F458283

General Info

Members Datasets Scaffolds Average Seq Length
518 262 1036 118

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1209553|Ga0436365_1209553_6801_7208
Length 135
Sequence MSAVRLLDDQSSPKEDRMKYALLIYPKPGSHEALGEDEYRSVNAEYWAFREDPRCLGGAHLQPIETATTVRYGGGENLITDGPYADTKEVLGGYYVFEASNLDEALEVAQRIPAVRLGGAVEVRPLVEVPVETAH

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
261 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
262 2738541356 Mycobacterium sp. OK887 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.19
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.95
Rhizosphere 88.03
Stem 0
Stem Tuber 0
Unclassified 2.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1209553 3300039437 Bacteria 10428
2 JGI24752J21851_1005692 3300001976 Bacteria 1625
3 JGI24747J21853_1045228 3300001978 Bacteria 528
4 JGI24735J21928_10091215 3300002067 Bacteria 874
5 JGI24033J26618_1036843 3300002155 Bacteria 673
6 JGI25407J50210_10034925 3300003373 Bacteria 1296
7 JGI25407J50210_10130419 3300003373 Bacteria 619
8 JGI25407J50210_10159846 3300003373 Bacteria 555
9 Ga0070658_10060835 3300005327 Bacteria 3076
10 Ga0070676_10011903 3300005328 Bacteria 4739
11 Ga0070683_100079985 3300005329 Bacteria 3059
12 Ga0070683_100199806 3300005329 Bacteria 1898
13 Ga0070683_100665309 3300005329 Bacteria 997
14 Ga0070690_101236004 3300005330 Bacteria 597
15 Ga0070670_100033361 3300005331 Bacteria 4433
16 Ga0068869_100009598 3300005334 Bacteria 6285
17 Ga0068869_100846272 3300005334 Bacteria 789
18 Ga0070666_10081036 3300005335 Bacteria 2219
19 Ga0070680_100061579 3300005336 Bacteria 3072
20 Ga0070680_101637500 3300005336 Bacteria 558
21 Ga0070682_100001638 3300005337 Bacteria 12431
22 Ga0070682_100095442 3300005337 Bacteria 1953
23 Ga0070682_101359794 3300005337 Bacteria 606
24 Ga0068868_100012346 3300005338 Bacteria 6241
25 Ga0068868_100020941 3300005338 Bacteria 4922
26 Ga0068868_100138194 3300005338 Bacteria 1999
27 Ga0068868_100170456 3300005338 Bacteria 1802
28 Ga0068868_101933475 3300005338 Bacteria 559
29 Ga0070660_100172688 3300005339 Bacteria 1746
30 Ga0070691_10008218 3300005341 Bacteria 4782
31 Ga0070691_10644531 3300005341 Bacteria 630
32 Ga0070687_100111022 3300005343 Bacteria 1552
33 Ga0070687_100157357 3300005343 Bacteria 1340
34 Ga0070661_100035322 3300005344 Bacteria 3629
35 Ga0070692_10001530 3300005345 Bacteria 8483
36 Ga0070692_10086873 3300005345 Bacteria 1693
37 Ga0070668_100182137 3300005347 Bacteria 1717
38 Ga0070668_100289258 3300005347 Bacteria 1371
39 Ga0070669_100537945 3300005353 Bacteria 973
40 Ga0070675_100007587 3300005354 Bacteria 8393
41 Ga0070675_100628672 3300005354 Bacteria 975
42 Ga0070675_102039187 3300005354 Bacteria 529
43 Ga0070671_100001239 3300005355 Bacteria 19127
44 Ga0070674_101850268 3300005356 Bacteria 548
45 Ga0070673_100011154 3300005364 Bacteria 6126
46 Ga0070673_101346411 3300005364 Bacteria 671
47 Ga0070688_100454041 3300005365 Bacteria 959
48 Ga0070688_100856366 3300005365 Bacteria 714
49 Ga0070659_100018000 3300005366 Bacteria 5326
50 Ga0070659_100346032 3300005366 Bacteria 1246
51 Ga0070659_101874059 3300005366 Bacteria 538
52 Ga0070667_100763446 3300005367 Bacteria 897
53 Ga0070703_10501505 3300005406 Bacteria 546
54 Ga0070714_100202737 3300005435 Bacteria 1815
55 Ga0070714_100522441 3300005435 Bacteria 1134
56 Ga0070714_100596021 3300005435 Bacteria 1061
57 Ga0070713_100001911 3300005436 Bacteria 13431
58 Ga0070713_100321982 3300005436 Bacteria 1428
59 Ga0070713_100415128 3300005436 Bacteria 1259
60 Ga0070701_10320278 3300005438 Bacteria 959
61 Ga0070711_100024211 3300005439 Bacteria 3957
62 Ga0070705_100399688 3300005440 Bacteria 1017
63 Ga0070700_100008017 3300005441 Bacteria 5739
64 Ga0070700_100134423 3300005441 Bacteria 1673
65 Ga0070694_100233033 3300005444 Bacteria 1386
66 Ga0070708_100017414 3300005445 Bacteria 5992
67 Ga0070663_100006728 3300005455 Bacteria 6939
68 Ga0070663_102046374 3300005455 Bacteria 516
69 Ga0070678_100000284 3300005456 Bacteria 23487
70 Ga0070662_101008722 3300005457 Bacteria 713
71 Ga0070681_10012576 3300005458 Bacteria 8398
72 Ga0068867_100323831 3300005459 Bacteria 1278
73 Ga0070685_10001974 3300005466 Bacteria 10654
74 Ga0070685_10054368 3300005466 Bacteria 2322
75 Ga0070706_100777224 3300005467 Bacteria 887
76 Ga0070707_101738722 3300005468 Bacteria 591
77 Ga0070698_100507772 3300005471 Bacteria 1144
78 Ga0070699_100772411 3300005518 Bacteria 879
79 Ga0070679_100035981 3300005530 Bacteria 4913
80 Ga0070679_100694921 3300005530 Bacteria 960
81 Ga0070684_100068819 3300005535 Bacteria 3112
82 Ga0070684_101043499 3300005535 Bacteria 767
83 Ga0070697_100083939 3300005536 Bacteria 2627
84 Ga0070697_101380019 3300005536 Unclassified 629
85 Ga0068853_100064681 3300005539 Bacteria 3172
86 Ga0070686_100945950 3300005544 Bacteria 704
87 Ga0070696_100463584 3300005546 Bacteria 1002
88 Ga0070693_100001259 3300005547 Bacteria 11472
89 Ga0070693_100167476 3300005547 Bacteria 1405
90 Ga0070693_100916323 3300005547 Unclassified 658
91 Ga0070665_100026252 3300005548 Bacteria 5866
92 Ga0070665_101190600 3300005548 Bacteria 773
93 Ga0068855_100165012 3300005563 Bacteria 2511
94 Ga0068855_101698963 3300005563 Bacteria 644
95 Ga0070664_100045159 3300005564 Bacteria 3721
96 Ga0070664_100061575 3300005564 Bacteria 3199
97 Ga0068857_100052166 3300005577 Bacteria 3629
98 Ga0068857_102501949 3300005577 Bacteria 507
99 Ga0068854_100416678 3300005578 Bacteria 1115
100 Ga0068856_100024336 3300005614 Bacteria 5892
101 Ga0070702_100000924 3300005615 Bacteria 11499
102 Ga0070702_100029132 3300005615 Bacteria 2999
103 Ga0070702_100849819 3300005615 Bacteria 710
104 Ga0070702_101491053 3300005615 Bacteria 556
105 Ga0068852_100040075 3300005616 Bacteria 3949
106 Ga0068852_100147378 3300005616 Bacteria 2185
107 Ga0068859_100458674 3300005617 Bacteria 1370
108 Ga0068859_100492767 3300005617 Bacteria 1321
109 Ga0068864_100019400 3300005618 Bacteria 5686
110 Ga0068864_100302138 3300005618 Bacteria 1498
111 Ga0068864_101268127 3300005618 Bacteria 737
112 Ga0068866_11147674 3300005718 Bacteria 559
113 Ga0068861_100118006 3300005719 Bacteria 2136
114 Ga0068861_100230361 3300005719 Bacteria 1571
115 Ga0068851_10001198 3300005834 Bacteria 11255
116 Ga0068851_10185921 3300005834 Bacteria 1153
117 Ga0068870_10000578 3300005840 Bacteria 13919
118 Ga0068870_10047316 3300005840 Bacteria 2261
119 Ga0068863_100009173 3300005841 Bacteria 9651
120 Ga0068858_100010797 3300005842 Bacteria 8633
121 Ga0068860_100072059 3300005843 Bacteria 3283
122 Ga0068860_100589924 3300005843 Bacteria 1116
123 Ga0068862_100072404 3300005844 Bacteria 2977
124 Ga0081455_10035741 3300005937 Bacteria 4434
125 Ga0081455_10184346 3300005937 Bacteria 1578
126 Ga0081538_10001305 3300005981 Bacteria 25806
127 Ga0081538_10001360 3300005981 Bacteria 25147
128 Ga0081538_10007664 3300005981 Bacteria 9306
129 Ga0081538_10018122 3300005981 Bacteria 5307
130 Ga0081538_10020267 3300005981 Bacteria 4904
131 Ga0081538_10120976 3300005981 Bacteria 1258
132 Ga0070717_10076113 3300006028 Bacteria 2808
133 Ga0075432_10172397 3300006058 Bacteria 842
134 Ga0070715_10169950 3300006163 Bacteria 1085
135 Ga0070716_100498433 3300006173 Bacteria 898
136 Ga0070712_100519363 3300006175 Bacteria 1000
137 Ga0070712_100808267 3300006175 Bacteria 805
138 Ga0070712_101673349 3300006175 Bacteria 557
139 Ga0097621_100125047 3300006237 Bacteria 2184
140 Ga0097621_102072680 3300006237 Bacteria 544
141 Ga0068871_100022033 3300006358 Bacteria 4908
142 Ga0075428_101626477 3300006844 Bacteria 675
143 Ga0075431_100077441 3300006847 Bacteria 3432
144 Ga0075433_10019747 3300006852 Bacteria 5622
145 Ga0075433_10057430 3300006852 Bacteria 3401
146 Ga0075433_10212519 3300006852 Bacteria 1719
147 Ga0075433_10693685 3300006852 Bacteria 892
148 Ga0075434_100002989 3300006871 Bacteria 15046
149 Ga0075434_100560545 3300006871 Bacteria 1162
150 Ga0097620_100458698 3300006931 Bacteria 1370
151 Ga0097620_100492794 3300006931 Bacteria 1321
152 Ga0075435_100009161 3300007076 Bacteria 7146
153 Ga0075435_100302661 3300007076 Bacteria 1368
154 Ga0105251_10026361 3300009011 Bacteria 2959
155 Ga0105240_11994222 3300009093 Bacteria 603
156 Ga0111539_10022517 3300009094 Bacteria 7741
157 Ga0111539_11312878 3300009094 Bacteria 840
158 Ga0111539_11951754 3300009094 Bacteria 681
159 Ga0105245_10024768 3300009098 Bacteria 5272
160 Ga0105245_10025107 3300009098 Bacteria 5240
161 Ga0105245_10101681 3300009098 Bacteria 2661
162 Ga0105245_10360128 3300009098 Bacteria 1443
163 Ga0105247_10003202 3300009101 Bacteria 10788
164 Ga0105247_10228515 3300009101 Bacteria 1262
165 Ga0114129_10180883 3300009147 Bacteria 2869
166 Ga0114129_12001415 3300009147 Bacteria 701
167 Ga0105243_10014190 3300009148 Bacteria 6030
168 Ga0105243_10185576 3300009148 Bacteria 1812
169 Ga0105243_10406433 3300009148 Bacteria 1266
170 Ga0105243_10710135 3300009148 Bacteria 981
171 Ga0105241_10009506 3300009174 Bacteria 7141
172 Ga0105242_10617304 3300009176 Bacteria 1050
173 Ga0105248_10944024 3300009177 Bacteria 974
174 Ga0105237_10256315 3300009545 Bacteria 1751
175 Ga0105237_11222204 3300009545 Bacteria 758
176 Ga0105238_10020821 3300009551 Bacteria 6680
177 Ga0105238_11632977 3300009551 Bacteria 675
178 Ga0105249_10118068 3300009553 Bacteria 2517
179 Ga0105239_10018752 3300010375 Bacteria 7642
180 Ga0105239_10083505 3300010375 Bacteria 3518
181 Ga0105239_10429980 3300010375 Bacteria 1496
182 Ga0105246_10058511 3300011119 Bacteria 2670
183 Ga0157320_1030967 3300012481 Bacteria 540
184 Ga0157373_10159141 3300013100 Bacteria 1589
185 Ga0157371_10017978 3300013102 Bacteria 5238
186 Ga0157371_10277553 3300013102 Bacteria 1210
187 Ga0157371_11031752 3300013102 Bacteria 628
188 Ga0157370_10016188 3300013104 Bacteria 7558
189 Ga0157369_10097371 3300013105 Bacteria 3138
190 Ga0157374_10012814 3300013296 Bacteria 7302
191 Ga0157374_10016335 3300013296 Bacteria 6521
192 Ga0157378_10462771 3300013297 Bacteria 1261
193 Ga0163162_10304217 3300013306 Bacteria 1727
194 Ga0157372_10024059 3300013307 Bacteria 6608
195 Ga0157372_10090827 3300013307 Bacteria 3473
196 Ga0157372_11212043 3300013307 Bacteria 872
197 Ga0157375_10105820 3300013308 Bacteria 2905
198 Ga0157375_10938316 3300013308 Bacteria 1008
199 Ga0157375_12004415 3300013308 Bacteria 688
200 Ga0157375_12169101 3300013308 Bacteria 662
201 Ga0163163_10064479 3300014325 Bacteria 3635
202 Ga0163163_10824287 3300014325 Bacteria 991
203 Ga0157380_10115956 3300014326 Bacteria 2260
204 Ga0157380_12998324 3300014326 Bacteria 538
205 Ga0157377_10023817 3300014745 Bacteria 3249
206 Ga0157379_10127734 3300014968 Bacteria 2288
207 Ga0157376_10027298 3300014969 Bacteria 4523
208 Ga0206353_10774369 3300020082 Bacteria 2787
209 Ga0213876_10042742 3300021384 Bacteria 2394
210 Ga0213876_10104713 3300021384 Bacteria 1501
211 Ga0213876_10122782 3300021384 Bacteria 1379
212 Ga0213876_10259051 3300021384 Bacteria 924
213 Ga0213875_10015624 3300021388 Bacteria 3693
214 Ga0213875_10022579 3300021388 Bacteria 3009
215 Ga0213875_10149560 3300021388 Bacteria 1094
216 Ga0207656_10014151 3300025321 Bacteria 3068
217 Ga0207656_10067520 3300025321 Bacteria 1583
218 Ga0207692_10142006 3300025898 Bacteria 1366
219 Ga0207642_10093208 3300025899 Bacteria 1493
220 Ga0207642_10217037 3300025899 Bacteria 1067
221 Ga0207710_10023238 3300025900 Bacteria 2664
222 Ga0207710_10248629 3300025900 Bacteria 889
223 Ga0207688_10020264 3300025901 Bacteria 3630
224 Ga0207688_10095264 3300025901 Bacteria 1713
225 Ga0207688_10196057 3300025901 Bacteria 1209
226 Ga0207647_10253993 3300025904 Bacteria 1008
227 Ga0207647_10436998 3300025904 Bacteria 734
228 Ga0207685_10159191 3300025905 Bacteria 1029
229 Ga0207645_10014932 3300025907 Bacteria 5178
230 Ga0207645_10091094 3300025907 Bacteria 1961
231 Ga0207645_10485213 3300025907 Bacteria 836
232 Ga0207643_10000272 3300025908 Bacteria 36101
233 Ga0207643_10052322 3300025908 Bacteria 2319
234 Ga0207705_10011081 3300025909 Bacteria 6537
235 Ga0207654_10002252 3300025911 Bacteria 9892
236 Ga0207654_10292529 3300025911 Bacteria 1105
237 Ga0207707_10023252 3300025912 Bacteria 5422
238 Ga0207671_10161362 3300025914 Bacteria 1736
239 Ga0207671_10870701 3300025914 Bacteria 713
240 Ga0207693_10027599 3300025915 Bacteria 4488
241 Ga0207693_10385262 3300025915 Bacteria 1096
242 Ga0207663_10064465 3300025916 Bacteria 2338
243 Ga0207660_10020835 3300025917 Bacteria 4406
244 Ga0207660_10908294 3300025917 Bacteria 719
245 Ga0207662_10056392 3300025918 Bacteria 2346
246 Ga0207662_10177896 3300025918 Bacteria 1368
247 Ga0207657_10053610 3300025919 Bacteria 3493
248 Ga0207649_10002301 3300025920 Bacteria 10749
249 Ga0207652_10007540 3300025921 Bacteria 8761
250 Ga0207652_10583717 3300025921 Bacteria 1003
251 Ga0207646_11498292 3300025922 Bacteria 584
252 Ga0207694_10029785 3300025924 Bacteria 4167
253 Ga0207694_11100917 3300025924 Bacteria 672
254 Ga0207650_10002878 3300025925 Bacteria 11886
255 Ga0207659_10019308 3300025926 Bacteria 4484
256 Ga0207659_10350511 3300025926 Bacteria 1225
257 Ga0207687_10003649 3300025927 Bacteria 10373
258 Ga0207687_10043841 3300025927 Bacteria 3084
259 Ga0207687_10075475 3300025927 Bacteria 2420
260 Ga0207687_10089947 3300025927 Bacteria 2236
261 Ga0207700_10014253 3300025928 Bacteria 5203
262 Ga0207700_10377775 3300025928 Bacteria 1239
263 Ga0207664_10186319 3300025929 Bacteria 1784
264 Ga0207664_10630593 3300025929 Bacteria 963
265 Ga0207644_10010629 3300025931 Bacteria 6069
266 Ga0207690_10037301 3300025932 Bacteria 3155
267 Ga0207690_10056855 3300025932 Bacteria 2641
268 Ga0207690_10141674 3300025932 Bacteria 1772
269 Ga0207690_11167692 3300025932 Bacteria 642
270 Ga0207706_10268472 3300025933 Bacteria 1489
271 Ga0207706_11022087 3300025933 Bacteria 694
272 Ga0207686_10126461 3300025934 Bacteria 1747
273 Ga0207686_11659719 3300025934 Bacteria 528
274 Ga0207709_10128043 3300025935 Bacteria 1725
275 Ga0207709_10297064 3300025935 Bacteria 1200
276 Ga0207709_10683470 3300025935 Bacteria 820
277 Ga0207709_11125826 3300025935 Bacteria 645
278 Ga0207670_10052459 3300025936 Bacteria 2742
279 Ga0207669_10636091 3300025937 Bacteria 871
280 Ga0207704_10016326 3300025938 Bacteria 3813
281 Ga0207704_10681120 3300025938 Bacteria 849
282 Ga0207711_10797903 3300025941 Bacteria 879
283 Ga0207689_10002086 3300025942 Bacteria 18860
284 Ga0207689_10044614 3300025942 Bacteria 3666
285 Ga0207661_10002245 3300025944 Bacteria 13325
286 Ga0207661_10202173 3300025944 Bacteria 1747
287 Ga0207679_10004458 3300025945 Bacteria 8725
288 Ga0207679_10092063 3300025945 Bacteria 2348
289 Ga0207667_10630136 3300025949 Bacteria 1079
290 Ga0207667_11822749 3300025949 Bacteria 572
291 Ga0207651_10009026 3300025960 Bacteria 5424
292 Ga0207712_10025284 3300025961 Bacteria 3945
293 Ga0207712_10045297 3300025961 Bacteria 3045
294 Ga0207668_10561223 3300025972 Bacteria 990
295 Ga0207640_10103773 3300025981 Bacteria 1999
296 Ga0207640_10577606 3300025981 Bacteria 948
297 Ga0207658_11715133 3300025986 Bacteria 574
298 Ga0207677_10003714 3300026023 Bacteria 8096
299 Ga0207677_10090809 3300026023 Bacteria 2220
300 Ga0207677_10182749 3300026023 Bacteria 1651
301 Ga0207677_10215553 3300026023 Bacteria 1536
302 Ga0207677_12256060 3300026023 Bacteria 507
303 Ga0207703_10011748 3300026035 Bacteria 6815
304 Ga0207703_12035647 3300026035 Bacteria 550
305 Ga0207639_10740952 3300026041 Bacteria 913
306 Ga0207678_10000085 3300026067 Bacteria 76854
307 Ga0207678_11655683 3300026067 Bacteria 563
308 Ga0207708_10046955 3300026075 Bacteria 3289
309 Ga0207708_10267612 3300026075 Bacteria 1381
310 Ga0207702_10006505 3300026078 Bacteria 10061
311 Ga0207702_10082471 3300026078 Bacteria 2796
312 Ga0207702_11376350 3300026078 Bacteria 699
313 Ga0207641_10008643 3300026088 Bacteria 8407
314 Ga0207641_10254093 3300026088 Bacteria 1643
315 Ga0207648_10167302 3300026089 Bacteria 1943
316 Ga0207676_10002081 3300026095 Bacteria 14519
317 Ga0207676_12602164 3300026095 Bacteria 502
318 Ga0207674_10026781 3300026116 Bacteria 6116
319 Ga0207675_100053524 3300026118 Bacteria 3766
320 Ga0207675_100201061 3300026118 Bacteria 1914
321 Ga0207683_10000055 3300026121 Bacteria 84901
322 Ga0207683_11136809 3300026121 Bacteria 724
323 Ga0207698_10005428 3300026142 Bacteria 7881
324 Ga0207698_10667466 3300026142 Bacteria 1031
325 Ga0207428_10006161 3300027907 Bacteria 11079
326 Ga0268266_10052371 3300028379 Bacteria 3505
327 Ga0268265_10202678 3300028380 Bacteria 1722
328 Ga0268265_10494594 3300028380 Bacteria 1151
329 Ga0268264_10060011 3300028381 Bacteria 3188
330 Ga0265336_10007800 3300028666 Bacteria 3791
331 Ga0265338_10009613 3300028800 Bacteria 11488
332 Ga0265327_10004248 3300031251 Bacteria 12846
333 Ga0307513_10326354 3300031456 Bacteria 1291
334 Ga0307410_10591201 3300031852 Bacteria 925
335 Ga0307410_11403312 3300031852 Bacteria 613
336 Ga0307410_11700612 3300031852 Bacteria 559
337 Ga0307409_100261623 3300031995 Bacteria 1588
338 Ga0307409_102464850 3300031995 Bacteria 549
339 Ga0307416_100473381 3300032002 Bacteria 1311
340 Ga0307414_10423160 3300032004 Bacteria 1162
341 Ga0307414_10554486 3300032004 Bacteria 1025
342 Ga0307414_11061534 3300032004 Bacteria 747
343 Ga0307411_10463756 3300032005 Bacteria 1063
344 Ga0307411_11381063 3300032005 Bacteria 644
345 Ga0307415_100316915 3300032126 Bacteria 1299
346 Ga0307415_100532640 3300032126 Bacteria 1033
347 Ga0307510_10084238 3300033180 Bacteria 3063
348 Ga0373941_0310833 3300035115 Bacteria 632
349 Ga0373960_0388697 3300035121 Bacteria 536
350 Ga0373937_0116896 3300036401 Bacteria 2484
351 Ga0395899_0014561 3300037312 Bacteria 6004
352 Ga0395899_0037756 3300037312 Bacteria 3620
353 Ga0395899_0151525 3300037312 Bacteria 1643
354 Ga0395900_0020602 3300037418 Bacteria 6736
355 Ga0395900_0026932 3300037418 Bacteria 5884
356 Ga0395900_0037451 3300037418 Bacteria 5001
357 Ga0395898_0001256 3300037466 Bacteria 37705
358 Ga0395898_0003859 3300037466 Bacteria 16582
359 Ga0395898_0008475 3300037466 Bacteria 10863
360 Ga0395898_1088555 3300037466 Bacteria 733
361 Ga0395905_0004823 3300037471 Bacteria 13911
362 Ga0395905_0038277 3300037471 Bacteria 4500
363 Ga0436364_0029551 3300037853 Unclassified 947
364 Ga0436364_0155463 3300037853 Bacteria 10370
365 Ga0436364_0168935 3300037853 Bacteria 2685
366 Ga0436364_0312041 3300037853 Bacteria 14073
367 Ga0436364_0434252 3300037853 Bacteria 1512
368 Ga0436364_0736840 3300037853 Bacteria 768
369 Ga0436364_1391322 3300037853 Bacteria 4725
370 Ga0395901_0011189 3300038443 Bacteria 9094
371 Ga0395901_0028945 3300038443 Bacteria 5700
372 Ga0395901_0181039 3300038443 Bacteria 2210
373 Ga0395901_0472533 3300038443 Bacteria 1280
374 Ga0395901_1282521 3300038443 Bacteria 695
375 Ga0436365_0178005 3300039437 Bacteria 3232
376 Ga0436365_0231390 3300039437 Bacteria 14465
377 Ga0436365_1279369 3300039437 Bacteria 6001
378 Ga0436365_1707471 3300039437 Bacteria 3760
379 Ga0436360_0373500 3300039438 Bacteria 2184
380 Ga0436363_1195057 3300039450 Bacteria 647
381 Ga0436362_0063717 3300039453 Bacteria 761
382 Ga0436362_0980423 3300039453 Bacteria 1467
383 Ga0451853_1172090 3300041512 Bacteria 656
384 Ga0466972_0620645 3300044658 Bacteria 512
385 Ga0466965_0601145 3300044683 Bacteria 625
386 Ga0466966_0106424 3300044684 Bacteria 1731
387 Ga0466961_0177539 3300044693 Bacteria 1323
388 Ga0466961_0196921 3300044693 Unclassified 1247
389 Ga0466961_0262859 3300044693 Bacteria 1058
390 Ga0466961_0270092 3300044693 Bacteria 1042
391 Ga0466961_0624983 3300044693 Bacteria 647
392 Ga0466963_0029024 3300044694 Bacteria 3557
393 Ga0466963_0382640 3300044694 Bacteria 992
394 Ga0466963_0525829 3300044694 Unclassified 835
395 Ga0466963_0938933 3300044694 Bacteria 609
396 Ga0466963_1059060 3300044694 Bacteria 571
397 Ga0466964_0440814 3300044706 Bacteria 689
398 Ga0466964_0541892 3300044706 Bacteria 631
399 Ga0466971_0033885 3300044719 Bacteria 2288
400 Ga0466971_0264035 3300044719 Bacteria 822
401 Ga0466971_0622109 3300044719 Bacteria 539
402 Ga0466968_0423065 3300044735 Bacteria 655
403 Ga0466970_0440948 3300044765 Bacteria 746
404 Ga0466957_0407255 3300044842 Bacteria 931
405 Ga0466957_0442132 3300044842 Bacteria 895
406 Ga0466957_0702562 3300044842 Unclassified 714
407 Ga0466957_1250332 3300044842 Bacteria 538
408 Ga0466960_0132300 3300044901 Bacteria 1318
409 Ga0466960_0291477 3300044901 Bacteria 917
410 Ga0466960_0543173 3300044901 Unclassified 685
411 Ga0466960_0654282 3300044901 Bacteria 627
412 Ga0466960_1059470 3300044901 Bacteria 500
413 Ga0466959_0117301 3300045049 Bacteria 1895
414 Ga0466959_0150928 3300045049 Bacteria 1638
415 Ga0466959_0282744 3300045049 Bacteria 1138
416 Ga0466959_0369608 3300045049 Bacteria 977
417 Ga0466959_0821079 3300045049 Unclassified 621
418 Ga0466959_1045000 3300045049 Bacteria 544
419 Ga0466958_0448707 3300045836 Unclassified 835
420 Ga0466958_0579715 3300045836 Bacteria 729
421 Ga0466958_0585970 3300045836 Bacteria 725
422 Ga0466958_0637524 3300045836 Bacteria 693
423 Ga0466958_0889822 3300045836 Bacteria 581
424 Ga0466967_0006410 3300045976 Bacteria 8321
425 Ga0466967_0076177 3300045976 Bacteria 3017
426 Ga0466967_0083042 3300045976 Bacteria 2896
427 Ga0466967_0134845 3300045976 Bacteria 2295
428 Ga0466967_0295016 3300045976 Bacteria 1558
429 Ga0466967_0310048 3300045976 Bacteria 1520
430 Ga0466967_0392244 3300045976 Bacteria 1349
431 Ga0466967_0656701 3300045976 Bacteria 1037
432 Ga0466967_0820983 3300045976 Bacteria 923
433 Ga0466967_0868939 3300045976 Bacteria 896
434 Ga0466967_0927457 3300045976 Bacteria 866
435 Ga0466967_1020831 3300045976 Bacteria 824
436 Ga0466967_1108063 3300045976 Bacteria 789
437 Ga0466967_1222891 3300045976 Bacteria 748
438 Ga0466967_1672218 3300045976 Bacteria 634
439 Ga0466967_1713435 3300045976 Bacteria 626
440 Ga0466967_2120286 3300045976 Bacteria 558
441 Ga0496100_0073274 3300048903 Bacteria 2291
442 Ga0496100_1037012 3300048903 Unclassified 646
443 Ga0496102_0003188 3300048905 Bacteria 13910
444 Ga0496102_0256768 3300048905 Bacteria 1648
445 Ga0496102_0847240 3300048905 Bacteria 836
446 Ga0496103_0323736 3300048906 Bacteria 991
447 Ga0496104_0005482 3300048907 Bacteria 11113
448 Ga0496104_0010009 3300048907 Bacteria 8462
449 Ga0496104_1038317 3300048907 Bacteria 723
450 Ga0496105_0003071 3300048908 Bacteria 12272
451 Ga0496105_0106234 3300048908 Unclassified 2318
452 Ga0496106_0007406 3300048909 Bacteria 8110
453 Ga0496106_0250042 3300048909 Bacteria 1417
454 Ga0496106_0279476 3300048909 Bacteria 1337
455 Ga0496107_0058000 3300048910 Bacteria 2799
456 Ga0496107_0380986 3300048910 Bacteria 1049
457 Ga0496108_0021882 3300048911 Bacteria 5256
458 Ga0496108_0398672 3300048911 Bacteria 1202
459 Ga0496108_1078148 3300048911 Bacteria 683
460 Ga0496109_0000874 3300048912 Bacteria 25072
461 Ga0496109_0236475 3300048912 Bacteria 1719
462 Ga0496109_0883860 3300048912 Bacteria 831
463 Ga0496110_0002082 3300048913 Bacteria 14915
464 Ga0496111_0011347 3300048914 Bacteria 5999
465 Ga0496111_0788900 3300048914 Bacteria 688
466 Ga0496112_0015411 3300048915 Bacteria 7133
467 Ga0496112_0015799 3300048915 Bacteria 7053
468 Ga0496112_1004667 3300048915 Bacteria 754
469 Ga0496112_1048123 3300048915 Bacteria 734
470 Ga0496113_0008068 3300048916 Bacteria 6833
471 Ga0496113_0032031 3300048916 Bacteria 3819
472 Ga0496113_0623893 3300048916 Bacteria 863
473 Ga0496113_0768521 3300048916 Bacteria 766
474 Ga0496113_1312352 3300048916 Bacteria 562
475 Ga0496114_0271521 3300048917 Bacteria 1494
476 Ga0496115_0120468 3300048918 Bacteria 2159
477 Ga0496126_0003394 3300048929 Bacteria 20156
478 Ga0501047_0179218 3300049581 Bacteria 1985
479 Ga0501067_0004085 3300049583 Bacteria 8049
480 Ga0501067_0133705 3300049583 Bacteria 1381
481 Ga0501067_0272374 3300049583 Bacteria 943
482 Ga0501069_0090722 3300049585 Bacteria 1728
483 Ga0501069_0233013 3300049585 Bacteria 1072
484 Ga0501070_0028815 3300049586 Bacteria 4655
485 Ga0501073_0560848 3300049589 Bacteria 789
486 Ga0501074_0032270 3300049590 Bacteria 3794
487 Ga0501074_0130382 3300049590 Bacteria 1799
488 Ga0501079_0266823 3300049741 Bacteria 1338
489 Ga0501080_0146762 3300049742 Bacteria 2181
490 Ga0501080_0848042 3300049742 Bacteria 799
491 Ga0501080_1595468 3300049742 Bacteria 553
492 Ga0501081_0511017 3300049743 Bacteria 896
493 Ga0501083_0218238 3300049744 Bacteria 1243
494 Ga0501035_1013364 3300049822 Bacteria 652
495 Ga0501044_0500960 3300049823 Bacteria 1116
496 Ga0501044_0900266 3300049823 Bacteria 760
497 nmdc:mga05p37_734501_c1 3300050507 Bacteria 1091
498 nmdc:mga06r32_151956_c1 3300050510 Bacteria 2294
499 nmdc:mga08y16_295819_c1 3300050511 Bacteria 1669
500 nmdc:mga08y16_4615_c1 3300050511 Bacteria 14360
501 nmdc:mga0n895_1101636_c1 3300050512 Bacteria 771
502 nmdc:mga0n895_11041_c1 3300050512 Bacteria 8032
503 nmdc:mga0n895_513092_c1 3300050512 Bacteria 1207
504 nmdc:mga0rr50_22357_c1 3300050513 Bacteria 4339
505 nmdc:mga0rr50_293078_c1 3300050513 Bacteria 1360
506 nmdc:mga0rr50_896_c1 3300050513 Bacteria 16106
507 nmdc:mga08x19_608478_c1 3300050514 Bacteria 774
508 nmdc:mga0a205_4848_c2 3300050515 Bacteria 6564
509 nmdc:mga0a205_547582_c1 3300050515 Bacteria 1012
510 nmdc:mga0a205_854321_c1 3300050515 Bacteria 757
511 Ga0495655_0223055 3300053083 Bacteria 625
512 Ga0495595_0379025 3300053084 Bacteria 716
513 Ga0466962_0035112 3300061719 Bacteria 2400
514 Ga0466962_0123570 3300061719 Bacteria 1249
515 Ga0466962_0196895 3300061719 Bacteria 984
516 Ga0466962_0218198 3300061719 Bacteria 934
517 2738668988 2738541264 Bacteria 5935393
518 2739148068 2738541356 Bacteria 5935017
519 Ga0436365_1209553
520 JGI24752J21851_1005692
521 JGI24747J21853_1045228
522 JGI24735J21928_10091215
523 JGI24033J26618_1036843
524 JGI25407J50210_10034925
525 JGI25407J50210_10130419
526 JGI25407J50210_10159846
527 Ga0070658_10060835
528 Ga0070676_10011903
529 Ga0070683_100079985
530 Ga0070683_100199806
531 Ga0070683_100665309
532 Ga0070690_101236004
533 Ga0070670_100033361
534 Ga0068869_100009598
535 Ga0068869_100846272
536 Ga0070666_10081036
537 Ga0070680_100061579
538 Ga0070680_101637500
539 Ga0070682_100001638
540 Ga0070682_100095442
541 Ga0070682_101359794
542 Ga0068868_100012346
543 Ga0068868_100020941
544 Ga0068868_100138194
545 Ga0068868_100170456
546 Ga0068868_101933475
547 Ga0070660_100172688
548 Ga0070691_10008218
549 Ga0070691_10644531
550 Ga0070687_100111022
551 Ga0070687_100157357
552 Ga0070661_100035322
553 Ga0070692_10001530
554 Ga0070692_10086873
555 Ga0070668_100182137
556 Ga0070668_100289258
557 Ga0070669_100537945
558 Ga0070675_100007587
559 Ga0070675_100628672
560 Ga0070675_102039187
561 Ga0070671_100001239
562 Ga0070674_101850268
563 Ga0070673_100011154
564 Ga0070673_101346411
565 Ga0070688_100454041
566 Ga0070688_100856366
567 Ga0070659_100018000
568 Ga0070659_100346032
569 Ga0070659_101874059
570 Ga0070667_100763446
571 Ga0070703_10501505
572 Ga0070714_100202737
573 Ga0070714_100522441
574 Ga0070714_100596021
575 Ga0070713_100001911
576 Ga0070713_100321982
577 Ga0070713_100415128
578 Ga0070701_10320278
579 Ga0070711_100024211
580 Ga0070705_100399688
581 Ga0070700_100008017
582 Ga0070700_100134423
583 Ga0070694_100233033
584 Ga0070708_100017414
585 Ga0070663_100006728
586 Ga0070663_102046374
587 Ga0070678_100000284
588 Ga0070662_101008722
589 Ga0070681_10012576
590 Ga0068867_100323831
591 Ga0070685_10001974
592 Ga0070685_10054368
593 Ga0070706_100777224
594 Ga0070707_101738722
595 Ga0070698_100507772
596 Ga0070699_100772411
597 Ga0070679_100035981
598 Ga0070679_100694921
599 Ga0070684_100068819
600 Ga0070684_101043499
601 Ga0070697_100083939
602 Ga0070697_101380019
603 Ga0068853_100064681
604 Ga0070686_100945950
605 Ga0070696_100463584
606 Ga0070693_100001259
607 Ga0070693_100167476
608 Ga0070693_100916323
609 Ga0070665_100026252
610 Ga0070665_101190600
611 Ga0068855_100165012
612 Ga0068855_101698963
613 Ga0070664_100045159
614 Ga0070664_100061575
615 Ga0068857_100052166
616 Ga0068857_102501949
617 Ga0068854_100416678
618 Ga0068856_100024336
619 Ga0070702_100000924
620 Ga0070702_100029132
621 Ga0070702_100849819
622 Ga0070702_101491053
623 Ga0068852_100040075
624 Ga0068852_100147378
625 Ga0068859_100458674
626 Ga0068859_100492767
627 Ga0068864_100019400
628 Ga0068864_100302138
629 Ga0068864_101268127
630 Ga0068866_11147674
631 Ga0068861_100118006
632 Ga0068861_100230361
633 Ga0068851_10001198
634 Ga0068851_10185921
635 Ga0068870_10000578
636 Ga0068870_10047316
637 Ga0068863_100009173
638 Ga0068858_100010797
639 Ga0068860_100072059
640 Ga0068860_100589924
641 Ga0068862_100072404
642 Ga0081455_10035741
643 Ga0081455_10184346
644 Ga0081538_10001305
645 Ga0081538_10001360
646 Ga0081538_10007664
647 Ga0081538_10018122
648 Ga0081538_10020267
649 Ga0081538_10120976
650 Ga0070717_10076113
651 Ga0075432_10172397
652 Ga0070715_10169950
653 Ga0070716_100498433
654 Ga0070712_100519363
655 Ga0070712_100808267
656 Ga0070712_101673349
657 Ga0097621_100125047
658 Ga0097621_102072680
659 Ga0068871_100022033
660 Ga0075428_101626477
661 Ga0075431_100077441
662 Ga0075433_10019747
663 Ga0075433_10057430
664 Ga0075433_10212519
665 Ga0075433_10693685
666 Ga0075434_100002989
667 Ga0075434_100560545
668 Ga0097620_100458698
669 Ga0097620_100492794
670 Ga0075435_100009161
671 Ga0075435_100302661
672 Ga0105251_10026361
673 Ga0105240_11994222
674 Ga0111539_10022517
675 Ga0111539_11312878
676 Ga0111539_11951754
677 Ga0105245_10024768
678 Ga0105245_10025107
679 Ga0105245_10101681
680 Ga0105245_10360128
681 Ga0105247_10003202
682 Ga0105247_10228515
683 Ga0114129_10180883
684 Ga0114129_12001415
685 Ga0105243_10014190
686 Ga0105243_10185576
687 Ga0105243_10406433
688 Ga0105243_10710135
689 Ga0105241_10009506
690 Ga0105242_10617304
691 Ga0105248_10944024
692 Ga0105237_10256315
693 Ga0105237_11222204
694 Ga0105238_10020821
695 Ga0105238_11632977
696 Ga0105249_10118068
697 Ga0105239_10018752
698 Ga0105239_10083505
699 Ga0105239_10429980
700 Ga0105246_10058511
701 Ga0157320_1030967
702 Ga0157373_10159141
703 Ga0157371_10017978
704 Ga0157371_10277553
705 Ga0157371_11031752
706 Ga0157370_10016188
707 Ga0157369_10097371
708 Ga0157374_10012814
709 Ga0157374_10016335
710 Ga0157378_10462771
711 Ga0163162_10304217
712 Ga0157372_10024059
713 Ga0157372_10090827
714 Ga0157372_11212043
715 Ga0157375_10105820
716 Ga0157375_10938316
717 Ga0157375_12004415
718 Ga0157375_12169101
719 Ga0163163_10064479
720 Ga0163163_10824287
721 Ga0157380_10115956
722 Ga0157380_12998324
723 Ga0157377_10023817
724 Ga0157379_10127734
725 Ga0157376_10027298
726 Ga0206353_10774369
727 Ga0213876_10042742
728 Ga0213876_10104713
729 Ga0213876_10122782
730 Ga0213876_10259051
731 Ga0213875_10015624
732 Ga0213875_10022579
733 Ga0213875_10149560
734 Ga0207656_10014151
735 Ga0207656_10067520
736 Ga0207692_10142006
737 Ga0207642_10093208
738 Ga0207642_10217037
739 Ga0207710_10023238
740 Ga0207710_10248629
741 Ga0207688_10020264
742 Ga0207688_10095264
743 Ga0207688_10196057
744 Ga0207647_10253993
745 Ga0207647_10436998
746 Ga0207685_10159191
747 Ga0207645_10014932
748 Ga0207645_10091094
749 Ga0207645_10485213
750 Ga0207643_10000272
751 Ga0207643_10052322
752 Ga0207705_10011081
753 Ga0207654_10002252
754 Ga0207654_10292529
755 Ga0207707_10023252
756 Ga0207671_10161362
757 Ga0207671_10870701
758 Ga0207693_10027599
759 Ga0207693_10385262
760 Ga0207663_10064465
761 Ga0207660_10020835
762 Ga0207660_10908294
763 Ga0207662_10056392
764 Ga0207662_10177896
765 Ga0207657_10053610
766 Ga0207649_10002301
767 Ga0207652_10007540
768 Ga0207652_10583717
769 Ga0207646_11498292
770 Ga0207694_10029785
771 Ga0207694_11100917
772 Ga0207650_10002878
773 Ga0207659_10019308
774 Ga0207659_10350511
775 Ga0207687_10003649
776 Ga0207687_10043841
777 Ga0207687_10075475
778 Ga0207687_10089947
779 Ga0207700_10014253
780 Ga0207700_10377775
781 Ga0207664_10186319
782 Ga0207664_10630593
783 Ga0207644_10010629
784 Ga0207690_10037301
785 Ga0207690_10056855
786 Ga0207690_10141674
787 Ga0207690_11167692
788 Ga0207706_10268472
789 Ga0207706_11022087
790 Ga0207686_10126461
791 Ga0207686_11659719
792 Ga0207709_10128043
793 Ga0207709_10297064
794 Ga0207709_10683470
795 Ga0207709_11125826
796 Ga0207670_10052459
797 Ga0207669_10636091
798 Ga0207704_10016326
799 Ga0207704_10681120
800 Ga0207711_10797903
801 Ga0207689_10002086
802 Ga0207689_10044614
803 Ga0207661_10002245
804 Ga0207661_10202173
805 Ga0207679_10004458
806 Ga0207679_10092063
807 Ga0207667_10630136
808 Ga0207667_11822749
809 Ga0207651_10009026
810 Ga0207712_10025284
811 Ga0207712_10045297
812 Ga0207668_10561223
813 Ga0207640_10103773
814 Ga0207640_10577606
815 Ga0207658_11715133
816 Ga0207677_10003714
817 Ga0207677_10090809
818 Ga0207677_10182749
819 Ga0207677_10215553
820 Ga0207677_12256060
821 Ga0207703_10011748
822 Ga0207703_12035647
823 Ga0207639_10740952
824 Ga0207678_10000085
825 Ga0207678_11655683
826 Ga0207708_10046955
827 Ga0207708_10267612
828 Ga0207702_10006505
829 Ga0207702_10082471
830 Ga0207702_11376350
831 Ga0207641_10008643
832 Ga0207641_10254093
833 Ga0207648_10167302
834 Ga0207676_10002081
835 Ga0207676_12602164
836 Ga0207674_10026781
837 Ga0207675_100053524
838 Ga0207675_100201061
839 Ga0207683_10000055
840 Ga0207683_11136809
841 Ga0207698_10005428
842 Ga0207698_10667466
843 Ga0207428_10006161
844 Ga0268266_10052371
845 Ga0268265_10202678
846 Ga0268265_10494594
847 Ga0268264_10060011
848 Ga0265336_10007800
849 Ga0265338_10009613
850 Ga0265327_10004248
851 Ga0307513_10326354
852 Ga0307410_10591201
853 Ga0307410_11403312
854 Ga0307410_11700612
855 Ga0307409_100261623
856 Ga0307409_102464850
857 Ga0307416_100473381
858 Ga0307414_10423160
859 Ga0307414_10554486
860 Ga0307414_11061534
861 Ga0307411_10463756
862 Ga0307411_11381063
863 Ga0307415_100316915
864 Ga0307415_100532640
865 Ga0307510_10084238
866 Ga0373941_0310833
867 Ga0373960_0388697
868 Ga0373937_0116896
869 Ga0395899_0014561
870 Ga0395899_0037756
871 Ga0395899_0151525
872 Ga0395900_0020602
873 Ga0395900_0026932
874 Ga0395900_0037451
875 Ga0395898_0001256
876 Ga0395898_0003859
877 Ga0395898_0008475
878 Ga0395898_1088555
879 Ga0395905_0004823
880 Ga0395905_0038277
881 Ga0436364_0029551
882 Ga0436364_0155463
883 Ga0436364_0168935
884 Ga0436364_0312041
885 Ga0436364_0434252
886 Ga0436364_0736840
887 Ga0436364_1391322
888 Ga0395901_0011189
889 Ga0395901_0028945
890 Ga0395901_0181039
891 Ga0395901_0472533
892 Ga0395901_1282521
893 Ga0436365_0178005
894 Ga0436365_0231390
895 Ga0436365_1279369
896 Ga0436365_1707471
897 Ga0436360_0373500
898 Ga0436363_1195057
899 Ga0436362_0063717
900 Ga0436362_0980423
901 Ga0451853_1172090
902 Ga0466972_0620645
903 Ga0466965_0601145
904 Ga0466966_0106424
905 Ga0466961_0177539
906 Ga0466961_0196921
907 Ga0466961_0262859
908 Ga0466961_0270092
909 Ga0466961_0624983
910 Ga0466963_0029024
911 Ga0466963_0382640
912 Ga0466963_0525829
913 Ga0466963_0938933
914 Ga0466963_1059060
915 Ga0466964_0440814
916 Ga0466964_0541892
917 Ga0466971_0033885
918 Ga0466971_0264035
919 Ga0466971_0622109
920 Ga0466968_0423065
921 Ga0466970_0440948
922 Ga0466957_0407255
923 Ga0466957_0442132
924 Ga0466957_0702562
925 Ga0466957_1250332
926 Ga0466960_0132300
927 Ga0466960_0291477
928 Ga0466960_0543173
929 Ga0466960_0654282
930 Ga0466960_1059470
931 Ga0466959_0117301
932 Ga0466959_0150928
933 Ga0466959_0282744
934 Ga0466959_0369608
935 Ga0466959_0821079
936 Ga0466959_1045000
937 Ga0466958_0448707
938 Ga0466958_0579715
939 Ga0466958_0585970
940 Ga0466958_0637524
941 Ga0466958_0889822
942 Ga0466967_0006410
943 Ga0466967_0076177
944 Ga0466967_0083042
945 Ga0466967_0134845
946 Ga0466967_0295016
947 Ga0466967_0310048
948 Ga0466967_0392244
949 Ga0466967_0656701
950 Ga0466967_0820983
951 Ga0466967_0868939
952 Ga0466967_0927457
953 Ga0466967_1020831
954 Ga0466967_1108063
955 Ga0466967_1222891
956 Ga0466967_1672218
957 Ga0466967_1713435
958 Ga0466967_2120286
959 Ga0496100_0073274
960 Ga0496100_1037012
961 Ga0496102_0003188
962 Ga0496102_0256768
963 Ga0496102_0847240
964 Ga0496103_0323736
965 Ga0496104_0005482
966 Ga0496104_0010009
967 Ga0496104_1038317
968 Ga0496105_0003071
969 Ga0496105_0106234
970 Ga0496106_0007406
971 Ga0496106_0250042
972 Ga0496106_0279476
973 Ga0496107_0058000
974 Ga0496107_0380986
975 Ga0496108_0021882
976 Ga0496108_0398672
977 Ga0496108_1078148
978 Ga0496109_0000874
979 Ga0496109_0236475
980 Ga0496109_0883860
981 Ga0496110_0002082
982 Ga0496111_0011347
983 Ga0496111_0788900
984 Ga0496112_0015411
985 Ga0496112_0015799
986 Ga0496112_1004667
987 Ga0496112_1048123
988 Ga0496113_0008068
989 Ga0496113_0032031
990 Ga0496113_0623893
991 Ga0496113_0768521
992 Ga0496113_1312352
993 Ga0496114_0271521
994 Ga0496115_0120468
995 Ga0496126_0003394
996 Ga0501047_0179218
997 Ga0501067_0004085
998 Ga0501067_0133705
999 Ga0501067_0272374
1000 Ga0501069_0090722
1001 Ga0501069_0233013
1002 Ga0501070_0028815
1003 Ga0501073_0560848
1004 Ga0501074_0032270
1005 Ga0501074_0130382
1006 Ga0501079_0266823
1007 Ga0501080_0146762
1008 Ga0501080_0848042
1009 Ga0501080_1595468
1010 Ga0501081_0511017
1011 Ga0501083_0218238
1012 Ga0501035_1013364
1013 Ga0501044_0500960
1014 Ga0501044_0900266
1015 nmdc:mga05p37_734501_c1
1016 nmdc:mga06r32_151956_c1
1017 nmdc:mga08y16_295819_c1
1018 nmdc:mga08y16_4615_c1
1019 nmdc:mga0n895_1101636_c1
1020 nmdc:mga0n895_11041_c1
1021 nmdc:mga0n895_513092_c1
1022 nmdc:mga0rr50_22357_c1
1023 nmdc:mga0rr50_293078_c1
1024 nmdc:mga0rr50_896_c1
1025 nmdc:mga08x19_608478_c1
1026 nmdc:mga0a205_4848_c2
1027 nmdc:mga0a205_547582_c1
1028 nmdc:mga0a205_854321_c1
1029 Ga0495655_0223055
1030 Ga0495595_0379025
1031 Ga0466962_0035112
1032 Ga0466962_0123570
1033 Ga0466962_0196895
1034 Ga0466962_0218198
1035 2738668988
1036 2739148068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

18

130

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8945 1 109
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8119 1 109
1mli-assembly1.cif.gz_A crystal structure of muconolactone isomerase at 3.3 angstroms resolution 0.7127 1 115
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6903 1 115
3znu-assembly1.cif.gz_I crystal structure of clcf in crystal form 2 0.6901 1 115
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8945 1 109 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8119 1 109 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6918 1 117 3.30.70.1060
4pcqD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6891 2 107 3.30.70.920
af_P71888_58_138_3.30.70.920 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6846 2 107 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A2V2SL62-F1-model_v4 deleted 0.969 1 112
AF-A0A2V2SL62-F1-model_v4 deleted 0.9606 1 112
AF-A0A6P2C507-F1-model_v4 YciI family protein 0.9506 1 112
AF-A0A6L5G7D1-F1-model_v4 YCII-related domain-containing protein 0.9448 1 112
AF-A0A6L5G7D1-F1-model_v4 YCII-related domain-containing protein 0.9368 1 112

Map