | |||
| 885 | Ga0500641_0150850 | |||
| 886 | Ga0500648_062965 | |||
| 887 | Ga0500650_0001012 | |||
| 888 | Ga0500556_0000002 | |||
| 889 | Ga0500558_205550 | |||
| 890 | Ga0500562_086308 | |||
| 891 | Ga0500569_043784 | |||
| 892 | Ga0500592_031992 | |||
| 893 | Ga0500594_0127038 | |||
| 894 | Ga0500595_107825 | |||
| 895 | Ga0500607_033478 | |||
| 896 | Ga0500608_001204 | |||
| 897 | Ga0500621_222912 | |||
| 898 | Ga0500642_0000093 | |||
| 899 | Ga0500642_0014309 | |||
| 900 | Ga0500652_006685 | |||
| 901 | Ga0500655_099205 | |||
| 902 | Ga0500658_0077605 | |||
| 903 | Ga0500559_0000512 | |||
| 904 | Ga0500559_0287988 | |||
| 905 | Ga0500568_0000835 | |||
| 906 | Ga0500577_0129607 | |||
| 907 | Ga0500586_002762 | |||
| 908 | Ga0500590_208486 | |||
| 909 | Ga0500604_0002705 | |||
| 910 | Ga0500616_0000069 | |||
| 911 | Ga0500619_192987 | |||
| 912 | Ga0500622_0020172 | |||
| 913 | Ga0500633_0051468 | |||
| 914 | Ga0500633_0292055 | |||
| 915 | Ga0500634_0335094 | |||
| 916 | Ga0500638_052841 | |||
| 917 | Ga0500636_0074071 | |||
| 918 | Ga0500636_0080807 | |||
| 919 | Ga0500636_0147954 | |||
| 920 | Ga0500636_0259053 | |||
| 921 | Ga0500637_0041196 | |||
| 922 | Ga0500645_110601 | |||
| 923 | Ga0500609_041537 | |||
| 924 | Ga0500552_052726 | |||
| 925 | Ga0500596_002248 | |||
| 926 | 2513648001 | |||
| 927 | 2513674011 | |||
| 928 | 2513702881 | |||
| 929 | 2513715670 | |||
| 930 | 2513873951 | |||
| 931 | 2514012925 | |||
| 932 | 2517102427 | |||
| 933 | 2524435705 | |||
| 934 | 2524470001 | |||
| 935 | 2528850361 | |||
| 936 | 2603858924 | |||
| 937 | 2617351663 | |||
| 938 | 2617374169 | |||
| 939 | 2723842068 | |||
| 940 | 2745079001 | |||
| 941 | 2793063138 | |||
| 942 | 2805919462 | |||
| 943 | 2818237240 | |||
| 944 | 2824602537 | |||
| 945 | 2824612683 | |||
| 946 | 2824624791 | |||
| 947 | 2824633663 | |||
| 948 | 2824641533 | |||
| 949 | 2824651928 | |||
| 950 | 2824654497 | |||
| 951 | 2824663625 | |||
| 952 | 2824674893 | |||
| 953 | 2824686670 | |||
| 954 | 2824695387 | |||
| 955 | 2824700450 | |||
| 956 | 2824709441 | |||
| 957 | 2824722161 | |||
| 958 | 2824731946 | |||
| 959 | 2824734829 | |||
| 960 | 2824748165 | |||
| 961 | 2824758454 | |||
| 962 | 2824768844 | |||
| 963 | 2824774981 | |||
| 964 | 2828309487 | |||
| 965 | 2838129519 | |||
| 966 | 2841951561 | |||
| 967 | 2841964652 | |||
| 968 | 2841969197 | |||
| 969 | 2841991056 | |||
| 970 | 2842043921 | |||
| 971 | 2842052089 | |||
| 972 | 2847939755 | |||
| 973 | 2847941715 | |||
| 974 | 2857511530 | |||
| 975 | 2857527970 | |||
| 976 | 2874617958 | |||
| 977 | 2874624383 | |||
| 978 | 2876765003 | |||
| 979 | 2879089985 | |||
| 980 | 2879101285 | |||
| 981 | 2881672906 | |||
| 982 | 2885371434 | |||
| 983 | 2885387705 | |||
| 984 | 2888380006 | |||
| 985 | 2888420810 | |||
| 986 | 2893068386 | |||
| 987 | 2903771376 | |||
| 988 | 2904672278 | |||
| 989 | 2904716007 | |||
| 990 | 2906634423 | |||
| 991 | 2906651697 | |||
| 992 | 2908776644 | |||
| 993 | 2919075370 | |||
| 994 | 2922378389 | |||
| 995 | 2922400327 | |||
| 996 | 2929622512 | |||
| 997 | 2929631270 | |||
| 998 | 2932786308 | |||
| 999 | 2932812617 | |||
| 1000 | 2932822979 | |||
| 1001 | 2932829546 | |||
| 1002 | 2933584409 | |||
| 1003 | 2935618064 | |||
| 1004 | 2935641538 | |||
| 1005 | 2935669404 | |||
| 1006 | 2935677998 | |||
| 1007 | 2935693681 | |||
| 1008 | 2935701763 | |||
| 1009 | 2935707228 | |||
| 1010 | 2935717070 | |||
| 1011 | 2935730096 | |||
| 1012 | 2935738484 | |||
| 1013 | 2935750272 | |||
| 1014 | 2935759866 | |||
| 1015 | 2935764482 | |||
| 1016 | 2935804392 | |||
| 1017 | 2935817253 | |||
| 1018 | 2935831269 | |||
| 1019 | 2935841878 | |||
| 1020 | 2935856437 | |||
| 1021 | 2935871040 | |||
| 1022 | 2935874537 | |||
| 1023 | 2935993998 | |||
| 1024 | 2936004991 | |||
| 1025 | 2936044049 | |||
| 1026 | 2940565680 | |||
| 1027 | 2941543951 | |||
| 1028 | 3005594179 | |||
| 1029 | 3005597804 | |||
| 1030 | 8016518682 | |||
| 1031 | 8016586863 | |||
| 1032 | 8017057991 | |||
| 1033 | 8019577729 | |||
| 1034 | 8019605930 | |||
| 1035 | 8019612603 | |||
| 1036 | 8055750963 | |||
| 1037 | 8056677773 | |||
| 1038 | 8056683119 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6nbl-assembly2.cif.gz_D | cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide | 0.9603 | 1 | 105 |
| 1xlq-assembly4.cif.gz_A | crystal structure of reduced c73s putidaredoxin from pseudomonas putida | 0.9584 | 3 | 105 |
| 1uwm-assembly1.cif.gz_A | reduced ferredoxin 6 from rhodobacter capsulatus | 0.9541 | 3 | 104 |
| 1r7s-assembly3.cif.gz_C | putidaredoxin (fe2s2 ferredoxin), c73g mutant | 0.9537 | 3 | 105 |
| 3hui-assembly1.cif.gz_A | crystal structure of the mutant a105r of [2fe-2s] ferredoxin in the class i cyp199a2 system from rhodopseudomonas palustris | 0.9524 | 1 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1uwmA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.954 | 3 | 104 | 3.10.20.30 |
| 3lxfB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9505 | 3 | 105 | 3.10.20.30 |
| af_Q9CPW2_55_168_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9484 | 2 | 105 | 3.10.20.30 |
| 4ltuB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9474 | 2 | 105 | 3.10.20.30 |
| af_Q9LSY0_1_123_3.30.710.10 | Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A | 0.9415 | 3 | 16 | 3.30.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2QRN5-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9722 | 1 | 105 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A0S2EPL8-F1-model_v4 | 2Fe-2S ferredoxin-type domain-containing protein | 0.971 | 1 | 105 |
GO:0005829
GO:0009055 GO:0051537 GO:0140647 |
| AF-A0A3M1UKT3-F1-model_v4 | 2Fe-2S ferredoxin | 0.9708 | 1 | 103 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A494TJ80-F1-model_v4 | 2Fe-2S ferredoxin | 0.9705 | 9 | 103 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A2N2S2L8-F1-model_v4 | (2Fe-2S)-binding protein | 0.9702 | 1 | 105 |
GO:0009055
GO:0051537 GO:0140647 |