F458463

General Info

Members Datasets Scaffolds Average Seq Length
519 381 1038 106

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0075275|Ga0496122_0075275_2044_2373
Length 109
Sequence MTLTAIIFIHPDGKSVRVESSDGESVMQAATRHGLDGILAECGGNAMCATCHVYVDEDWLTRLPDISDDEDALLEGVATDRLPNSRLSCQIHVTSHLDGMVLRLPERQV

Samples

Sample ID Description Type Environment
1 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
47 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
48 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
71 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
72 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
73 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
113 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
114 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
115 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
116 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
161 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
187 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
188 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
225 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
226 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
229 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
230 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
231 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
232 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
233 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
234 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
235 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
236 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
237 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
238 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
239 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
240 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
241 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
242 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
245 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
246 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
247 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
248 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
249 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
254 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
255 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
256 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
259 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
260 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
261 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
262 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
263 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
264 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
265 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
266 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
267 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
268 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
269 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
270 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
271 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
272 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
273 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
274 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
275 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
276 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
277 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
278 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
279 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
280 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
281 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
282 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
283 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
284 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
285 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
286 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
287 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
288 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
289 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
290 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
291 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
292 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
293 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
294 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
295 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
296 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
297 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
298 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
299 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
300 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
301 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
302 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
303 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
304 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
305 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
306 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
307 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
308 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
309 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
310 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
311 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
312 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
313 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
314 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
315 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
316 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
317 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
318 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
319 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
320 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
321 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
322 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
323 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
324 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
325 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
326 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
327 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
328 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
329 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
330 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
331 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
332 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
333 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
334 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
335 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
336 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
337 2922368715
338 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
339 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
340 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
341 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
342 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
343 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
344 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
345 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
346 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
347 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
348 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
349 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
350 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
351 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
352 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
353 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
354 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
355 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
356 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
357 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
358 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
359 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
360 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
361 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
362 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
363 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
364 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
365 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
366 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
367 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
368 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
369 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
370 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
371 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
372 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
373 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
374 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
375 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
376 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
377 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
378 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
379 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
380 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
381 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.38
Metatranscriptomes 0
Isolates 21.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.85
Nodule 16.18
Rhizoplane 4.43
Rhizosphere 39.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496122_0075275 3300048925 Bacteria 2383
2 LJNas_1030696 3300000546 Bacteria 578
3 JGI25153J46596_10001692 3300003215 Bacteria 13083
4 JGI25153J46596_10011110 3300003215 Bacteria 4008
5 JGI25153J46596_10026722 3300003215 Bacteria 2038
6 JGI25160J50197_1001280 3300003354 Bacteria 12763
7 Ga0055526_1029663 3300003771 Bacteria 1618
8 Ga0055531_10005988 3300003794 Bacteria 6983
9 Ga0065165_1016260 3300005262 Bacteria 2793
10 Ga0065165_1095705 3300005262 Bacteria 750
11 Ga0068868_100255534 3300005338 Bacteria 1476
12 Ga0070660_101392752 3300005339 Bacteria 596
13 Ga0070668_101016616 3300005347 Bacteria 745
14 Ga0070673_102227978 3300005364 Bacteria 521
15 Ga0070659_100853790 3300005366 Bacteria 794
16 Ga0070667_100773347 3300005367 Bacteria 891
17 Ga0070714_100597601 3300005435 Bacteria 1059
18 Ga0070714_101146532 3300005435 Bacteria 758
19 Ga0070713_100010044 3300005436 Bacteria 6823
20 Ga0070710_11188953 3300005437 Bacteria 563
21 Ga0070711_100757420 3300005439 Bacteria 821
22 Ga0070663_100477569 3300005455 Bacteria 1031
23 Ga0070678_100748835 3300005456 Bacteria 884
24 Ga0070662_100115123 3300005457 Bacteria 2054
25 Ga0070685_11439477 3300005466 Bacteria 530
26 Ga0070684_100589830 3300005535 Bacteria 1033
27 Ga0068853_100089449 3300005539 Bacteria 2704
28 Ga0070665_100048058 3300005548 Bacteria 4284
29 Ga0070665_100480978 3300005548 Bacteria 1253
30 Ga0070665_101447709 3300005548 Bacteria 696
31 Ga0068855_100012149 3300005563 Bacteria 10404
32 Ga0068855_100481657 3300005563 Bacteria 1350
33 Ga0068854_100511522 3300005578 Bacteria 1013
34 Ga0068856_100627377 3300005614 Bacteria 1096
35 Ga0068852_100699554 3300005616 Bacteria 1023
36 Ga0068864_101343605 3300005618 Bacteria 716
37 Ga0068851_10343482 3300005834 Bacteria 867
38 Ga0068851_10413349 3300005834 Bacteria 796
39 Ga0068858_100806652 3300005842 Bacteria 916
40 Ga0068860_100002058 3300005843 Bacteria 21189
41 Ga0081455_10019582 3300005937 Bacteria 6397
42 Ga0081455_10092640 3300005937 Bacteria 2445
43 Ga0070717_10090247 3300006028 Bacteria 2586
44 Ga0070717_11143528 3300006028 Bacteria 709
45 Ga0075365_10055985 3300006038 Bacteria 2621
46 Ga0075364_10804476 3300006051 Bacteria 641
47 Ga0070716_100308549 3300006173 Bacteria 1104
48 Ga0070712_100459808 3300006175 Bacteria 1061
49 Ga0070712_101164831 3300006175 Bacteria 670
50 Ga0070712_101343882 3300006175 Bacteria 623
51 Ga0075362_10181495 3300006177 Bacteria 1020
52 Ga0075367_10219437 3300006178 Bacteria 1190
53 Ga0075367_10241969 3300006178 Bacteria 1131
54 Ga0075367_10339947 3300006178 Bacteria 947
55 Ga0075369_10007794 3300006186 Bacteria 4095
56 Ga0075369_10043640 3300006186 Bacteria 1925
57 Ga0075369_10164979 3300006186 Bacteria 1016
58 Ga0075366_10929898 3300006195 Bacteria 542
59 Ga0097621_101017096 3300006237 Bacteria 776
60 Ga0075370_10296526 3300006353 Bacteria 961
61 Ga0075370_10640889 3300006353 Bacteria 645
62 Ga0068871_101799406 3300006358 Bacteria 582
63 Ga0099825_1028838 3300006941 Bacteria 2646
64 Ga0099824_1004372 3300006942 Bacteria 20372
65 Ga0099823_1025568 3300006944 Bacteria 5274
66 Ga0099795_10022883 3300007788 Bacteria 2068
67 Ga0099795_10093190 3300007788 Bacteria 1170
68 Ga0105250_10215780 3300009092 Bacteria 812
69 Ga0105240_10007827 3300009093 Bacteria 15427
70 Ga0105240_11028514 3300009093 Bacteria 880
71 Ga0105245_11517001 3300009098 Bacteria 721
72 Ga0105247_10147544 3300009101 Bacteria 1547
73 Ga0105243_10250773 3300009148 Bacteria 1580
74 Ga0105241_10071726 3300009174 Bacteria 2690
75 Ga0105241_10652125 3300009174 Bacteria 956
76 Ga0105248_10669826 3300009177 Bacteria 1171
77 Ga0105237_10019431 3300009545 Bacteria 7016
78 Ga0105237_10132914 3300009545 Bacteria 2483
79 Ga0105238_10007870 3300009551 Bacteria 10662
80 Ga0105238_10908028 3300009551 Bacteria 899
81 Ga0099796_10114791 3300010159 Bacteria 1029
82 Ga0099796_10225365 3300010159 Bacteria 770
83 Ga0105239_10016692 3300010375 Bacteria 8116
84 Ga0105239_10079186 3300010375 Bacteria 3616
85 Ga0105239_10092022 3300010375 Bacteria 3347
86 Ga0105239_10151651 3300010375 Bacteria 2587
87 Ga0105246_10354582 3300011119 Bacteria 1203
88 Ga0157374_10202276 3300013296 Bacteria 1945
89 Ga0157374_10653640 3300013296 Bacteria 1063
90 Ga0163162_10278070 3300013306 Bacteria 1806
91 Ga0163162_10504831 3300013306 Bacteria 1340
92 Ga0157372_12085171 3300013307 Bacteria 651
93 Ga0157375_10128833 3300013308 Bacteria 2649
94 Ga0163163_10155692 3300014325 Bacteria 2330
95 Ga0182008_10682220 3300014497 Bacteria 585
96 Ga0157376_11218059 3300014969 Bacteria 781
97 Ga0157376_11906787 3300014969 Bacteria 631
98 Ga0163161_10959385 3300017792 Bacteria 728
99 Ga0214544_1000003 3300021320 Bacteria 643752
100 Ga0214542_1000003 3300021321 Bacteria 435700
101 Ga0214545_1000004 3300021324 Bacteria 453352
102 Ga0214545_1037165 3300021324 Bacteria 1494
103 Ga0214543_1000007 3300021327 Bacteria 414744
104 Ga0213876_10002313 3300021384 Bacteria 11242
105 Ga0209233_1062543 3300025261 Bacteria 714
106 Ga0209673_1029096 3300025273 Bacteria 1764
107 Ga0209025_1124256 3300025294 Bacteria 764
108 Ga0209564_1013475 3300025295 Bacteria 3468
109 Ga0209758_1000015 3300025297 Bacteria 851943
110 Ga0209758_1001252 3300025297 Bacteria 31479
111 Ga0209758_1001829 3300025297 Bacteria 23439
112 Ga0209758_1005164 3300025297 Bacteria 10270
113 Ga0209758_1033529 3300025297 Bacteria 2059
114 Ga0209256_1006017 3300025299 Bacteria 6638
115 Ga0207426_1000585 3300025302 Bacteria 48529
116 Ga0207426_1006102 3300025302 Bacteria 5308
117 Ga0209257_1001348 3300025304 Bacteria 29776
118 Ga0209257_1031969 3300025304 Bacteria 1674
119 Ga0207710_10131336 3300025900 Bacteria 1203
120 Ga0207647_10549741 3300025904 Bacteria 640
121 Ga0207654_10041745 3300025911 Bacteria 2593
122 Ga0207695_10000548 3300025913 Bacteria 77673
123 Ga0207695_10161116 3300025913 Bacteria 2175
124 Ga0207671_10006410 3300025914 Bacteria 10483
125 Ga0207671_10009328 3300025914 Bacteria 8213
126 Ga0207671_10243876 3300025914 Bacteria 1412
127 Ga0207671_11212082 3300025914 Bacteria 590
128 Ga0207693_10184496 3300025915 Bacteria 1642
129 Ga0207657_10640765 3300025919 Bacteria 828
130 Ga0207694_10010496 3300025924 Bacteria 6988
131 Ga0207650_11394595 3300025925 Bacteria 596
132 Ga0207687_11479088 3300025927 Bacteria 584
133 Ga0207700_10007140 3300025928 Bacteria 6808
134 Ga0207690_10586698 3300025932 Bacteria 909
135 Ga0207706_10416526 3300025933 Bacteria 1164
136 Ga0207665_10319165 3300025939 Bacteria 1165
137 Ga0207711_10962285 3300025941 Bacteria 793
138 Ga0207667_10057124 3300025949 Bacteria 4097
139 Ga0207667_10549600 3300025949 Bacteria 1168
140 Ga0207668_10040472 3300025972 Bacteria 3145
141 Ga0207668_10558188 3300025972 Bacteria 993
142 Ga0207640_10496564 3300025981 Bacteria 1015
143 Ga0207640_10527131 3300025981 Bacteria 988
144 Ga0207658_10541359 3300025986 Bacteria 1041
145 Ga0207677_10376278 3300026023 Bacteria 1197
146 Ga0207703_10730652 3300026035 Bacteria 943
147 Ga0207703_10887070 3300026035 Bacteria 854
148 Ga0207703_11525691 3300026035 Bacteria 643
149 Ga0207639_10270453 3300026041 Bacteria 1490
150 Ga0207639_10520855 3300026041 Bacteria 1089
151 Ga0207678_10021859 3300026067 Bacteria 5610
152 Ga0207641_11148933 3300026088 Bacteria 776
153 Ga0207648_10146186 3300026089 Bacteria 2085
154 Ga0207676_11926309 3300026095 Bacteria 590
155 Ga0207675_101425447 3300026118 Bacteria 713
156 Ga0207683_10718681 3300026121 Bacteria 926
157 Ga0207698_10039537 3300026142 Bacteria 3496
158 Ga0209389_1000015 3300027296 Bacteria 188311
159 Ga0209389_1000029 3300027296 Bacteria 140337
160 Ga0209589_1000012 3300027357 Bacteria 229451
161 Ga0209589_1000013 3300027357 Bacteria 229273
162 Ga0209489_100013 3300027361 Bacteria 229831
163 Ga0209489_100072 3300027361 Bacteria 138111
164 Ga0209700_100034 3300027363 Bacteria 197276
165 Ga0209179_1036438 3300027512 Bacteria 1025
166 Ga0209588_1023187 3300027671 Bacteria 1955
167 Ga0268266_10081037 3300028379 Bacteria 2829
168 Ga0268266_11254151 3300028379 Bacteria 716
169 Ga0268264_10000049 3300028381 Bacteria 329992
170 Ga0265330_10061488 3300031235 Bacteria 1634
171 Ga0265332_10010078 3300031238 Bacteria 4208
172 Ga0265328_10019935 3300031239 Bacteria 2570
173 Ga0265325_10032926 3300031241 Bacteria 2765
174 Ga0265329_10211603 3300031242 Bacteria 640
175 Ga0265340_10208915 3300031247 Bacteria 877
176 Ga0265339_10045684 3300031249 Bacteria 2410
177 Ga0265331_10049017 3300031250 Bacteria 2030
178 Ga0265316_10249261 3300031344 Bacteria 1304
179 Ga0307509_10022323 3300031507 Bacteria 7137
180 Ga0307509_10449967 3300031507 Bacteria 982
181 Ga0307508_10000046 3300031616 Bacteria 139709
182 Ga0307508_10176880 3300031616 Bacteria 1737
183 Ga0307508_10443372 3300031616 Bacteria 890
184 Ga0265314_10166526 3300031711 Bacteria 1335
185 Ga0265314_10594883 3300031711 Bacteria 570
186 Ga0265342_10216067 3300031712 Bacteria 1035
187 Ga0307516_10542842 3300031730 Bacteria 816
188 Ga0307412_10021329 3300031911 Bacteria 3956
189 Ga0307507_10010582 3300033179 Bacteria 11885
190 Ga0316212_1048739 3300033547 Bacteria 602
191 Ga0373935_0480597 3300035692 Bacteria 900
192 Ga0373927_0082091 3300035695 Bacteria 2089
193 Ga0395905_0002607 3300037471 Bacteria 19855
194 Ga0395905_0919694 3300037471 Bacteria 778
195 Ga0395901_0380831 3300038443 Bacteria 1452
196 Ga0395901_0833300 3300038443 Bacteria 909
197 Ga0436365_0989879 3300039437 Bacteria 21862
198 Ga0439446_0278489 3300042156 Bacteria 583
199 Ga0466969_0008112 3300044656 Bacteria 5575
200 Ga0466972_0004158 3300044658 Bacteria 7224
201 Ga0466972_0075631 3300044658 Bacteria 1605
202 Ga0466972_0262536 3300044658 Bacteria 807
203 Ga0466965_0076432 3300044683 Bacteria 1690
204 Ga0466965_0083061 3300044683 Bacteria 1621
205 Ga0466965_0184644 3300044683 Bacteria 1101
206 Ga0466966_0000238 3300044684 Bacteria 36401
207 Ga0466961_0000044 3300044693 Bacteria 76071
208 Ga0466964_0176080 3300044706 Bacteria 1011
209 Ga0466964_0317715 3300044706 Bacteria 790
210 Ga0466968_0020935 3300044735 Bacteria 2644
211 Ga0466970_0440606 3300044765 Bacteria 746
212 Ga0466960_0004740 3300044901 Bacteria 5342
213 Ga0466960_0086072 3300044901 Bacteria 1593
214 Ga0466960_0841481 3300044901 Bacteria 557
215 Ga0466959_0000963 3300045049 Bacteria 17121
216 Ga0495629_0546964 3300046459 Bacteria 777
217 Ga0495638_0046390 3300046460 Bacteria 2729
218 Ga0495651_0122593 3300046462 Bacteria 1907
219 Ga0495639_0541176 3300046475 Bacteria 596
220 Ga0495664_0158930 3300046477 Bacteria 1371
221 Ga0495585_0438682 3300046492 Bacteria 626
222 Ga0495594_0730347 3300046499 Bacteria 559
223 Ga0495596_0180228 3300046500 Bacteria 821
224 Ga0495607_0171007 3300046501 Bacteria 1097
225 Ga0495607_0243049 3300046501 Bacteria 870
226 Ga0495583_0089330 3300046506 Bacteria 1329
227 Ga0495606_0046405 3300046507 Bacteria 2872
228 Ga0495606_0113838 3300046507 Bacteria 1628
229 Ga0495610_0368979 3300046512 Bacteria 536
230 Ga0495616_0042119 3300046513 Bacteria 2326
231 Ga0495620_0020355 3300046515 Bacteria 3242
232 Ga0495632_0053579 3300046519 Bacteria 1981
233 Ga0495643_0062009 3300046522 Bacteria 1981
234 Ga0495643_0129445 3300046522 Bacteria 1268
235 Ga0495648_0001433 3300046524 Bacteria 23346
236 Ga0495648_0082093 3300046524 Bacteria 1831
237 Ga0495648_0157191 3300046524 Bacteria 1179
238 Ga0495652_0055076 3300046529 Bacteria 3384
239 Ga0495654_0009803 3300046530 Bacteria 5235
240 Ga0495622_0117176 3300046557 Bacteria 1217
241 Ga0495668_0092366 3300046616 Bacteria 1658
242 Ga0495668_0161919 3300046616 Bacteria 1226
243 Ga0495668_0187758 3300046616 Bacteria 1132
244 Ga0495611_0027324 3300046648 Bacteria 2494
245 Ga0495611_0162027 3300046648 Bacteria 1045
246 Ga0495625_0014301 3300046660 Bacteria 6341
247 Ga0495625_0846440 3300046660 Bacteria 528
248 Ga0495661_0297885 3300046665 Bacteria 808
249 Ga0495588_0021077 3300046674 Bacteria 3208
250 Ga0495588_0209136 3300046674 Bacteria 1030
251 Ga0495599_0633468 3300046678 Bacteria 621
252 Ga0495624_0118741 3300046690 Bacteria 1625
253 Ga0495670_0010379 3300046691 Bacteria 4575
254 Ga0495671_0164005 3300046692 Bacteria 1081
255 Ga0495649_0044277 3300046694 Bacteria 2430
256 Ga0495589_0178241 3300046794 Bacteria 1009
257 Ga0495589_0305604 3300046794 Bacteria 737
258 Ga0495604_0411784 3300047317 Bacteria 889
259 Ga0495672_0399120 3300047320 Bacteria 629
260 Ga0495672_0556898 3300047320 Bacteria 502
261 Ga0495677_0060051 3300047445 Bacteria 1409
262 Ga0495673_0168243 3300047469 Bacteria 837
263 Ga0495681_0118997 3300047470 Bacteria 1135
264 Ga0495686_0130058 3300047472 Bacteria 1493
265 Ga0495686_0251196 3300047472 Bacteria 994
266 Ga0495614_0192017 3300048089 Bacteria 922
267 Ga0495626_0151617 3300048091 Bacteria 977
268 Ga0496100_0199540 3300048903 Bacteria 1457
269 Ga0496100_0571970 3300048903 Bacteria 876
270 Ga0496101_0521291 3300048904 Bacteria 939
271 Ga0496102_0253775 3300048905 Bacteria 1658
272 Ga0496102_1625759 3300048905 Bacteria 564
273 Ga0496103_0538701 3300048906 Bacteria 746
274 Ga0496104_0469990 3300048907 Bacteria 1169
275 Ga0496105_0458340 3300048908 Bacteria 1005
276 Ga0496106_0001452 3300048909 Bacteria 17800
277 Ga0496106_0190724 3300048909 Bacteria 1629
278 Ga0496107_0924167 3300048910 Bacteria 635
279 Ga0496108_0173658 3300048911 Bacteria 1865
280 Ga0496108_0473137 3300048911 Bacteria 1095
281 Ga0496109_0541762 3300048912 Bacteria 1098
282 Ga0496110_0048909 3300048913 Bacteria 3708
283 Ga0496111_0298750 3300048914 Bacteria 1194
284 Ga0496112_0248293 3300048915 Bacteria 1731
285 Ga0496113_0287642 3300048916 Bacteria 1315
286 Ga0496113_0686848 3300048916 Bacteria 817
287 Ga0496114_0113764 3300048917 Bacteria 2320
288 Ga0496114_0830960 3300048917 Bacteria 803
289 Ga0496115_0117181 3300048918 Bacteria 2191
290 Ga0496116_0006682 3300048919 Bacteria 10401
291 Ga0496116_0044872 3300048919 Bacteria 2997
292 Ga0496116_0149352 3300048919 Bacteria 1301
293 Ga0496117_0035646 3300048920 Bacteria 3732
294 Ga0496117_0096481 3300048920 Bacteria 1886
295 Ga0496117_0109611 3300048920 Bacteria 1723
296 Ga0496117_0121561 3300048920 Bacteria 1603
297 Ga0496117_0600970 3300048920 Bacteria 514
298 Ga0496118_0009493 3300048921 Bacteria 9812
299 Ga0496118_0072113 3300048921 Bacteria 2482
300 Ga0496118_0072195 3300048921 Bacteria 2480
301 Ga0496118_0078253 3300048921 Bacteria 2341
302 Ga0496118_0178736 3300048921 Bacteria 1285
303 Ga0496118_0295041 3300048921 Bacteria 893
304 Ga0496119_0096735 3300048922 Bacteria 1665
305 Ga0496119_0108773 3300048922 Bacteria 1543
306 Ga0496119_0118559 3300048922 Bacteria 1458
307 Ga0496120_0484259 3300048923 Bacteria 534
308 Ga0496121_0000261 3300048924 Bacteria 110085
309 Ga0496121_0028610 3300048924 Bacteria 5184
310 Ga0496121_0047604 3300048924 Bacteria 3656
311 Ga0496121_0061363 3300048924 Bacteria 3085
312 Ga0496121_0209964 3300048924 Bacteria 1380
313 Ga0496121_0482125 3300048924 Bacteria 792
314 Ga0496122_0050542 3300048925 Bacteria 3169
315 Ga0496122_0209247 3300048925 Bacteria 1131
316 Ga0496123_0055443 3300048926 Bacteria 2600
317 Ga0496123_0131684 3300048926 Bacteria 1384
318 Ga0496123_0271951 3300048926 Bacteria 824
319 Ga0496123_0383686 3300048926 Bacteria 644
320 Ga0496124_0002998 3300048927 Bacteria 21122
321 Ga0496124_0211266 3300048927 Bacteria 1468
322 Ga0496124_0306189 3300048927 Bacteria 1145
323 Ga0496125_0000210 3300048928 Bacteria 121786
324 Ga0496125_0059133 3300048928 Bacteria 3090
325 Ga0496125_0065440 3300048928 Bacteria 2880
326 Ga0496125_0067620 3300048928 Bacteria 2814
327 Ga0496125_0123562 3300048928 Bacteria 1840
328 Ga0496125_0244787 3300048928 Bacteria 1136
329 Ga0496125_0573660 3300048928 Bacteria 621
330 Ga0496126_0008831 3300048929 Bacteria 10808
331 Ga0496126_0139264 3300048929 Bacteria 2090
332 Ga0496126_0143953 3300048929 Bacteria 2049
333 Ga0496126_0146174 3300048929 Bacteria 2030
334 Ga0496126_0176256 3300048929 Bacteria 1818
335 Ga0496126_0322426 3300048929 Bacteria 1269
336 Ga0496126_0659818 3300048929 Bacteria 817
337 Ga0496126_1248316 3300048929 Bacteria 544
338 nmdc:mga03683_221736_c1 3300050489 Bacteria 872
339 nmdc:mga03683_553775_c1 3300050489 Bacteria 560
340 nmdc:mga03n38_852652_c1 3300050490 Bacteria 533
341 nmdc:mga0yw44_219630_c1 3300050492 Bacteria 1259
342 nmdc:mga0yw44_3707_c1 3300050492 Bacteria 6839
343 nmdc:mga0yw44_75963_c1 3300050492 Bacteria 2096
344 nmdc:mga0k408_366744_c1 3300050493 Bacteria 858
345 nmdc:mga0k408_906164_c1 3300050493 Bacteria 511
346 nmdc:mga06z11_277537_c2 3300050494 Bacteria 691
347 nmdc:mga06z11_452929_c1 3300050494 Bacteria 775
348 nmdc:mga06z11_663371_c1 3300050494 Bacteria 635
349 nmdc:mga06z11_864994_c1 3300050494 Bacteria 551
350 nmdc:mga07m45_123339_c1 3300050496 Bacteria 1497
351 nmdc:mga07m45_253660_c1 3300050496 Bacteria 1023
352 nmdc:mga07m45_335114_c1 3300050496 Bacteria 879
353 nmdc:mga0sz30_235976_c1 3300050516 Bacteria 814
354 nmdc:mga0sz30_31850_c1 3300050516 Bacteria 2184
355 Ga0500635_0028832 3300053080 Bacteria 1777
356 Ga0500578_0077233 3300053086 Bacteria 2120
357 Ga0500578_0126089 3300053086 Bacteria 1608
358 Ga0500643_012149 3300053087 Bacteria 3097
359 Ga0500644_0038249 3300053088 Bacteria 1573
360 Ga0500581_141858 3300053089 Bacteria 1137
361 Ga0500646_0101751 3300053090 Bacteria 903
362 Ga0500583_0384255 3300053092 Bacteria 676
363 Ga0500651_0028799 3300053093 Bacteria 3491
364 Ga0500651_0411874 3300053093 Bacteria 758
365 Ga0500566_0000990 3300053094 Bacteria 16360
366 Ga0500641_0150850 3300053096 Bacteria 1003
367 Ga0500648_062965 3300053097 Bacteria 2102
368 Ga0500650_0001012 3300053098 Bacteria 7987
369 Ga0500556_0000002 3300053104 Bacteria 773626
370 Ga0500558_205550 3300053106 Bacteria 682
371 Ga0500562_086308 3300053108 Bacteria 850
372 Ga0500569_043784 3300053109 Bacteria 1323
373 Ga0500592_031992 3300053116 Bacteria 849
374 Ga0500594_0127038 3300053118 Bacteria 805
375 Ga0500595_107825 3300053119 Bacteria 794
376 Ga0500607_033478 3300053121 Bacteria 2816
377 Ga0500608_001204 3300053122 Bacteria 9253
378 Ga0500621_222912 3300053126 Bacteria 652
379 Ga0500642_0000093 3300053130 Bacteria 44347
380 Ga0500642_0014309 3300053130 Bacteria 2947
381 Ga0500652_006685 3300053131 Bacteria 3729
382 Ga0500655_099205 3300053133 Bacteria 609
383 Ga0500658_0077605 3300053134 Bacteria 1414
384 Ga0500559_0000512 3300053136 Bacteria 27276
385 Ga0500559_0287988 3300053136 Bacteria 772
386 Ga0500568_0000835 3300053139 Bacteria 21662
387 Ga0500577_0129607 3300053142 Bacteria 1056
388 Ga0500586_002762 3300053145 Bacteria 4033
389 Ga0500590_208486 3300053148 Bacteria 819
390 Ga0500604_0002705 3300053151 Bacteria 4821
391 Ga0500616_0000069 3300053153 Bacteria 234334
392 Ga0500619_192987 3300053154 Bacteria 685
393 Ga0500622_0020172 3300053156 Bacteria 3539
394 Ga0500633_0051468 3300053160 Bacteria 1422
395 Ga0500633_0292055 3300053160 Bacteria 601
396 Ga0500634_0335094 3300053161 Bacteria 584
397 Ga0500638_052841 3300053162 Bacteria 1962
398 Ga0500636_0074071 3300053177 Bacteria 1971
399 Ga0500636_0080807 3300053177 Bacteria 1872
400 Ga0500636_0147954 3300053177 Bacteria 1292
401 Ga0500636_0259053 3300053177 Bacteria 881
402 Ga0500637_0041196 3300053178 Bacteria 2611
403 Ga0500645_110601 3300053730 Bacteria 771
404 Ga0500609_041537 3300053731 Bacteria 636
405 Ga0500552_052726 3300053733 Bacteria 693
406 Ga0500596_002248 3300053735 Bacteria 3832
407 2513648001 2513237095 Bacteria 8976980
408 2513674011 2513237098 Bacteria 9902361
409 2513702881 2513237102 Bacteria 7703324
410 2513715670 2513237104 Bacteria 10034502
411 2513873951 2513237139 Bacteria 8737671
412 2514012925 2513237161 Bacteria 8871253
413 2517102427 2517093001 Bacteria 9002274
414 2524435705 2524023205 Bacteria 8918781
415 2524470001 2524023210 Bacteria 9029266
416 2528850361 2528768022 Bacteria 10457665
417 2603858924 2602042107 Bacteria 6226103
418 2617351663 2617270735 Bacteria 9163226
419 2617374169 2617270741 Bacteria 8201522
420 2723842068 2721755755 Bacteria 8322773
421 2745079001 2744054633 Bacteria 8678936
422 2793063138 2791355196 Bacteria 7323613
423 2805919462 2802429603 Bacteria 8777136
424 2818237240 2816332527 Bacteria 8933356
425 2824602537 2824600985 Bacteria 8488197
426 2824612683 2824609381 Bacteria 8672835
427 2824624791 2824617872 Bacteria 8814715
428 2824633663 2824626560 Bacteria 8813858
429 2824641533 2824635225 Bacteria 8785348
430 2824651928 2824644064 Bacteria 8743947
431 2824654497 2824653114 Bacteria 8493680
432 2824663625 2824661429 Bacteria 9877870
433 2824674893 2824671348 Bacteria 8369588
434 2824686670 2824679649 Bacteria 8248951
435 2824695387 2824687955 Bacteria 8360029
436 2824700450 2824696289 Bacteria 8335049
437 2824709441 2824704595 Bacteria 9667483
438 2824722161 2824714736 Bacteria 8717648
439 2824731946 2824723954 Bacteria 8758240
440 2824734829 2824732956 Bacteria 7810675
441 2824748165 2824746037 Bacteria 7911610
442 2824758454 2824753945 Bacteria 9787441
443 2824768844 2824763712 Bacteria 9792355
444 2824774981 2824773399 Bacteria 8360218
445 2828309487 2828305725 Bacteria 4916900
446 2838129519 2838122688 Bacteria 8803140
447 2841951561 2841949485 Bacteria 8680857
448 2841964652 2841957949 Bacteria 8652217
449 2841969197 2841966195 Bacteria 8673214
450 2841991056 2841983080 Bacteria 8395090
451 2842043921 2842038055 Bacteria 8002051
452 2842052089 2842045827 Bacteria 8006841
453 2847939755 2847930680 Bacteria 9342022
454 2847941715 2847939898 Bacteria 8606328
455 2857511530 2857509624 Bacteria 7472071
456 2857527970 2857524615 Bacteria 6615449
457 2874617958 2874612657 Bacteria 8252029
458 2874624383 2874620515 Bacteria 8290088
459 2876765003 2876761206 Bacteria 10111113
460 2879089985 2879083081 Bacteria 8587928
461 2879101285 2879099564 Bacteria 10442239
462 2881672906 2881665667 Bacteria 8175609
463 2885371434 2885366525 Bacteria 8326213
464 2885387705 2885383462 Bacteria 9473874
465 2888380006 2888378607 Bacteria 9652610
466 2888420810 2888419890 Bacteria 7857137
467 2893068386 2893066018 Bacteria 6158120
468 2903771376 2903768456 Bacteria 9749579
469 2904672278 2904666416 Bacteria 8226587
470 2904716007 2904711408 Bacteria 9771557
471 2906634423 2906626472 Bacteria 8826946
472 2906651697 2906643746 Bacteria 8722424
473 2908776644 2908775508 Bacteria 8092255
474 2919075370 2919073203 Bacteria 6531949
475 2922378389
476 2922400327 2922393267 Bacteria 8285685
477 2929622512 2929615660 Bacteria 9193770
478 2929631270 2929624759 Bacteria 9339455
479 2932786308 2932784394 Bacteria 9704911
480 2932812617 2932809354 Bacteria 9135765
481 2932822979 2932818245 Bacteria 9955613
482 2932829546 2932828146 Bacteria 9745859
483 2933584409 2933577622 Bacteria 9116884
484 2935618064 2935616580 Bacteria 9032984
485 2935641538 2935638405 Bacteria 10015038
486 2935669404 2935665750 Bacteria 9571747
487 2935677998 2935675223 Bacteria 9928132
488 2935693681 2935684952 Bacteria 9590419
489 2935701763 2935694250 Bacteria 9291695
490 2935707228 2935703347 Bacteria 10242284
491 2935717070 2935713505 Bacteria 9608509
492 2935730096 2935722832 Bacteria 9608746
493 2935738484 2935732158 Bacteria 9706831
494 2935750272 2935741537 Bacteria 9707219
495 2935759866 2935750917 Bacteria 9590372
496 2935764482 2935760218 Bacteria 9817913
497 2935804392 2935801545 Bacteria 9301974
498 2935817253 2935810662 Bacteria 9401221
499 2935831269 2935827899 Bacteria 10038562
500 2935841878 2935837841 Bacteria 9454360
501 2935856437 2935855204 Bacteria 9035059
502 2935871040 2935864058 Bacteria 9784707
503 2935874537 2935873716 Bacteria 9632195
504 2935993998 2935992306 Bacteria 9802711
505 2936004991 2936002035 Bacteria 9362176
506 2936044049 2936037263 Bacteria 9446081
507 2940565680 2940556831 Bacteria 9590747
508 2941543951 2941538514 Bacteria 9402094
509 3005594179 3005587118 Bacteria 7794411
510 3005597804 3005594810 Bacteria 8716512
511 8016518682 8016511872 Bacteria 9921665
512 8016586863 8016583857 Bacteria 10421953
513 8017057991 8017057580 Bacteria 10023680
514 8019577729 8019576017 Bacteria 10049540
515 8019605930 8019597564 Bacteria 10041141
516 8019612603 8019608314 Bacteria 10042931
517 8055750963 8055742211 Bacteria 9226248
518 8056677773 8056673599 Bacteria 7871253
519 8056683119 8056681323 Bacteria 8472857
520 Ga0496122_0075275
521 LJNas_1030696
522 JGI25153J46596_10001692
523 JGI25153J46596_10011110
524 JGI25153J46596_10026722
525 JGI25160J50197_1001280
526 Ga0055526_1029663
527 Ga0055531_10005988
528 Ga0065165_1016260
529 Ga0065165_1095705
530 Ga0068868_100255534
531 Ga0070660_101392752
532 Ga0070668_101016616
533 Ga0070673_102227978
534 Ga0070659_100853790
535 Ga0070667_100773347
536 Ga0070714_100597601
537 Ga0070714_101146532
538 Ga0070713_100010044
539 Ga0070710_11188953
540 Ga0070711_100757420
541 Ga0070663_100477569
542 Ga0070678_100748835
543 Ga0070662_100115123
544 Ga0070685_11439477
545 Ga0070684_100589830
546 Ga0068853_100089449
547 Ga0070665_100048058
548 Ga0070665_100480978
549 Ga0070665_101447709
550 Ga0068855_100012149
551 Ga0068855_100481657
552 Ga0068854_100511522
553 Ga0068856_100627377
554 Ga0068852_100699554
555 Ga0068864_101343605
556 Ga0068851_10343482
557 Ga0068851_10413349
558 Ga0068858_100806652
559 Ga0068860_100002058
560 Ga0081455_10019582
561 Ga0081455_10092640
562 Ga0070717_10090247
563 Ga0070717_11143528
564 Ga0075365_10055985
565 Ga0075364_10804476
566 Ga0070716_100308549
567 Ga0070712_100459808
568 Ga0070712_101164831
569 Ga0070712_101343882
570 Ga0075362_10181495
571 Ga0075367_10219437
572 Ga0075367_10241969
573 Ga0075367_10339947
574 Ga0075369_10007794
575 Ga0075369_10043640
576 Ga0075369_10164979
577 Ga0075366_10929898
578 Ga0097621_101017096
579 Ga0075370_10296526
580 Ga0075370_10640889
581 Ga0068871_101799406
582 Ga0099825_1028838
583 Ga0099824_1004372
584 Ga0099823_1025568
585 Ga0099795_10022883
586 Ga0099795_10093190
587 Ga0105250_10215780
588 Ga0105240_10007827
589 Ga0105240_11028514
590 Ga0105245_11517001
591 Ga0105247_10147544
592 Ga0105243_10250773
593 Ga0105241_10071726
594 Ga0105241_10652125
595 Ga0105248_10669826
596 Ga0105237_10019431
597 Ga0105237_10132914
598 Ga0105238_10007870
599 Ga0105238_10908028
600 Ga0099796_10114791
601 Ga0099796_10225365
602 Ga0105239_10016692
603 Ga0105239_10079186
604 Ga0105239_10092022
605 Ga0105239_10151651
606 Ga0105246_10354582
607 Ga0157374_10202276
608 Ga0157374_10653640
609 Ga0163162_10278070
610 Ga0163162_10504831
611 Ga0157372_12085171
612 Ga0157375_10128833
613 Ga0163163_10155692
614 Ga0182008_10682220
615 Ga0157376_11218059
616 Ga0157376_11906787
617 Ga0163161_10959385
618 Ga0214544_1000003
619 Ga0214542_1000003
620 Ga0214545_1000004
621 Ga0214545_1037165
622 Ga0214543_1000007
623 Ga0213876_10002313
624 Ga0209233_1062543
625 Ga0209673_1029096
626 Ga0209025_1124256
627 Ga0209564_1013475
628 Ga0209758_1000015
629 Ga0209758_1001252
630 Ga0209758_1001829
631 Ga0209758_1005164
632 Ga0209758_1033529
633 Ga0209256_1006017
634 Ga0207426_1000585
635 Ga0207426_1006102
636 Ga0209257_1001348
637 Ga0209257_1031969
638 Ga0207710_10131336
639 Ga0207647_10549741
640 Ga0207654_10041745
641 Ga0207695_10000548
642 Ga0207695_10161116
643 Ga0207671_10006410
644 Ga0207671_10009328
645 Ga0207671_10243876
646 Ga0207671_11212082
647 Ga0207693_10184496
648 Ga0207657_10640765
649 Ga0207694_10010496
650 Ga0207650_11394595
651 Ga0207687_11479088
652 Ga0207700_10007140
653 Ga0207690_10586698
654 Ga0207706_10416526
655 Ga0207665_10319165
656 Ga0207711_10962285
657 Ga0207667_10057124
658 Ga0207667_10549600
659 Ga0207668_10040472
660 Ga0207668_10558188
661 Ga0207640_10496564
662 Ga0207640_10527131
663 Ga0207658_10541359
664 Ga0207677_10376278
665 Ga0207703_10730652
666 Ga0207703_10887070
667 Ga0207703_11525691
668 Ga0207639_10270453
669 Ga0207639_10520855
670 Ga0207678_10021859
671 Ga0207641_11148933
672 Ga0207648_10146186
673 Ga0207676_11926309
674 Ga0207675_101425447
675 Ga0207683_10718681
676 Ga0207698_10039537
677 Ga0209389_1000015
678 Ga0209389_1000029
679 Ga0209589_1000012
680 Ga0209589_1000013
681 Ga0209489_100013
682 Ga0209489_100072
683 Ga0209700_100034
684 Ga0209179_1036438
685 Ga0209588_1023187
686 Ga0268266_10081037
687 Ga0268266_11254151
688 Ga0268264_10000049
689 Ga0265330_10061488
690 Ga0265332_10010078
691 Ga0265328_10019935
692 Ga0265325_10032926
693 Ga0265329_10211603
694 Ga0265340_10208915
695 Ga0265339_10045684
696 Ga0265331_10049017
697 Ga0265316_10249261
698 Ga0307509_10022323
699 Ga0307509_10449967
700 Ga0307508_10000046
701 Ga0307508_10176880
702 Ga0307508_10443372
703 Ga0265314_10166526
704 Ga0265314_10594883
705 Ga0265342_10216067
706 Ga0307516_10542842
707 Ga0307412_10021329
708 Ga0307507_10010582
709 Ga0316212_1048739
710 Ga0373935_0480597
711 Ga0373927_0082091
712 Ga0395905_0002607
713 Ga0395905_0919694
714 Ga0395901_0380831
715 Ga0395901_0833300
716 Ga0436365_0989879
717 Ga0439446_0278489
718 Ga0466969_0008112
719 Ga0466972_0004158
720 Ga0466972_0075631
721 Ga0466972_0262536
722 Ga0466965_0076432
723 Ga0466965_0083061
724 Ga0466965_0184644
725 Ga0466966_0000238
726 Ga0466961_0000044
727 Ga0466964_0176080
728 Ga0466964_0317715
729 Ga0466968_0020935
730 Ga0466970_0440606
731 Ga0466960_0004740
732 Ga0466960_0086072
733 Ga0466960_0841481
734 Ga0466959_0000963
735 Ga0495629_0546964
736 Ga0495638_0046390
737 Ga0495651_0122593
738 Ga0495639_0541176
739 Ga0495664_0158930
740 Ga0495585_0438682
741 Ga0495594_0730347
742 Ga0495596_0180228
743 Ga0495607_0171007
744 Ga0495607_0243049
745 Ga0495583_0089330
746 Ga0495606_0046405
747 Ga0495606_0113838
748 Ga0495610_0368979
749 Ga0495616_0042119
750 Ga0495620_0020355
751 Ga0495632_0053579
752 Ga0495643_0062009
753 Ga0495643_0129445
754 Ga0495648_0001433
755 Ga0495648_0082093
756 Ga0495648_0157191
757 Ga0495652_0055076
758 Ga0495654_0009803
759 Ga0495622_0117176
760 Ga0495668_0092366
761 Ga0495668_0161919
762 Ga0495668_0187758
763 Ga0495611_0027324
764 Ga0495611_0162027
765 Ga0495625_0014301
766 Ga0495625_0846440
767 Ga0495661_0297885
768 Ga0495588_0021077
769 Ga0495588_0209136
770 Ga0495599_0633468
771 Ga0495624_0118741
772 Ga0495670_0010379
773 Ga0495671_0164005
774 Ga0495649_0044277
775 Ga0495589_0178241
776 Ga0495589_0305604
777 Ga0495604_0411784
778 Ga0495672_0399120
779 Ga0495672_0556898
780 Ga0495677_0060051
781 Ga0495673_0168243
782 Ga0495681_0118997
783 Ga0495686_0130058
784 Ga0495686_0251196
785 Ga0495614_0192017
786 Ga0495626_0151617
787 Ga0496100_0199540
788 Ga0496100_0571970
789 Ga0496101_0521291
790 Ga0496102_0253775
791 Ga0496102_1625759
792 Ga0496103_0538701
793 Ga0496104_0469990
794 Ga0496105_0458340
795 Ga0496106_0001452
796 Ga0496106_0190724
797 Ga0496107_0924167
798 Ga0496108_0173658
799 Ga0496108_0473137
800 Ga0496109_0541762
801 Ga0496110_0048909
802 Ga0496111_0298750
803 Ga0496112_0248293
804 Ga0496113_0287642
805 Ga0496113_0686848
806 Ga0496114_0113764
807 Ga0496114_0830960
808 Ga0496115_0117181
809 Ga0496116_0006682
810 Ga0496116_0044872
811 Ga0496116_0149352
812 Ga0496117_0035646
813 Ga0496117_0096481
814 Ga0496117_0109611
815 Ga0496117_0121561
816 Ga0496117_0600970
817 Ga0496118_0009493
818 Ga0496118_0072113
819 Ga0496118_0072195
820 Ga0496118_0078253
821 Ga0496118_0178736
822 Ga0496118_0295041
823 Ga0496119_0096735
824 Ga0496119_0108773
825 Ga0496119_0118559
826 Ga0496120_0484259
827 Ga0496121_0000261
828 Ga0496121_0028610
829 Ga0496121_0047604
830 Ga0496121_0061363
831 Ga0496121_0209964
832 Ga0496121_0482125
833 Ga0496122_0050542
834 Ga0496122_0209247
835 Ga0496123_0055443
836 Ga0496123_0131684
837 Ga0496123_0271951
838 Ga0496123_0383686
839 Ga0496124_0002998
840 Ga0496124_0211266
841 Ga0496124_0306189
842 Ga0496125_0000210
843 Ga0496125_0059133
844 Ga0496125_0065440
845 Ga0496125_0067620
846 Ga0496125_0123562
847 Ga0496125_0244787
848 Ga0496125_0573660
849 Ga0496126_0008831
850 Ga0496126_0139264
851 Ga0496126_0143953
852 Ga0496126_0146174
853 Ga0496126_0176256
854 Ga0496126_0322426
855 Ga0496126_0659818
856 Ga0496126_1248316
857 nmdc:mga03683_221736_c1
858 nmdc:mga03683_553775_c1
859 nmdc:mga03n38_852652_c1
860 nmdc:mga0yw44_219630_c1
861 nmdc:mga0yw44_3707_c1
862 nmdc:mga0yw44_75963_c1
863 nmdc:mga0k408_366744_c1
864 nmdc:mga0k408_906164_c1
865 nmdc:mga06z11_277537_c2
866 nmdc:mga06z11_452929_c1
867 nmdc:mga06z11_663371_c1
868 nmdc:mga06z11_864994_c1
869 nmdc:mga07m45_123339_c1
870 nmdc:mga07m45_253660_c1
871 nmdc:mga07m45_335114_c1
872 nmdc:mga0sz30_235976_c1
873 nmdc:mga0sz30_31850_c1
874 Ga0500635_0028832
875 Ga0500578_0077233
876 Ga0500578_0126089
877 Ga0500643_012149
878 Ga0500644_0038249
879 Ga0500581_141858
880 Ga0500646_0101751
881 Ga0500583_0384255
882 Ga0500651_0028799
883 Ga0500651_0411874
884 Ga0500566_0000990
885 Ga0500641_0150850
886 Ga0500648_062965
887 Ga0500650_0001012
888 Ga0500556_0000002
889 Ga0500558_205550
890 Ga0500562_086308
891 Ga0500569_043784
892 Ga0500592_031992
893 Ga0500594_0127038
894 Ga0500595_107825
895 Ga0500607_033478
896 Ga0500608_001204
897 Ga0500621_222912
898 Ga0500642_0000093
899 Ga0500642_0014309
900 Ga0500652_006685
901 Ga0500655_099205
902 Ga0500658_0077605
903 Ga0500559_0000512
904 Ga0500559_0287988
905 Ga0500568_0000835
906 Ga0500577_0129607
907 Ga0500586_002762
908 Ga0500590_208486
909 Ga0500604_0002705
910 Ga0500616_0000069
911 Ga0500619_192987
912 Ga0500622_0020172
913 Ga0500633_0051468
914 Ga0500633_0292055
915 Ga0500634_0335094
916 Ga0500638_052841
917 Ga0500636_0074071
918 Ga0500636_0080807
919 Ga0500636_0147954
920 Ga0500636_0259053
921 Ga0500637_0041196
922 Ga0500645_110601
923 Ga0500609_041537
924 Ga0500552_052726
925 Ga0500596_002248
926 2513648001
927 2513674011
928 2513702881
929 2513715670
930 2513873951
931 2514012925
932 2517102427
933 2524435705
934 2524470001
935 2528850361
936 2603858924
937 2617351663
938 2617374169
939 2723842068
940 2745079001
941 2793063138
942 2805919462
943 2818237240
944 2824602537
945 2824612683
946 2824624791
947 2824633663
948 2824641533
949 2824651928
950 2824654497
951 2824663625
952 2824674893
953 2824686670
954 2824695387
955 2824700450
956 2824709441
957 2824722161
958 2824731946
959 2824734829
960 2824748165
961 2824758454
962 2824768844
963 2824774981
964 2828309487
965 2838129519
966 2841951561
967 2841964652
968 2841969197
969 2841991056
970 2842043921
971 2842052089
972 2847939755
973 2847941715
974 2857511530
975 2857527970
976 2874617958
977 2874624383
978 2876765003
979 2879089985
980 2879101285
981 2881672906
982 2885371434
983 2885387705
984 2888380006
985 2888420810
986 2893068386
987 2903771376
988 2904672278
989 2904716007
990 2906634423
991 2906651697
992 2908776644
993 2919075370
994 2922378389
995 2922400327
996 2929622512
997 2929631270
998 2932786308
999 2932812617
1000 2932822979
1001 2932829546
1002 2933584409
1003 2935618064
1004 2935641538
1005 2935669404
1006 2935677998
1007 2935693681
1008 2935701763
1009 2935707228
1010 2935717070
1011 2935730096
1012 2935738484
1013 2935750272
1014 2935759866
1015 2935764482
1016 2935804392
1017 2935817253
1018 2935831269
1019 2935841878
1020 2935856437
1021 2935871040
1022 2935874537
1023 2935993998
1024 2936004991
1025 2936044049
1026 2940565680
1027 2941543951
1028 3005594179
1029 3005597804
1030 8016518682
1031 8016586863
1032 8017057991
1033 8019577729
1034 8019605930
1035 8019612603
1036 8055750963
1037 8056677773
1038 8056683119

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

9

94

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nbl-assembly2.cif.gz_D cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide 0.9603 1 105
1xlq-assembly4.cif.gz_A crystal structure of reduced c73s putidaredoxin from pseudomonas putida 0.9584 3 105
1uwm-assembly1.cif.gz_A reduced ferredoxin 6 from rhodobacter capsulatus 0.9541 3 104
1r7s-assembly3.cif.gz_C putidaredoxin (fe2s2 ferredoxin), c73g mutant 0.9537 3 105
3hui-assembly1.cif.gz_A crystal structure of the mutant a105r of [2fe-2s] ferredoxin in the class i cyp199a2 system from rhodopseudomonas palustris 0.9524 1 105
ID Description Score Start End Superfamily
1uwmA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.954 3 104 3.10.20.30
3lxfB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9505 3 105 3.10.20.30
af_Q9CPW2_55_168_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9484 2 105 3.10.20.30
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9474 2 105 3.10.20.30
af_Q9LSY0_1_123_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.9415 3 16 3.30.710.10
ID Description Score Start End GO Terms
AF-A0A7C2QRN5-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9722 1 105 GO:0009055
GO:0051537
GO:0140647
AF-A0A0S2EPL8-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.971 1 105 GO:0005829
GO:0009055
GO:0051537
GO:0140647
AF-A0A3M1UKT3-F1-model_v4 2Fe-2S ferredoxin 0.9708 1 103 GO:0009055
GO:0051537
GO:0140647
AF-A0A494TJ80-F1-model_v4 2Fe-2S ferredoxin 0.9705 9 103 GO:0009055
GO:0051537
GO:0140647
AF-A0A2N2S2L8-F1-model_v4 (2Fe-2S)-binding protein 0.9702 1 105 GO:0009055
GO:0051537
GO:0140647

Map