F458264

General Info

Members Datasets Scaffolds Average Seq Length
518 302 487 160

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10046379|Ga0207689_100463795
Length 184
Sequence MDSPKHQLSMTVLMTPDMANFSGNVHGGTILKLLDQVAYACAARYAGRYVVTLSVDQVMFREPIHVGELVTFLASVNHTGTSSMEVGIKVLAEEIRTQRTRHANSCFFTMVAVGDDRKPVAVPPLEPKTADERRRHQMAELRRGLRSDYRARYEALRPQTEGDDGGGPASSGATSRAWIFRGCE

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2547132512 Azospira oryzae 6a3 Isolate Unclassified
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
6 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
7 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
8 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
9 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
10 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
11 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
12 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
13 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
14 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
15 2721755523 Delftia sp. HK171 Isolate Unclassified
16 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
17 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
18 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
19 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
20 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
21 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
22 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
23 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
24 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
25 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
26 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
27 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
28 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
29 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
30 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
33 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
34 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
38 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
39 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
40 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
41 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
42 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
43 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
44 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
45 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
46 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
47 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
48 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
49 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
50 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
51 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
136 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
141 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
198 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
206 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
219 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
220 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
221 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
222 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
223 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
224 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
225 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
226 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
227 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
228 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
231 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
232 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
233 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
234 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
241 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
242 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
250 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
253 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
258 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
279 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
280 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
281 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
287 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
288 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
289 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
290 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
291 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
292 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
293 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
294 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
295 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
296 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
297 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
298 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
299 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
300 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
301 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
302 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.02
Metatranscriptomes 0
Isolates 5.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.2
Nodule 1.35
Rhizoplane 4.63
Rhizosphere 59.46
Stem 0
Stem Tuber 0
Unclassified 12.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013376 3300001979 Bacteria 3062
2 JGI25156J39149_1000175 3300002705 Bacteria 47051
3 JGI25156J39149_1017682 3300002705 Bacteria 1342
4 JGI25154J39366_1003891 3300002738 Bacteria 2901
5 JGI25157J39369_1000029 3300002741 Bacteria 146928
6 JGI25157J39369_1030130 3300002741 Bacteria 620
7 JGI25150J39212_1011329 3300002774 Bacteria 1621
8 JGI25153J46596_10001167 3300003215 Bacteria 15888
9 rootH1_10080354 3300003316 Bacteria 1500
10 rootH2_10050886 3300003320 Bacteria 3952
11 rootH1_10069326 3300003323 Bacteria 5218
12 rootH1_10069327 3300003323 Bacteria 2116
13 rootH1_10146338 3300003323 Bacteria 1916
14 Ga0055539_1000310 3300003752 Bacteria 25571
15 Ga0055539_1001425 3300003752 Bacteria 4480
16 Ga0055533_1000010 3300003756 Bacteria 491196
17 Ga0055533_1002953 3300003756 Bacteria 3647
18 Ga0055525_1000841 3300003759 Bacteria 9168
19 Ga0055525_1001256 3300003759 Bacteria 5371
20 Ga0055535_1000107 3300003761 Bacteria 89840
21 Ga0055529_1000111 3300003763 Bacteria 118734
22 Ga0055526_1003406 3300003771 Bacteria 10118
23 Ga0055524_1000203 3300003775 Bacteria 64635
24 Ga0055524_1001287 3300003775 Bacteria 14709
25 Ga0055534_1039687 3300003784 Bacteria 696
26 Ga0055528_1055169 3300003790 Bacteria 778
27 Ga0055530_10002154 3300003791 Bacteria 13044
28 Ga0055530_10016194 3300003791 Bacteria 2393
29 Ga0055540_1000357 3300003792 Bacteria 38830
30 Ga0055540_1067132 3300003792 Bacteria 706
31 Ga0055531_10020200 3300003794 Bacteria 2649
32 Ga0065165_1004882 3300005262 Bacteria 7926
33 Ga0070658_10360177 3300005327 Bacteria 1245
34 Ga0070658_10949865 3300005327 Bacteria 747
35 Ga0070676_10113727 3300005328 Bacteria 1689
36 Ga0070683_100031612 3300005329 Bacteria 4815
37 Ga0070683_100185442 3300005329 Bacteria 1975
38 Ga0070690_100028351 3300005330 Bacteria 3468
39 Ga0070690_100076543 3300005330 Bacteria 2183
40 Ga0068869_100717182 3300005334 Bacteria 854
41 Ga0070666_10257766 3300005335 Bacteria 1236
42 Ga0070682_100240103 3300005337 Bacteria 1300
43 Ga0068868_100051368 3300005338 Bacteria 3242
44 Ga0070660_100590586 3300005339 Bacteria 928
45 Ga0070661_100000791 3300005344 Bacteria 22707
46 Ga0070661_100652200 3300005344 Bacteria 854
47 Ga0070692_11058285 3300005345 Bacteria 570
48 Ga0070669_100160714 3300005353 Bacteria 1745
49 Ga0070669_100488820 3300005353 Bacteria 1019
50 Ga0070675_100359590 3300005354 Unclassified 1292
51 Ga0070675_100402339 3300005354 Bacteria 1221
52 Ga0070675_101491114 3300005354 Bacteria 624
53 Ga0070671_100440262 3300005355 Bacteria 1117
54 Ga0070671_100697307 3300005355 Bacteria 880
55 Ga0070674_100020018 3300005356 Bacteria 4264
56 Ga0070674_100251433 3300005356 Bacteria 1388
57 Ga0070674_100371407 3300005356 Bacteria 1161
58 Ga0070673_100313794 3300005364 Bacteria 1383
59 Ga0070688_100088709 3300005365 Bacteria 2017
60 Ga0070659_100009555 3300005366 Bacteria 7126
61 Ga0070659_100412922 3300005366 Bacteria 1141
62 Ga0070659_100610760 3300005366 Bacteria 938
63 Ga0070667_100077442 3300005367 Bacteria 2840
64 Ga0070667_100425228 3300005367 Bacteria 1211
65 Ga0070700_100758800 3300005441 Bacteria 777
66 Ga0070678_100123617 3300005456 Bacteria 2045
67 Ga0070662_100025445 3300005457 Bacteria 4087
68 Ga0070662_100148878 3300005457 Bacteria 1820
69 Ga0068867_100015012 3300005459 Bacteria 5492
70 Ga0068867_100142047 3300005459 Bacteria 1878
71 Ga0068867_100532565 3300005459 Bacteria 1015
72 Ga0068867_100792537 3300005459 Bacteria 844
73 Ga0068867_101086486 3300005459 Bacteria 730
74 Ga0070672_100046173 3300005543 Bacteria 3374
75 Ga0070672_100114802 3300005543 Bacteria 2199
76 Ga0070672_100398261 3300005543 Bacteria 1180
77 Ga0070672_100425818 3300005543 Bacteria 1141
78 Ga0070672_100646470 3300005543 Bacteria 923
79 Ga0070672_100860554 3300005543 Bacteria 799
80 Ga0070672_101103592 3300005543 Bacteria 705
81 Ga0070665_100802047 3300005548 Bacteria 955
82 Ga0068855_100052867 3300005563 Bacteria 4780
83 Ga0068855_100170534 3300005563 Bacteria 2465
84 Ga0070664_100000524 3300005564 Bacteria 29185
85 Ga0070664_100005230 3300005564 Bacteria 10411
86 Ga0070664_100024941 3300005564 Bacteria 4955
87 Ga0070664_100253896 3300005564 Bacteria 1581
88 Ga0070664_100336369 3300005564 Unclassified 1370
89 Ga0070664_100765674 3300005564 Bacteria 902
90 Ga0068857_100002542 3300005577 Bacteria 14936
91 Ga0068857_100098356 3300005577 Bacteria 2624
92 Ga0068857_100292624 3300005577 Bacteria 1500
93 Ga0068857_100548702 3300005577 Bacteria 1089
94 Ga0068857_100911846 3300005577 Bacteria 843
95 Ga0068854_100012169 3300005578 Bacteria 5630
96 Ga0068854_100041829 3300005578 Bacteria 3240
97 Ga0068854_100265671 3300005578 Bacteria 1376
98 Ga0068856_100003174 3300005614 Bacteria 16729
99 Ga0068856_100124594 3300005614 Bacteria 2579
100 Ga0068852_100103368 3300005616 Bacteria 2576
101 Ga0068852_100400552 3300005616 Bacteria 1350
102 Ga0068852_101304312 3300005616 Bacteria 748
103 Ga0068859_100004121 3300005617 Bacteria 14826
104 Ga0068859_100324312 3300005617 Bacteria 1634
105 Ga0068864_100008613 3300005618 Bacteria 8417
106 Ga0068864_100772751 3300005618 Unclassified 942
107 Ga0068861_100024717 3300005719 Bacteria 4347
108 Ga0068861_100181271 3300005719 Bacteria 1753
109 Ga0068851_10032475 3300005834 Bacteria 2597
110 Ga0068851_10153541 3300005834 Bacteria 1260
111 Ga0068863_100003333 3300005841 Bacteria 15866
112 Ga0068863_101140764 3300005841 Bacteria 785
113 Ga0068858_100490354 3300005842 Bacteria 1186
114 Ga0068860_100478602 3300005843 Bacteria 1241
115 Ga0075363_100014012 3300006048 Bacteria 3905
116 Ga0075363_100229064 3300006048 Bacteria 1066
117 Ga0075363_100363855 3300006048 Bacteria 846
118 Ga0075364_10124488 3300006051 Bacteria 1727
119 Ga0075364_10237150 3300006051 Bacteria 1239
120 Ga0075362_10016150 3300006177 Bacteria 3052
121 Ga0075362_10126565 3300006177 Bacteria 1212
122 Ga0075362_10130281 3300006177 Bacteria 1196
123 Ga0075362_10191718 3300006177 Bacteria 993
124 Ga0075362_10657083 3300006177 Bacteria 545
125 Ga0075367_10005093 3300006178 Bacteria 6487
126 Ga0075367_10021656 3300006178 Bacteria 3595
127 Ga0075367_10044931 3300006178 Bacteria 2591
128 Ga0075367_10050777 3300006178 Bacteria 2449
129 Ga0075367_10219474 3300006178 Bacteria 1190
130 Ga0075369_10022437 3300006186 Bacteria 2603
131 Ga0075369_10026047 3300006186 Bacteria 2435
132 Ga0075366_10004401 3300006195 Bacteria 7560
133 Ga0075366_10023724 3300006195 Bacteria 3574
134 Ga0075366_10029363 3300006195 Bacteria 3231
135 Ga0075366_10140195 3300006195 Bacteria 1461
136 Ga0075366_10212147 3300006195 Bacteria 1179
137 Ga0075366_10246271 3300006195 Bacteria 1090
138 Ga0097621_100062361 3300006237 Bacteria 3060
139 Ga0097621_100190134 3300006237 Bacteria 1778
140 Ga0075370_10001752 3300006353 Bacteria 9670
141 Ga0075370_10001759 3300006353 Bacteria 9658
142 Ga0075370_10002149 3300006353 Bacteria 9017
143 Ga0068871_101077942 3300006358 Bacteria 750
144 Ga0097620_100004121 3300006931 Bacteria 14826
145 Ga0097620_100324304 3300006931 Bacteria 1634
146 Ga0079104_1000003 3300006946 Bacteria 468966
147 Ga0079104_1000019 3300006946 Bacteria 269313
148 Ga0079104_1007180 3300006946 Bacteria 4080
149 Ga0105240_10009244 3300009093 Bacteria 13982
150 Ga0105240_10055149 3300009093 Bacteria 4977
151 Ga0105245_10814784 3300009098 Bacteria 972
152 Ga0105245_11800124 3300009098 Bacteria 665
153 Ga0105247_10878063 3300009101 Bacteria 691
154 Ga0105243_10150476 3300009148 Bacteria 1996
155 Ga0105243_10188234 3300009148 Bacteria 1801
156 Ga0105243_10328256 3300009148 Bacteria 1397
157 Ga0105241_10250188 3300009174 Bacteria 1502
158 Ga0105242_10014031 3300009176 Bacteria 6201
159 Ga0105242_10351936 3300009176 Bacteria 1361
160 Ga0105242_10994048 3300009176 Bacteria 846
161 Ga0105248_10597143 3300009177 Bacteria 1246
162 Ga0105237_10000076 3300009545 Bacteria 131773
163 Ga0105237_10009537 3300009545 Bacteria 10393
164 Ga0105238_10018911 3300009551 Bacteria 7016
165 Ga0105238_10471484 3300009551 Bacteria 1254
166 Ga0105238_10664400 3300009551 Bacteria 1053
167 Ga0105249_10072528 3300009553 Bacteria 3183
168 Ga0105249_10205158 3300009553 Bacteria 1931
169 Ga0105249_10899282 3300009553 Unclassified 952
170 Ga0105239_10001865 3300010375 Bacteria 27579
171 Ga0105239_10033884 3300010375 Bacteria 5606
172 Ga0105239_11556081 3300010375 Bacteria 764
173 Ga0105246_10481896 3300011119 Bacteria 1049
174 Ga0105246_10843494 3300011119 Bacteria 817
175 Ga0157369_10166927 3300013105 Bacteria 2321
176 Ga0157374_10136911 3300013296 Bacteria 2374
177 Ga0157374_10227796 3300013296 Bacteria 1830
178 Ga0157374_10946261 3300013296 Bacteria 880
179 Ga0157374_11968620 3300013296 Bacteria 610
180 Ga0157378_10042645 3300013297 Bacteria 4027
181 Ga0157378_10329596 3300013297 Bacteria 1485
182 Ga0157378_10508421 3300013297 Bacteria 1204
183 Ga0163162_10006216 3300013306 Bacteria 11572
184 Ga0163162_10434449 3300013306 Bacteria 1445
185 Ga0157372_10018330 3300013307 Bacteria 7524
186 Ga0157375_11193872 3300013308 Unclassified 892
187 Ga0163163_10156395 3300014325 Bacteria 2324
188 Ga0163163_10394924 3300014325 Bacteria 1441
189 Ga0157380_10037473 3300014326 Bacteria 3757
190 Ga0157380_10039918 3300014326 Bacteria 3653
191 Ga0157380_10054689 3300014326 Bacteria 3168
192 Ga0157379_10012758 3300014968 Bacteria 7348
193 Ga0157379_10721818 3300014968 Bacteria 936
194 Ga0157376_11190595 3300014969 Bacteria 790
195 Ga0182007_10049503 3300015262 Bacteria 1388
196 Ga0163161_10068263 3300017792 Bacteria 2597
197 Ga0213872_10021044 3300021361 Bacteria 3003
198 Ga0213872_10091453 3300021361 Bacteria 1361
199 Ga0209674_100003 3300025226 Bacteria 2196646
200 Ga0209674_102655 3300025226 Bacteria 3699
201 Ga0209563_100049 3300025230 Bacteria 358472
202 Ga0209563_102915 3300025230 Bacteria 3699
203 Ga0207427_100158 3300025231 Bacteria 76687
204 Ga0209258_100267 3300025242 Bacteria 89896
205 Ga0209258_100700 3300025242 Bacteria 22801
206 Ga0207425_1000511 3300025245 Bacteria 23911
207 Ga0209026_1000054 3300025250 Bacteria 242508
208 Ga0209026_1003501 3300025250 Bacteria 5110
209 Ga0209677_100050 3300025253 Bacteria 176828
210 Ga0209677_100316 3300025253 Bacteria 31473
211 Ga0209677_104861 3300025253 Bacteria 3699
212 Ga0209148_1001945 3300025254 Bacteria 8369
213 Ga0209759_1000043 3300025256 Bacteria 242513
214 Ga0209759_1000905 3300025256 Bacteria 22093
215 Ga0209759_1007464 3300025256 Bacteria 3513
216 Ga0209129_1000225 3300025258 Bacteria 63564
217 Ga0209565_1029496 3300025263 Bacteria 1077
218 Ga0209455_1000158 3300025272 Bacteria 118973
219 Ga0209673_1020546 3300025273 Bacteria 2336
220 Ga0207673_1037854 3300025290 Bacteria 675
221 Ga0209675_1009271 3300025291 Bacteria 3494
222 Ga0209564_1000196 3300025295 Bacteria 141368
223 Ga0209758_1000181 3300025297 Bacteria 140847
224 Ga0209758_1000207 3300025297 Bacteria 129217
225 Ga0209050_1000703 3300025298 Bacteria 49694
226 Ga0209050_1002192 3300025298 Bacteria 17608
227 Ga0209050_1024764 3300025298 Bacteria 2064
228 Ga0209256_1000024 3300025299 Bacteria 448909
229 Ga0209256_1059323 3300025299 Bacteria 897
230 Ga0209051_1000063 3300025303 Bacteria 249739
231 Ga0209051_1001539 3300025303 Bacteria 19182
232 Ga0209051_1003706 3300025303 Bacteria 9864
233 Ga0209051_1080560 3300025303 Bacteria 941
234 Ga0209257_1000118 3300025304 Bacteria 225963
235 Ga0207697_10023871 3300025315 Bacteria 2504
236 Ga0207656_10137632 3300025321 Bacteria 1149
237 Ga0207642_10136950 3300025899 Bacteria 1285
238 Ga0207680_10481620 3300025903 Bacteria 883
239 Ga0207645_10028011 3300025907 Bacteria 3637
240 Ga0207645_10240763 3300025907 Bacteria 1195
241 Ga0207643_10275534 3300025908 Bacteria 1042
242 Ga0207654_10132356 3300025911 Bacteria 1580
243 Ga0207695_10012360 3300025913 Bacteria 10255
244 Ga0207695_10016652 3300025913 Bacteria 8592
245 Ga0207695_10103587 3300025913 Bacteria 2837
246 Ga0207671_10008561 3300025914 Bacteria 8656
247 Ga0207671_10012329 3300025914 Bacteria 6880
248 Ga0207671_10247304 3300025914 Bacteria 1402
249 Ga0207657_10444599 3300025919 Bacteria 1017
250 Ga0207649_10001484 3300025920 Bacteria 13768
251 Ga0207681_10100757 3300025923 Bacteria 2082
252 Ga0207694_10007192 3300025924 Bacteria 8453
253 Ga0207694_10013700 3300025924 Bacteria 6111
254 Ga0207694_10717196 3300025924 Bacteria 844
255 Ga0207694_10931989 3300025924 Bacteria 735
256 Ga0207650_10032432 3300025925 Bacteria 3778
257 Ga0207650_10193563 3300025925 Bacteria 1626
258 Ga0207659_10002201 3300025926 Bacteria 11590
259 Ga0207687_10261586 3300025927 Bacteria 1379
260 Ga0207687_11192352 3300025927 Bacteria 654
261 Ga0207644_10342600 3300025931 Bacteria 1212
262 Ga0207644_10464266 3300025931 Bacteria 1041
263 Ga0207690_10002792 3300025932 Bacteria 10532
264 Ga0207690_10415501 3300025932 Bacteria 1075
265 Ga0207690_10850972 3300025932 Bacteria 755
266 Ga0207706_10010206 3300025933 Bacteria 8590
267 Ga0207706_10089307 3300025933 Bacteria 2709
268 Ga0207686_10039492 3300025934 Bacteria 2864
269 Ga0207686_10050285 3300025934 Bacteria 2591
270 Ga0207686_10225384 3300025934 Bacteria 1356
271 Ga0207709_10000032 3300025935 Bacteria 324478
272 Ga0207670_10077789 3300025936 Bacteria 2312
273 Ga0207669_10175324 3300025937 Bacteria 1531
274 Ga0207704_10099583 3300025938 Bacteria 1934
275 Ga0207691_10062074 3300025940 Bacteria 3393
276 Ga0207691_10139044 3300025940 Bacteria 2141
277 Ga0207691_10855040 3300025940 Bacteria 763
278 Ga0207689_10046379 3300025942 Bacteria 3592
279 Ga0207689_10291868 3300025942 Bacteria 1351
280 Ga0207689_10977206 3300025942 Bacteria 714
281 Ga0207679_10000220 3300025945 Bacteria 45059
282 Ga0207679_10159795 3300025945 Bacteria 1844
283 Ga0207679_10281383 3300025945 Bacteria 1427
284 Ga0207679_11152859 3300025945 Bacteria 711
285 Ga0207667_10012561 3300025949 Bacteria 9742
286 Ga0207667_11242244 3300025949 Bacteria 723
287 Ga0207651_10500403 3300025960 Bacteria 1050
288 Ga0207668_10103311 3300025972 Bacteria 2122
289 Ga0207640_10323274 3300025981 Bacteria 1229
290 Ga0207658_10010682 3300025986 Bacteria 6242
291 Ga0207677_10004271 3300026023 Bacteria 7644
292 Ga0207703_10001921 3300026035 Bacteria 18419
293 Ga0207639_10096290 3300026041 Bacteria 2381
294 Ga0207639_10135921 3300026041 Bacteria 2041
295 Ga0207639_10279554 3300026041 Bacteria 1467
296 Ga0207639_10479552 3300026041 Bacteria 1133
297 Ga0207678_10088062 3300026067 Bacteria 2654
298 Ga0207678_10094880 3300026067 Bacteria 2549
299 Ga0207678_10147882 3300026067 Bacteria 2005
300 Ga0207702_10011854 3300026078 Bacteria 7255
301 Ga0207641_10011803 3300026088 Bacteria 7171
302 Ga0207648_10004326 3300026089 Bacteria 14627
303 Ga0207648_10013067 3300026089 Bacteria 7741
304 Ga0207648_10020746 3300026089 Bacteria 5915
305 Ga0207648_10037429 3300026089 Bacteria 4273
306 Ga0207648_10066241 3300026089 Bacteria 3150
307 Ga0207648_10844105 3300026089 Bacteria 854
308 Ga0207648_10992028 3300026089 Bacteria 786
309 Ga0207676_10061518 3300026095 Bacteria 2973
310 Ga0207674_10263634 3300026116 Bacteria 1670
311 Ga0207674_10310415 3300026116 Bacteria 1526
312 Ga0207674_10675043 3300026116 Bacteria 998
313 Ga0207675_100080990 3300026118 Bacteria 3044
314 Ga0207675_100089778 3300026118 Bacteria 2888
315 Ga0207698_10223969 3300026142 Bacteria 1702
316 Ga0207698_10612312 3300026142 Bacteria 1075
317 Ga0209281_1000002 3300027111 Bacteria 1924012
318 Ga0209281_1000149 3300027111 Bacteria 167880
319 Ga0268266_10637737 3300028379 Bacteria 1025
320 Ga0268265_10296442 3300028380 Bacteria 1454
321 Ga0268265_11040464 3300028380 Bacteria 810
322 Ga0268264_10260997 3300028381 Bacteria 1614
323 Ga0307517_10093811 3300028786 Bacteria 2430
324 Ga0307517_10418407 3300028786 Bacteria 704
325 Ga0307515_10000013 3300028794 Bacteria 568456
326 Ga0307515_10000109 3300028794 Bacteria 195895
327 Ga0307515_10002637 3300028794 Bacteria 38528
328 Ga0307515_10010767 3300028794 Bacteria 17455
329 Ga0307515_10062490 3300028794 Bacteria 5256
330 Ga0307515_10086733 3300028794 Bacteria 3986
331 Ga0307515_10405603 3300028794 Bacteria 987
332 Ga0265324_10021680 3300029957 Bacteria 2302
333 Ga0307512_10071793 3300030522 Bacteria 2567
334 Ga0265332_10000030 3300031238 Bacteria 175141
335 Ga0265327_10096503 3300031251 Bacteria 1433
336 Ga0307513_10000990 3300031456 Bacteria 41065
337 Ga0307513_10083360 3300031456 Bacteria 3288
338 Ga0307513_10362251 3300031456 Bacteria 1194
339 Ga0307513_10397742 3300031456 Bacteria 1113
340 Ga0307509_10043209 3300031507 Bacteria 4878
341 Ga0307509_10072228 3300031507 Bacteria 3596
342 Ga0307509_10167717 3300031507 Bacteria 2081
343 Ga0307509_10218829 3300031507 Bacteria 1720
344 Ga0307408_100000028 3300031548 Bacteria 233440
345 Ga0307408_100055431 3300031548 Bacteria 2870
346 Ga0307508_10000101 3300031616 Bacteria 100858
347 Ga0307514_10000533 3300031649 Bacteria 74078
348 Ga0307514_10008985 3300031649 Bacteria 8442
349 Ga0307516_10000193 3300031730 Bacteria 78825
350 Ga0307516_10001515 3300031730 Bacteria 31972
351 Ga0307516_10002784 3300031730 Bacteria 23086
352 Ga0307516_10011646 3300031730 Bacteria 9543
353 Ga0307516_10015133 3300031730 Bacteria 8127
354 Ga0307405_10124709 3300031731 Bacteria 1769
355 Ga0307412_10052632 3300031911 Bacteria 2697
356 Ga0307414_10105953 3300032004 Bacteria 2127
357 Ga0307507_10063204 3300033179 Bacteria 3430
358 Ga0307507_10081775 3300033179 Bacteria 2837
359 Ga0373931_0015905 3300035691 Bacteria 3695
360 Ga0373931_0234204 3300035691 Bacteria 1111
361 Ga0373925_0156871 3300037068 Bacteria 1790
362 Ga0395899_0335003 3300037312 Bacteria 1016
363 Ga0395900_1074324 3300037418 Bacteria 723
364 Ga0395905_0021000 3300037471 Bacteria 6182
365 Ga0395905_0535442 3300037471 Bacteria 1072
366 Ga0395905_0885749 3300037471 Bacteria 796
367 Ga0395901_0002847 3300038443 Bacteria 17464
368 Ga0436361_0256361 3300039447 Bacteria 5094
369 Ga0439466_0194917 3300041411 Bacteria 617
370 Ga0451791_1934572 3300041451 Bacteria 1328
371 Ga0451793_0125591 3300041452 Bacteria 1185
372 Ga0451793_1753075 3300041452 Bacteria 700
373 Ga0451797_0545602 3300041453 Bacteria 906
374 Ga0451795_0646682 3300041456 Bacteria 566
375 Ga0451795_1537189 3300041456 Bacteria 2196
376 Ga0451798_0706099 3300041458 Bacteria 867
377 Ga0451800_1243688 3300041459 Bacteria 631
378 Ga0451800_1338090 3300041459 Bacteria 2068
379 Ga0451800_1496088 3300041459 Bacteria 834
380 Ga0451802_0277119 3300041460 Bacteria 1352
381 Ga0451804_0771933 3300041463 Bacteria 1272
382 Ga0451807_2456877 3300041486 Bacteria 2036
383 Ga0451849_0711165 3300041505 Bacteria 1469
384 Ga0451853_0606631 3300041512 Bacteria 1830
385 Ga0439431_0003056 3300041997 Bacteria 3673
386 Ga0439462_0134718 3300042015 Bacteria 691
387 Ga0450919_000730 3300042121 Bacteria 4162
388 Ga0450908_026940 3300042184 Bacteria 1003
389 Ga0450918_001092 3300042531 Bacteria 5589
390 Ga0451577_0003346 3300042876 Bacteria 17953
391 Ga0451577_0189917 3300042876 Bacteria 1853
392 Ga0466969_0013679 3300044656 Bacteria 4270
393 Ga0466965_0001496 3300044683 Bacteria 9471
394 Ga0466966_0011578 3300044684 Bacteria 5848
395 Ga0466961_0047056 3300044693 Bacteria 2758
396 Ga0466964_0030855 3300044706 Bacteria 2123
397 Ga0453684_0014644 3300044712 Bacteria 12518
398 Ga0453684_0263474 3300044712 Bacteria 1973
399 Ga0453684_0375708 3300044712 Bacteria 1597
400 Ga0466971_0006274 3300044719 Bacteria 5162
401 Ga0466957_0052177 3300044842 Bacteria 2490
402 Ga0466957_0110699 3300044842 Bacteria 1741
403 Ga0466957_0303550 3300044842 Bacteria 1073
404 Ga0466959_0021762 3300045049 Bacteria 4733
405 Ga0466958_0119727 3300045836 Bacteria 1647
406 Ga0466967_0374944 3300045976 Bacteria 1381
407 Ga0466967_1304451 3300045976 Bacteria 723
408 Ga0495639_0025341 3300046475 Bacteria 2615
409 Ga0495639_0093229 3300046475 Bacteria 1415
410 Ga0495585_0009167 3300046492 Bacteria 5955
411 Ga0495585_0070688 3300046492 Bacteria 1903
412 Ga0495610_0222178 3300046512 Bacteria 762
413 Ga0495620_0276536 3300046515 Bacteria 639
414 Ga0495628_0168006 3300046516 Bacteria 1664
415 Ga0495632_0001710 3300046519 Bacteria 17844
416 Ga0495632_0107519 3300046519 Bacteria 1311
417 Ga0495643_0084198 3300046522 Bacteria 1650
418 Ga0495652_0001279 3300046529 Bacteria 28174
419 Ga0495652_0427474 3300046529 Bacteria 932
420 Ga0495652_0565654 3300046529 Bacteria 780
421 Ga0495621_0437344 3300046539 Bacteria 558
422 Ga0495645_0012072 3300046543 Bacteria 6087
423 Ga0495633_0417865 3300046558 Bacteria 606
424 Ga0495611_0166214 3300046648 Bacteria 1031
425 Ga0495625_0012039 3300046660 Bacteria 7020
426 Ga0495588_0028282 3300046674 Bacteria 2804
427 Ga0495646_0000288 3300046680 Bacteria 25753
428 Ga0495658_0240542 3300046683 Bacteria 1137
429 Ga0495604_0967518 3300047317 Bacteria 528
430 Ga0495686_0242602 3300047472 Bacteria 1015
431 Ga0495626_0275893 3300048091 Bacteria 669
432 Ga0496103_0021982 3300048906 Bacteria 3839
433 Ga0496104_0400250 3300048907 Bacteria 1285
434 Ga0496104_0613210 3300048907 Bacteria 998
435 Ga0496105_0549749 3300048908 Bacteria 901
436 Ga0496107_0428110 3300048910 Bacteria 984
437 Ga0496108_1350970 3300048911 Bacteria 598
438 Ga0496109_0034703 3300048912 Bacteria 4546
439 Ga0496114_0070795 3300048917 Bacteria 2930
440 Ga0496114_0101077 3300048917 Bacteria 2461
441 Ga0496121_0046103 3300048924 Bacteria 3735
442 Ga0496123_0143219 3300048926 Bacteria 1303
443 Ga0496124_0000089 3300048927 Bacteria 192423
444 Ga0496125_0007669 3300048928 Bacteria 11438
445 Ga0496125_0079099 3300048928 Bacteria 2524
446 Ga0496126_0011097 3300048929 Bacteria 9361
447 Ga0501198_000318 3300049649 Bacteria 6101
448 Ga0501222_000134 3300049662 Bacteria 15759
449 nmdc:mga03683_127687_c1 3300050489 Bacteria 1135
450 nmdc:mga03683_213856_c1 3300050489 Bacteria 888
451 nmdc:mga03n38_140075_c1 3300050490 Bacteria 1207
452 nmdc:mga03n38_609588_c1 3300050490 Bacteria 622
453 nmdc:mga00v17_341302_c1 3300050491 Bacteria 974
454 nmdc:mga00v17_86973_c1 3300050491 Bacteria 1959
455 nmdc:mga0k408_203324_c1 3300050493 Bacteria 1182
456 nmdc:mga0k408_24788_c1 3300050493 Bacteria 3394
457 nmdc:mga0k408_321586_c1 3300050493 Bacteria 923
458 nmdc:mga0k408_36268_c1 3300050493 Bacteria 2830
459 nmdc:mga0k408_36991_c1 3300050493 Bacteria 2801
460 nmdc:mga0k408_3802_c1 3300050493 Bacteria 8000
461 nmdc:mga0k408_504_c1 3300050493 Bacteria 21443
462 nmdc:mga06z11_511544_c1 3300050494 Bacteria 728
463 nmdc:mga06z11_746691_c1 3300050494 Bacteria 596
464 nmdc:mga06z11_86510_c1 3300050494 Bacteria 1693
465 nmdc:mga06z11_92414_c1 3300050494 Bacteria 1645
466 nmdc:mga07m45_11604_c1 3300050496 Bacteria 4633
467 nmdc:mga07m45_202587_c1 3300050496 Bacteria 1155
468 nmdc:mga07m45_334916_c1 3300050496 Bacteria 880
469 nmdc:mga07m45_34906_c1 3300050496 Bacteria 2797
470 nmdc:mga07m45_4996_c1 3300050496 Bacteria 6551
471 nmdc:mga07m45_569_c2 3300050496 Bacteria 10196
472 nmdc:mga0sz30_14436_c1 3300050516 Bacteria 3109
473 Ga0500578_0000224 3300053086 Bacteria 70358
474 Ga0500644_0026739 3300053088 Bacteria 1788
475 Ga0500651_0200210 3300053093 Bacteria 1178
476 Ga0500650_0014279 3300053098 Bacteria 3357
477 Ga0500562_022841 3300053108 Bacteria 1631
478 Ga0500628_023070 3300053129 Bacteria 1279
479 Ga0500642_0004823 3300053130 Bacteria 4271
480 Ga0500652_004746 3300053131 Bacteria 4227
481 Ga0500564_021746 3300053138 Bacteria 2940
482 Ga0500568_0137478 3300053139 Bacteria 906
483 Ga0500604_0015614 3300053151 Bacteria 2082
484 Ga0500622_0001670 3300053156 Bacteria 17337
485 Ga0500627_0157921 3300053158 Bacteria 1024
486 Ga0500587_001372 3300053739 Bacteria 3433
487 Ga0466962_0004546 3300061719 Bacteria 6654

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025290 Ga0207673_1037854 Ga0207673_10378541 128
2 3300045976 Ga0466967_1304451 Ga0466967_1304451_225_692 143
3 3300031649 Ga0307514_10000533 Ga0307514_1000053338 145
4 3300048926 Ga0496123_0143219 Ga0496123_0143219_747_1208 145
5 iso_pu_bacteria 2721755523 2722884948 145
6 iso_pu_bacteria 2904601388 2904603383 145
7 3300046475 Ga0495639_0025341 Ga0495639_0025341_1039_1548 147
8 3300046529 Ga0495652_0565654 Ga0495652_0565654_54_563 147
9 3300005614 Ga0068856_100124594 Ga0068856_1001245942 148
10 3300021361 Ga0213872_10021044 Ga0213872_100210443 148
11 3300039447 Ga0436361_0256361 Ga0436361_0256361_1709_2203 148
12 3300049649 Ga0501198_000318 Ga0501198_000318_4240_4704 148
13 3300049662 Ga0501222_000134 Ga0501222_000134_11056_11520 148
14 3300005366 Ga0070659_100610760 Ga0070659_1006107602 149
15 3300006946 Ga0079104_1000003 Ga0079104_1000003406 149
16 3300025935 Ga0207709_10000032 Ga0207709_10000032266 149
17 3300027111 Ga0209281_1000002 Ga0209281_10000021619 149
18 3300031730 Ga0307516_10015133 Ga0307516_100151333 149
19 3300037471 Ga0395905_0885749 Ga0395905_0885749_84_542 149
20 3300041460 Ga0451802_0277119 Ga0451802_0277119_865_1335 149
21 3300044842 Ga0466957_0110699 Ga0466957_0110699_1264_1716 149
22 3300046516 Ga0495628_0168006 Ga0495628_0168006_959_1411 149
23 3300046529 Ga0495652_0001279 Ga0495652_0001279_27281_27733 149
24 3300046543 Ga0495645_0012072 Ga0495645_0012072_734_1186 149
25 3300046680 Ga0495646_0000288 Ga0495646_0000288_12932_13384 149
26 3300047317 Ga0495604_0967518 Ga0495604_0967518_19_471 149
27 iso_pu_bacteria 2939631187 2939632750 150
28 3300044656 Ga0466969_0013679 Ga0466969_0013679_1936_2442 152
29 3300044683 Ga0466965_0001496 Ga0466965_0001496_1774_2280 152
30 3300044684 Ga0466966_0011578 Ga0466966_0011578_2937_3443 152
31 3300044693 Ga0466961_0047056 Ga0466961_0047056_1625_2131 152
32 3300044706 Ga0466964_0030855 Ga0466964_0030855_889_1395 152
33 3300044712 Ga0453684_0263474 Ga0453684_0263474_435_908 152
34 3300044719 Ga0466971_0006274 Ga0466971_0006274_4182_4688 152
35 3300044842 Ga0466957_0052177 Ga0466957_0052177_1018_1524 152
36 3300045049 Ga0466959_0021762 Ga0466959_0021762_1906_2412 152
37 3300045836 Ga0466958_0119727 Ga0466958_0119727_137_643 152
38 3300045976 Ga0466967_0374944 Ga0466967_0374944_109_615 152
39 3300061719 Ga0466962_0004546 Ga0466962_0004546_1096_1602 152
40 3300005327 Ga0070658_10949865 Ga0070658_109498651 153
41 3300005329 Ga0070683_100031612 Ga0070683_1000316122 153
42 3300005334 Ga0068869_100717182 Ga0068869_1007171822 153
43 3300005337 Ga0070682_100240103 Ga0070682_1002401033 153
44 3300005344 Ga0070661_100652200 Ga0070661_1006522001 153
45 3300005345 Ga0070692_11058285 Ga0070692_110582851 153
46 3300005354 Ga0070675_101491114 Ga0070675_1014911141 153
47 3300005366 Ga0070659_100412922 Ga0070659_1004129221 153
48 3300005564 Ga0070664_100005230 Ga0070664_1000052302 153
49 3300005577 Ga0068857_100911846 Ga0068857_1009118461 153
50 3300005578 Ga0068854_100041829 Ga0068854_1000418292 153
51 3300005616 Ga0068852_100103368 Ga0068852_1001033684 153
52 3300005834 Ga0068851_10032475 Ga0068851_100324751 153
53 3300006237 Ga0097621_100190134 Ga0097621_1001901341 153
54 3300013296 Ga0157374_10136911 Ga0157374_101369111 153
55 3300013307 Ga0157372_10018330 Ga0157372_100183305 153
56 3300025932 Ga0207690_10415501 Ga0207690_104155012 153
57 3300025942 Ga0207689_10977206 Ga0207689_109772062 153
58 3300025945 Ga0207679_11152859 Ga0207679_111528592 153
59 3300026067 Ga0207678_10094880 Ga0207678_100948802 153
60 3300026116 Ga0207674_10263634 Ga0207674_102636343 153
61 3300042876 Ga0451577_0189917 Ga0451577_0189917_599_1060 153
62 3300044712 Ga0453684_0375708 Ga0453684_0375708_948_1409 153
63 3300005356 Ga0070674_100371407 Ga0070674_1003714072 154
64 3300005459 Ga0068867_100532565 Ga0068867_1005325652 154
65 3300005459 Ga0068867_100792537 Ga0068867_1007925371 154
66 3300005543 Ga0070672_100046173 Ga0070672_1000461734 154
67 3300005543 Ga0070672_100114802 Ga0070672_1001148022 154
68 3300005564 Ga0070664_100253896 Ga0070664_1002538962 154
69 3300005841 Ga0068863_100003333 Ga0068863_1000033332 154
70 3300009176 Ga0105242_10014031 Ga0105242_100140314 154
71 3300009551 Ga0105238_10471484 Ga0105238_104714842 154
72 3300025924 Ga0207694_10931989 Ga0207694_109319891 154
73 3300025925 Ga0207650_10193563 Ga0207650_101935632 154
74 3300025934 Ga0207686_10039492 Ga0207686_100394922 154
75 3300025934 Ga0207686_10050285 Ga0207686_100502853 154
76 3300025940 Ga0207691_10062074 Ga0207691_100620743 154
77 3300025940 Ga0207691_10139044 Ga0207691_101390442 154
78 3300025945 Ga0207679_10281383 Ga0207679_102813831 154
79 3300026023 Ga0207677_10004271 Ga0207677_100042719 154
80 3300026089 Ga0207648_10844105 Ga0207648_108441051 154
81 3300037068 Ga0373925_0156871 Ga0373925_0156871_20_487 154
82 iso_pu_bacteria 2511231003 2511252379 154
83 iso_pu_bacteria 2511231026 2511385202 154
84 iso_pu_bacteria 2547132512 2548848132 154
85 iso_pu_bacteria 2548876994 2550692724 154
86 iso_pu_bacteria 2585428057 2587730682 154
87 iso_pu_bacteria 2585428058 2587732102 154
88 iso_pu_bacteria 2585428062 2587759888 154
89 iso_pu_bacteria 2588253510 2588291159 154
90 iso_pu_bacteria 2600254954 2600446216 154
91 iso_pu_bacteria 2600255389 2602007982 154
92 iso_pu_bacteria 2643221592 2643969226 154
93 iso_pu_bacteria 2643221625 2644140800 154
94 iso_pu_bacteria 2643221644 2644243277 154
95 iso_pu_bacteria 2643221648 2644272177 154
96 iso_pu_bacteria 2739367655 2739612321 154
97 iso_pu_bacteria 2808606386 2808981870 154
98 iso_pu_bacteria 2808606415 2809131492 154
99 iso_pu_bacteria 2808606419 2809151114 154
100 iso_pu_bacteria 2818991445 2819591768 154
101 iso_pu_bacteria 2839138175 2839139575 154
102 iso_pu_bacteria 2852618963 2852622606 154
103 iso_pu_bacteria 2884852848 2884853860 154
104 iso_pu_bacteria 2896154374 2896155023 154
105 iso_pu_bacteria 2919501602 2919502993 154
106 iso_pu_bacteria 2919704043 2919706896 154
107 iso_pu_bacteria 2926063275 2926064666 154
108 iso_pu_bacteria 8034962539 8034965544 154
109 3300005328 Ga0070676_10113727 Ga0070676_101137272 155
110 3300005330 Ga0070690_100028351 Ga0070690_1000283512 155
111 3300005338 Ga0068868_100051368 Ga0068868_1000513681 155
112 3300005354 Ga0070675_100402339 Ga0070675_1004023392 155
113 3300005355 Ga0070671_100697307 Ga0070671_1006973071 155
114 3300005364 Ga0070673_100313794 Ga0070673_1003137942 155
115 3300005365 Ga0070688_100088709 Ga0070688_1000887092 155
116 3300005367 Ga0070667_100077442 Ga0070667_1000774423 155
117 3300005456 Ga0070678_100123617 Ga0070678_1001236172 155
118 3300005543 Ga0070672_100425818 Ga0070672_1004258182 155
119 3300005548 Ga0070665_100802047 Ga0070665_1008020472 155
120 3300005564 Ga0070664_100765674 Ga0070664_1007656742 155
121 3300005617 Ga0068859_100004121 Ga0068859_1000041219 155
122 3300005618 Ga0068864_100008613 Ga0068864_1000086132 155
123 3300005842 Ga0068858_100490354 Ga0068858_1004903542 155
124 3300006237 Ga0097621_100062361 Ga0097621_1000623612 155
125 3300006931 Ga0097620_100004121 Ga0097620_1000041219 155
126 3300011119 Ga0105246_10843494 Ga0105246_108434942 155
127 3300013296 Ga0157374_11968620 Ga0157374_119686201 155
128 3300013297 Ga0157378_10329596 Ga0157378_103295962 155
129 3300013306 Ga0163162_10006216 Ga0163162_100062161 155
130 3300014325 Ga0163163_10156395 Ga0163163_101563952 155
131 3300014326 Ga0157380_10054689 Ga0157380_100546892 155
132 3300014968 Ga0157379_10012758 Ga0157379_100127583 155
133 3300014969 Ga0157376_11190595 Ga0157376_111905952 155
134 3300025907 Ga0207645_10028011 Ga0207645_100280112 155
135 3300025908 Ga0207643_10275534 Ga0207643_102755342 155
136 3300025924 Ga0207694_10717196 Ga0207694_107171962 155
137 3300025926 Ga0207659_10002201 Ga0207659_100022012 155
138 3300025931 Ga0207644_10342600 Ga0207644_103426002 155
139 3300025936 Ga0207670_10077789 Ga0207670_100777892 155
140 3300025940 Ga0207691_10855040 Ga0207691_108550401 155
141 3300025945 Ga0207679_10159795 Ga0207679_101597952 155
142 3300025960 Ga0207651_10500403 Ga0207651_105004032 155
143 3300025986 Ga0207658_10010682 Ga0207658_100106824 155
144 3300026035 Ga0207703_10001921 Ga0207703_1000192113 155
145 3300026067 Ga0207678_10147882 Ga0207678_101478822 155
146 3300026088 Ga0207641_10011803 Ga0207641_100118032 155
147 3300026089 Ga0207648_10013067 Ga0207648_100130676 155
148 3300026089 Ga0207648_10066241 Ga0207648_100662415 155
149 3300026095 Ga0207676_10061518 Ga0207676_100615182 155
150 3300026118 Ga0207675_100080990 Ga0207675_1000809902 155
151 3300028379 Ga0268266_10637737 Ga0268266_106377372 155
152 3300032004 Ga0307414_10105953 Ga0307414_101059531 155
153 3300048907 Ga0496104_0613210 Ga0496104_0613210_483_953 155
154 3300048910 Ga0496107_0428110 Ga0496107_0428110_497_967 155
155 3300048912 Ga0496109_0034703 Ga0496109_0034703_2828_3298 155
156 3300003792 Ga0055540_1067132 Ga0055540_10671321 156
157 3300005353 Ga0070669_100160714 Ga0070669_1001607143 156
158 3300005354 Ga0070675_100359590 Ga0070675_1003595902 156
159 3300005355 Ga0070671_100440262 Ga0070671_1004402621 156
160 3300005356 Ga0070674_100251433 Ga0070674_1002514332 156
161 3300005367 Ga0070667_100425228 Ga0070667_1004252282 156
162 3300005543 Ga0070672_100646470 Ga0070672_1006464701 156
163 3300005564 Ga0070664_100336369 Ga0070664_1003363692 156
164 3300005618 Ga0068864_100772751 Ga0068864_1007727511 156
165 3300005719 Ga0068861_100024717 Ga0068861_1000247172 156
166 3300006358 Ga0068871_101077942 Ga0068871_1010779421 156
167 3300009177 Ga0105248_10597143 Ga0105248_105971433 156
168 3300009553 Ga0105249_10899282 Ga0105249_108992821 156
169 3300010375 Ga0105239_11556081 Ga0105239_115560811 156
170 3300013296 Ga0157374_10227796 Ga0157374_102277961 156
171 3300013297 Ga0157378_10508421 Ga0157378_105084212 156
172 3300013306 Ga0163162_10434449 Ga0163162_104344492 156
173 3300013308 Ga0157375_11193872 Ga0157375_111938722 156
174 3300014325 Ga0163163_10394924 Ga0163163_103949242 156
175 3300025303 Ga0209051_1001539 Ga0209051_10015392 156
176 3300025903 Ga0207680_10481620 Ga0207680_104816201 156
177 3300025923 Ga0207681_10100757 Ga0207681_101007573 156
178 3300025925 Ga0207650_10032432 Ga0207650_100324322 156
179 3300025931 Ga0207644_10464266 Ga0207644_104642662 156
180 3300026089 Ga0207648_10004326 Ga0207648_100043262 156
181 3300046492 Ga0495585_0070688 Ga0495585_0070688_967_1449 156
182 3300046539 Ga0495621_0437344 Ga0495621_0437344_57_536 156
183 3300046558 Ga0495633_0417865 Ga0495633_0417865_106_576 156
184 3300046648 Ga0495611_0166214 Ga0495611_0166214_230_712 156
185 3300046674 Ga0495588_0028282 Ga0495588_0028282_1348_1830 156
186 3300048906 Ga0496103_0021982 Ga0496103_0021982_3243_3713 156
187 iso_pu_bacteria 2816332141 2816519441 156
188 3300002705 JGI25156J39149_1000175 JGI25156J39149_100017543 157
189 3300002738 JGI25154J39366_1003891 JGI25154J39366_10038914 157
190 3300002741 JGI25157J39369_1000029 JGI25157J39369_1000029112 157
191 3300003316 rootH1_10080354 rootH1_100803541 157
192 3300003320 rootH2_10050886 rootH2_100508862 157
193 3300003323 rootH1_10069326 rootH1_100693265 157
194 3300003323 rootH1_10069327 rootH1_100693272 157
195 3300003323 rootH1_10146338 rootH1_101463382 157
196 3300003752 Ga0055539_1000310 Ga0055539_100031021 157
197 3300003752 Ga0055539_1001425 Ga0055539_10014253 157
198 3300003756 Ga0055533_1000010 Ga0055533_1000010380 157
199 3300003759 Ga0055525_1000841 Ga0055525_10008414 157
200 3300005327 Ga0070658_10360177 Ga0070658_103601772 157
201 3300005329 Ga0070683_100185442 Ga0070683_1001854422 157
202 3300005330 Ga0070690_100076543 Ga0070690_1000765433 157
203 3300005459 Ga0068867_101086486 Ga0068867_1010864861 157
204 3300005563 Ga0068855_100052867 Ga0068855_1000528673 157
205 3300005577 Ga0068857_100002542 Ga0068857_1000025421 157
206 3300005577 Ga0068857_100098356 Ga0068857_1000983562 157
207 3300005577 Ga0068857_100548702 Ga0068857_1005487022 157
208 3300005578 Ga0068854_100012169 Ga0068854_1000121693 157
209 3300005614 Ga0068856_100003174 Ga0068856_1000031749 157
210 3300005616 Ga0068852_101304312 Ga0068852_1013043122 157
211 3300005617 Ga0068859_100324312 Ga0068859_1003243122 157
212 3300005843 Ga0068860_100478602 Ga0068860_1004786022 157
213 3300006195 Ga0075366_10029363 Ga0075366_100293634 157
214 3300006353 Ga0075370_10001752 Ga0075370_1000175210 157
215 3300006931 Ga0097620_100324304 Ga0097620_1003243042 157
216 3300009098 Ga0105245_11800124 Ga0105245_118001241 157
217 3300009148 Ga0105243_10188234 Ga0105243_101882343 157
218 3300009174 Ga0105241_10250188 Ga0105241_102501882 157
219 3300009176 Ga0105242_10351936 Ga0105242_103519362 157
220 3300009551 Ga0105238_10664400 Ga0105238_106644001 157
221 3300010375 Ga0105239_10033884 Ga0105239_100338842 157
222 3300011119 Ga0105246_10481896 Ga0105246_104818962 157
223 3300013105 Ga0157369_10166927 Ga0157369_101669272 157
224 3300013296 Ga0157374_10946261 Ga0157374_109462611 157
225 3300013297 Ga0157378_10042645 Ga0157378_100426454 157
226 3300014968 Ga0157379_10721818 Ga0157379_107218182 157
227 3300015262 Ga0182007_10049503 Ga0182007_100495032 157
228 3300025226 Ga0209674_100003 Ga0209674_1000031714 157
229 3300025230 Ga0209563_100049 Ga0209563_100049176 157
230 3300025231 Ga0207427_100158 Ga0207427_10015817 157
231 3300025242 Ga0209258_100700 Ga0209258_10070020 157
232 3300025250 Ga0209026_1000054 Ga0209026_100005475 157
233 3300025253 Ga0209677_100050 Ga0209677_100050133 157
234 3300025253 Ga0209677_100316 Ga0209677_1003165 157
235 3300025256 Ga0209759_1000043 Ga0209759_1000043152 157
236 3300025256 Ga0209759_1007464 Ga0209759_10074645 157
237 3300025303 Ga0209051_1003706 Ga0209051_10037069 157
238 3300025303 Ga0209051_1080560 Ga0209051_10805601 157
239 3300025911 Ga0207654_10132356 Ga0207654_101323562 157
240 3300025913 Ga0207695_10012360 Ga0207695_100123608 157
241 3300025914 Ga0207671_10012329 Ga0207671_100123296 157
242 3300025924 Ga0207694_10013700 Ga0207694_100137004 157
243 3300025927 Ga0207687_10261586 Ga0207687_102615861 157
244 3300025934 Ga0207686_10225384 Ga0207686_102253842 157
245 3300025942 Ga0207689_10046379 Ga0207689_100463795 157
246 3300025949 Ga0207667_10012561 Ga0207667_100125619 157
247 3300025949 Ga0207667_11242244 Ga0207667_112422442 157
248 3300026041 Ga0207639_10135921 Ga0207639_101359212 157
249 3300026041 Ga0207639_10279554 Ga0207639_102795542 157
250 3300026078 Ga0207702_10011854 Ga0207702_100118547 157
251 3300026089 Ga0207648_10992028 Ga0207648_109920281 157
252 3300026116 Ga0207674_10675043 Ga0207674_106750432 157
253 3300026118 Ga0207675_100089778 Ga0207675_1000897784 157
254 3300026142 Ga0207698_10612312 Ga0207698_106123122 157
255 3300031507 Ga0307509_10167717 Ga0307509_101677171 157
256 3300031507 Ga0307509_10218829 Ga0307509_102188292 157
257 3300031730 Ga0307516_10001515 Ga0307516_100015155 157
258 3300035691 Ga0373931_0015905 Ga0373931_0015905_306_800 157
259 3300035691 Ga0373931_0234204 Ga0373931_0234204_207_707 157
260 3300037312 Ga0395899_0335003 Ga0395899_0335003_11_511 157
261 3300037418 Ga0395900_1074324 Ga0395900_1074324_192_692 157
262 3300037471 Ga0395905_0535442 Ga0395905_0535442_55_555 157
263 3300038443 Ga0395901_0002847 Ga0395901_0002847_9371_9871 157
264 3300046475 Ga0495639_0093229 Ga0495639_0093229_568_1068 157
265 3300046492 Ga0495585_0009167 Ga0495585_0009167_392_886 157
266 3300046529 Ga0495652_0427474 Ga0495652_0427474_410_910 157
267 3300050493 nmdc:mga0k408_36991_c1 nmdc:mga0k408_36991_c1_1984_2484 157
268 3300050496 nmdc:mga07m45_4996_c1 nmdc:mga07m45_4996_c1_2216_2713 157
269 3300053138 Ga0500564_021746 Ga0500564_021746_2119_2616 157
270 3300001979 JGI24740J21852_10013376 JGI24740J21852_100133762 158
271 3300002705 JGI25156J39149_1017682 JGI25156J39149_10176823 158
272 3300002741 JGI25157J39369_1030130 JGI25157J39369_10301301 158
273 3300002774 JGI25150J39212_1011329 JGI25150J39212_10113292 158
274 3300003215 JGI25153J46596_10001167 JGI25153J46596_100011674 158
275 3300003756 Ga0055533_1002953 Ga0055533_10029533 158
276 3300003759 Ga0055525_1001256 Ga0055525_10012565 158
277 3300003761 Ga0055535_1000107 Ga0055535_100010778 158
278 3300003763 Ga0055529_1000111 Ga0055529_10001111 158
279 3300003771 Ga0055526_1003406 Ga0055526_100340610 158
280 3300003775 Ga0055524_1000203 Ga0055524_100020357 158
281 3300003775 Ga0055524_1001287 Ga0055524_10012876 158
282 3300003784 Ga0055534_1039687 Ga0055534_10396871 158
283 3300003790 Ga0055528_1055169 Ga0055528_10551692 158
284 3300003791 Ga0055530_10002154 Ga0055530_100021546 158
285 3300003791 Ga0055530_10016194 Ga0055530_100161943 158
286 3300003792 Ga0055540_1000357 Ga0055540_100035730 158
287 3300003794 Ga0055531_10020200 Ga0055531_100202002 158
288 3300005262 Ga0065165_1004882 Ga0065165_10048824 158
289 3300005335 Ga0070666_10257766 Ga0070666_102577662 158
290 3300005339 Ga0070660_100590586 Ga0070660_1005905862 158
291 3300005344 Ga0070661_100000791 Ga0070661_10000079110 158
292 3300005353 Ga0070669_100488820 Ga0070669_1004888202 158
293 3300005356 Ga0070674_100020018 Ga0070674_1000200183 158
294 3300005366 Ga0070659_100009555 Ga0070659_1000095556 158
295 3300005441 Ga0070700_100758800 Ga0070700_1007588002 158
296 3300005457 Ga0070662_100025445 Ga0070662_1000254453 158
297 3300005457 Ga0070662_100148878 Ga0070662_1001488781 158
298 3300005459 Ga0068867_100015012 Ga0068867_1000150122 158
299 3300005459 Ga0068867_100142047 Ga0068867_1001420472 158
300 3300005543 Ga0070672_100398261 Ga0070672_1003982612 158
301 3300005543 Ga0070672_100860554 Ga0070672_1008605541 158
302 3300005543 Ga0070672_101103592 Ga0070672_1011035921 158
303 3300005563 Ga0068855_100170534 Ga0068855_1001705342 158
304 3300005564 Ga0070664_100000524 Ga0070664_1000005249 158
305 3300005564 Ga0070664_100024941 Ga0070664_1000249412 158
306 3300005577 Ga0068857_100292624 Ga0068857_1002926242 158
307 3300005578 Ga0068854_100265671 Ga0068854_1002656712 158
308 3300005616 Ga0068852_100400552 Ga0068852_1004005522 158
309 3300005719 Ga0068861_100181271 Ga0068861_1001812712 158
310 3300005834 Ga0068851_10153541 Ga0068851_101535412 158
311 3300005841 Ga0068863_101140764 Ga0068863_1011407642 158
312 3300006048 Ga0075363_100014012 Ga0075363_1000140124 158
313 3300006048 Ga0075363_100229064 Ga0075363_1002290642 158
314 3300006048 Ga0075363_100363855 Ga0075363_1003638551 158
315 3300006051 Ga0075364_10124488 Ga0075364_101244882 158
316 3300006051 Ga0075364_10237150 Ga0075364_102371502 158
317 3300006177 Ga0075362_10016150 Ga0075362_100161502 158
318 3300006177 Ga0075362_10126565 Ga0075362_101265652 158
319 3300006177 Ga0075362_10130281 Ga0075362_101302812 158
320 3300006177 Ga0075362_10191718 Ga0075362_101917182 158
321 3300006177 Ga0075362_10657083 Ga0075362_106570831 158
322 3300006178 Ga0075367_10005093 Ga0075367_100050935 158
323 3300006178 Ga0075367_10021656 Ga0075367_100216564 158
324 3300006178 Ga0075367_10044931 Ga0075367_100449313 158
325 3300006178 Ga0075367_10050777 Ga0075367_100507772 158
326 3300006178 Ga0075367_10219474 Ga0075367_102194742 158
327 3300006186 Ga0075369_10022437 Ga0075369_100224374 158
328 3300006186 Ga0075369_10026047 Ga0075369_100260472 158
329 3300006195 Ga0075366_10004401 Ga0075366_100044012 158
330 3300006195 Ga0075366_10023724 Ga0075366_100237242 158
331 3300006195 Ga0075366_10140195 Ga0075366_101401952 158
332 3300006195 Ga0075366_10212147 Ga0075366_102121472 158
333 3300006195 Ga0075366_10246271 Ga0075366_102462712 158
334 3300006353 Ga0075370_10001759 Ga0075370_100017596 158
335 3300006353 Ga0075370_10002149 Ga0075370_100021495 158
336 3300006946 Ga0079104_1000019 Ga0079104_1000019163 158
337 3300006946 Ga0079104_1007180 Ga0079104_10071808 158
338 3300009093 Ga0105240_10009244 Ga0105240_1000924410 158
339 3300009093 Ga0105240_10055149 Ga0105240_100551493 158
340 3300009098 Ga0105245_10814784 Ga0105245_108147842 158
341 3300009101 Ga0105247_10878063 Ga0105247_108780632 158
342 3300009148 Ga0105243_10150476 Ga0105243_101504762 158
343 3300009148 Ga0105243_10328256 Ga0105243_103282562 158
344 3300009176 Ga0105242_10994048 Ga0105242_109940482 158
345 3300009545 Ga0105237_10000076 Ga0105237_10000076105 158
346 3300009545 Ga0105237_10009537 Ga0105237_1000953710 158
347 3300009551 Ga0105238_10018911 Ga0105238_100189111 158
348 3300009553 Ga0105249_10072528 Ga0105249_100725282 158
349 3300009553 Ga0105249_10205158 Ga0105249_102051582 158
350 3300010375 Ga0105239_10001865 Ga0105239_1000186526 158
351 3300014326 Ga0157380_10037473 Ga0157380_100374732 158
352 3300014326 Ga0157380_10039918 Ga0157380_100399184 158
353 3300017792 Ga0163161_10068263 Ga0163161_100682633 158
354 3300021361 Ga0213872_10091453 Ga0213872_100914532 158
355 3300025226 Ga0209674_102655 Ga0209674_1026553 158
356 3300025230 Ga0209563_102915 Ga0209563_1029153 158
357 3300025242 Ga0209258_100267 Ga0209258_10026776 158
358 3300025245 Ga0207425_1000511 Ga0207425_100051116 158
359 3300025250 Ga0209026_1003501 Ga0209026_10035014 158
360 3300025253 Ga0209677_104861 Ga0209677_1048613 158
361 3300025254 Ga0209148_1001945 Ga0209148_10019456 158
362 3300025256 Ga0209759_1000905 Ga0209759_100090514 158
363 3300025258 Ga0209129_1000225 Ga0209129_100022549 158
364 3300025263 Ga0209565_1029496 Ga0209565_10294962 158
365 3300025272 Ga0209455_1000158 Ga0209455_100015894 158
366 3300025273 Ga0209673_1020546 Ga0209673_10205462 158
367 3300025291 Ga0209675_1009271 Ga0209675_10092713 158
368 3300025295 Ga0209564_1000196 Ga0209564_100019681 158
369 3300025297 Ga0209758_1000181 Ga0209758_100018149 158
370 3300025297 Ga0209758_1000207 Ga0209758_100020776 158
371 3300025298 Ga0209050_1000703 Ga0209050_10007039 158
372 3300025298 Ga0209050_1002192 Ga0209050_10021924 158
373 3300025298 Ga0209050_1024764 Ga0209050_10247643 158
374 3300025299 Ga0209256_1000024 Ga0209256_1000024137 158
375 3300025299 Ga0209256_1059323 Ga0209256_10593232 158
376 3300025303 Ga0209051_1000063 Ga0209051_100006382 158
377 3300025304 Ga0209257_1000118 Ga0209257_1000118125 158
378 3300025315 Ga0207697_10023871 Ga0207697_100238711 158
379 3300025321 Ga0207656_10137632 Ga0207656_101376322 158
380 3300025899 Ga0207642_10136950 Ga0207642_101369502 158
381 3300025907 Ga0207645_10240763 Ga0207645_102407632 158
382 3300025913 Ga0207695_10016652 Ga0207695_100166525 158
383 3300025913 Ga0207695_10103587 Ga0207695_101035872 158
384 3300025914 Ga0207671_10008561 Ga0207671_100085614 158
385 3300025914 Ga0207671_10247304 Ga0207671_102473042 158
386 3300025919 Ga0207657_10444599 Ga0207657_104445992 158
387 3300025920 Ga0207649_10001484 Ga0207649_1000148410 158
388 3300025924 Ga0207694_10007192 Ga0207694_100071928 158
389 3300025927 Ga0207687_11192352 Ga0207687_111923522 158
390 3300025932 Ga0207690_10002792 Ga0207690_100027922 158
391 3300025932 Ga0207690_10850972 Ga0207690_108509721 158
392 3300025933 Ga0207706_10010206 Ga0207706_100102067 158
393 3300025933 Ga0207706_10089307 Ga0207706_100893072 158
394 3300025937 Ga0207669_10175324 Ga0207669_101753242 158
395 3300025938 Ga0207704_10099583 Ga0207704_100995833 158
396 3300025942 Ga0207689_10291868 Ga0207689_102918682 158
397 3300025945 Ga0207679_10000220 Ga0207679_1000022022 158
398 3300025972 Ga0207668_10103311 Ga0207668_101033111 158
399 3300025981 Ga0207640_10323274 Ga0207640_103232742 158
400 3300026041 Ga0207639_10096290 Ga0207639_100962902 158
401 3300026041 Ga0207639_10479552 Ga0207639_104795522 158
402 3300026067 Ga0207678_10088062 Ga0207678_100880622 158
403 3300026089 Ga0207648_10020746 Ga0207648_100207467 158
404 3300026089 Ga0207648_10037429 Ga0207648_100374294 158
405 3300026116 Ga0207674_10310415 Ga0207674_103104152 158
406 3300026142 Ga0207698_10223969 Ga0207698_102239692 158
407 3300027111 Ga0209281_1000149 Ga0209281_1000149131 158
408 3300028380 Ga0268265_10296442 Ga0268265_102964422 158
409 3300028380 Ga0268265_11040464 Ga0268265_110404642 158
410 3300028381 Ga0268264_10260997 Ga0268264_102609973 158
411 3300028786 Ga0307517_10093811 Ga0307517_100938112 158
412 3300028786 Ga0307517_10418407 Ga0307517_104184071 158
413 3300028794 Ga0307515_10000013 Ga0307515_10000013228 158
414 3300028794 Ga0307515_10000109 Ga0307515_1000010923 158
415 3300028794 Ga0307515_10002637 Ga0307515_100026379 158
416 3300028794 Ga0307515_10010767 Ga0307515_100107679 158
417 3300028794 Ga0307515_10062490 Ga0307515_100624904 158
418 3300028794 Ga0307515_10086733 Ga0307515_100867333 158
419 3300028794 Ga0307515_10405603 Ga0307515_104056031 158
420 3300029957 Ga0265324_10021680 Ga0265324_100216802 158
421 3300030522 Ga0307512_10071793 Ga0307512_100717932 158
422 3300031238 Ga0265332_10000030 Ga0265332_1000003070 158
423 3300031251 Ga0265327_10096503 Ga0265327_100965033 158
424 3300031456 Ga0307513_10000990 Ga0307513_1000099024 158
425 3300031456 Ga0307513_10083360 Ga0307513_100833602 158
426 3300031456 Ga0307513_10362251 Ga0307513_103622512 158
427 3300031456 Ga0307513_10397742 Ga0307513_103977422 158
428 3300031507 Ga0307509_10043209 Ga0307509_100432093 158
429 3300031507 Ga0307509_10072228 Ga0307509_100722281 158
430 3300031548 Ga0307408_100000028 Ga0307408_100000028122 158
431 3300031548 Ga0307408_100055431 Ga0307408_1000554314 158
432 3300031616 Ga0307508_10000101 Ga0307508_1000010190 158
433 3300031649 Ga0307514_10008985 Ga0307514_100089852 158
434 3300031730 Ga0307516_10000193 Ga0307516_1000019315 158
435 3300031730 Ga0307516_10002784 Ga0307516_1000278413 158
436 3300031730 Ga0307516_10011646 Ga0307516_100116464 158
437 3300031731 Ga0307405_10124709 Ga0307405_101247092 158
438 3300031911 Ga0307412_10052632 Ga0307412_100526324 158
439 3300033179 Ga0307507_10063204 Ga0307507_100632041 158
440 3300033179 Ga0307507_10081775 Ga0307507_100817752 158
441 3300037471 Ga0395905_0021000 Ga0395905_0021000_3323_3811 158
442 3300041411 Ga0439466_0194917 Ga0439466_0194917_53_562 158
443 3300041451 Ga0451791_1934572 Ga0451791_1934572_417_893 158
444 3300041452 Ga0451793_0125591 Ga0451793_0125591_618_1109 158
445 3300041452 Ga0451793_1753075 Ga0451793_1753075_72_548 158
446 3300041453 Ga0451797_0545602 Ga0451797_0545602_90_581 158
447 3300041456 Ga0451795_0646682 Ga0451795_0646682_16_507 158
448 3300041456 Ga0451795_1537189 Ga0451795_1537189_1104_1580 158
449 3300041458 Ga0451798_0706099 Ga0451798_0706099_45_536 158
450 3300041459 Ga0451800_1243688 Ga0451800_1243688_60_551 158
451 3300041459 Ga0451800_1338090 Ga0451800_1338090_1436_1912 158
452 3300041459 Ga0451800_1496088 Ga0451800_1496088_214_711 158
453 3300041463 Ga0451804_0771933 Ga0451804_0771933_375_851 158
454 3300041486 Ga0451807_2456877 Ga0451807_2456877_1078_1569 158
455 3300041505 Ga0451849_0711165 Ga0451849_0711165_352_843 158
456 3300041512 Ga0451853_0606631 Ga0451853_0606631_815_1291 158
457 3300041997 Ga0439431_0003056 Ga0439431_0003056_673_1182 158
458 3300042015 Ga0439462_0134718 Ga0439462_0134718_146_655 158
459 3300042121 Ga0450919_000730 Ga0450919_000730_1035_1511 158
460 3300042184 Ga0450908_026940 Ga0450908_026940_316_819 158
461 3300042531 Ga0450918_001092 Ga0450918_001092_1061_1537 158
462 3300042876 Ga0451577_0003346 Ga0451577_0003346_3114_3611 158
463 3300044712 Ga0453684_0014644 Ga0453684_0014644_3720_4208 158
464 3300044842 Ga0466957_0303550 Ga0466957_0303550_290_811 158
465 3300046512 Ga0495610_0222178 Ga0495610_0222178_249_725 158
466 3300046515 Ga0495620_0276536 Ga0495620_0276536_145_621 158
467 3300046519 Ga0495632_0001710 Ga0495632_0001710_15308_15784 158
468 3300046519 Ga0495632_0107519 Ga0495632_0107519_622_1113 158
469 3300046522 Ga0495643_0084198 Ga0495643_0084198_647_1138 158
470 3300046660 Ga0495625_0012039 Ga0495625_0012039_3875_4366 158
471 3300046683 Ga0495658_0240542 Ga0495658_0240542_75_569 158
472 3300047472 Ga0495686_0242602 Ga0495686_0242602_273_764 158
473 3300048091 Ga0495626_0275893 Ga0495626_0275893_138_614 158
474 3300048907 Ga0496104_0400250 Ga0496104_0400250_48_575 158
475 3300048908 Ga0496105_0549749 Ga0496105_0549749_165_692 158
476 3300048911 Ga0496108_1350970 Ga0496108_1350970_48_524 158
477 3300048917 Ga0496114_0070795 Ga0496114_0070795_568_1068 158
478 3300048917 Ga0496114_0101077 Ga0496114_0101077_1275_1751 158
479 3300048924 Ga0496121_0046103 Ga0496121_0046103_2066_2554 158
480 3300048927 Ga0496124_0000089 Ga0496124_0000089_133671_134153 158
481 3300048928 Ga0496125_0007669 Ga0496125_0007669_8448_8930 158
482 3300048928 Ga0496125_0079099 Ga0496125_0079099_1238_1741 158
483 3300048929 Ga0496126_0011097 Ga0496126_0011097_2823_3323 158
484 3300050489 nmdc:mga03683_127687_c1 nmdc:mga03683_127687_c1_82_558 158
485 3300050489 nmdc:mga03683_213856_c1 nmdc:mga03683_213856_c1_62_541 158
486 3300050490 nmdc:mga03n38_140075_c1 nmdc:mga03n38_140075_c1_366_845 158
487 3300050490 nmdc:mga03n38_609588_c1 nmdc:mga03n38_609588_c1_104_595 158
488 3300050491 nmdc:mga00v17_341302_c1 nmdc:mga00v17_341302_c1_167_646 158
489 3300050491 nmdc:mga00v17_86973_c1 nmdc:mga00v17_86973_c1_404_910 158
490 3300050493 nmdc:mga0k408_203324_c1 nmdc:mga0k408_203324_c1_167_649 158
491 3300050493 nmdc:mga0k408_24788_c1 nmdc:mga0k408_24788_c1_1734_2213 158
492 3300050493 nmdc:mga0k408_321586_c1 nmdc:mga0k408_321586_c1_60_545 158
493 3300050493 nmdc:mga0k408_36268_c1 nmdc:mga0k408_36268_c1_1114_1590 158
494 3300050493 nmdc:mga0k408_3802_c1 nmdc:mga0k408_3802_c1_5345_5824 158
495 3300050493 nmdc:mga0k408_504_c1 nmdc:mga0k408_504_c1_5169_5648 158
496 3300050494 nmdc:mga06z11_511544_c1 nmdc:mga06z11_511544_c1_156_635 158
497 3300050494 nmdc:mga06z11_746691_c1 nmdc:mga06z11_746691_c1_70_561 158
498 3300050494 nmdc:mga06z11_86510_c1 nmdc:mga06z11_86510_c1_768_1247 158
499 3300050494 nmdc:mga06z11_92414_c1 nmdc:mga06z11_92414_c1_987_1463 158
500 3300050496 nmdc:mga07m45_11604_c1 nmdc:mga07m45_11604_c1_2294_2770 158
501 3300050496 nmdc:mga07m45_202587_c1 nmdc:mga07m45_202587_c1_42_521 158
502 3300050496 nmdc:mga07m45_334916_c1 nmdc:mga07m45_334916_c1_50_541 158
503 3300050496 nmdc:mga07m45_34906_c1 nmdc:mga07m45_34906_c1_1134_1613 158
504 3300050496 nmdc:mga07m45_569_c2 nmdc:mga07m45_569_c2_6320_6799 158
505 3300050516 nmdc:mga0sz30_14436_c1 nmdc:mga0sz30_14436_c1_2581_3063 158
506 3300053086 Ga0500578_0000224 Ga0500578_0000224_28973_29449 158
507 3300053088 Ga0500644_0026739 Ga0500644_0026739_651_1127 158
508 3300053093 Ga0500651_0200210 Ga0500651_0200210_142_618 158
509 3300053098 Ga0500650_0014279 Ga0500650_0014279_962_1438 158
510 3300053108 Ga0500562_022841 Ga0500562_022841_891_1367 158
511 3300053129 Ga0500628_023070 Ga0500628_023070_754_1230 158
512 3300053130 Ga0500642_0004823 Ga0500642_0004823_1144_1620 158
513 3300053131 Ga0500652_004746 Ga0500652_004746_1304_1780 158
514 3300053139 Ga0500568_0137478 Ga0500568_0137478_11_487 158
515 3300053151 Ga0500604_0015614 Ga0500604_0015614_1215_1691 158
516 3300053156 Ga0500622_0001670 Ga0500622_0001670_7297_7773 158
517 3300053158 Ga0500627_0157921 Ga0500627_0157921_347_823 158
518 3300053739 Ga0500587_001372 Ga0500587_001372_1379_1870 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

22

98

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ien-assembly1.cif.gz_A crystal structure of acyl-coa hydrolase from neisseria meningitidis fam18 0.9869 1 145
5t02-assembly1.cif.gz_F structural characterisation of mutant asp39ala of thioesterase (nmach) from neisseria meningitidis 0.9865 3 145
5szu-assembly1.cif.gz_A novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9859 2 148
5szv-assembly2.cif.gz_D novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9795 2 149
5szy-assembly1.cif.gz_A novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9793 1 149
ID Description Score Start End Superfamily
4ienA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9869 1 145 3.10.129.10
1vpmB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9675 7 148 3.10.129.10
af_F1R1X8_276_424_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9643 7 142 3.10.129.10
2q2bB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9539 7 145 3.10.129.10
af_Q91V12_220_381_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9537 7 151 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2Z3IDM6-F1-model_v4 Acyl-CoA thioesterase 0.9971 5 150 GO:0005829
GO:0006637
GO:0052816
AF-D0LD77-F1-model_v4 Thioesterase superfamily protein 0.9953 5 149 GO:0005829
GO:0006637
GO:0052816
AF-F6EKZ5-F1-model_v4 Putative acyl-coA thioester hydrolase 0.9947 6 156 GO:0005829
GO:0006637
GO:0052816
AF-A0A2E1GD44-F1-model_v4 deleted 0.9947 5 149
AF-A0A7C9G8B4-F1-model_v4 Acyl-CoA thioesterase 0.9947 3 148 GO:0005829
GO:0006637
GO:0052816

Feature Viewer

pLDDT pTM Quality
93.67 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map