F458220
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 518 | 301 | 509 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10040937|Ga0070709_100409373 |
| Length | 289 |
| Sequence | VRRLVVLDKRFIAIALNTIFQGLDWRQRLFERGQFNFSKSVGEVSHHRASELEWTGLAQDAARKEVSYADFLEQLLAIENGARLERQRDTLMKLATLPSVKTLEQYDFGFASGAPRAQIQELASLTFIERAENVVFLGPSGVGKSHLAQALAYRAVMAGIKSRFITAADLMLQLATARKQERLREYFNRAVVGPRLLIIDEIGYLPFGREEANLLFNVVAKRYERGSIILTSNLAFAQWSSAFADDKTLTAALLDRLLHHAHIVQIGGESYRLKDKRKAGQAHKRAKAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 2 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 3 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 4 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 5 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 6 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 7 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 8 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 109 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 112 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 197 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 201 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 202 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 203 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 204 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 205 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 206 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 207 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 208 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 209 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 210 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 211 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 212 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 213 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 214 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 270 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 271 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 301 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.26 |
| Metatranscriptomes | 0 |
| Isolates | 1.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0.77 |
| Rhizoplane | 2.51 |
| Rhizosphere | 92.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1003937 | 3300002076 | Bacteria | 2069 |
| 2 | JGI24744J21845_10012598 | 3300002077 | Bacteria | 1713 |
| 3 | JGI24742J22300_10005870 | 3300002244 | Bacteria | 2022 |
| 4 | JGI24751J29686_10033234 | 3300002459 | Bacteria | 1069 |
| 5 | rootH2_10056772 | 3300003320 | Bacteria | 3776 |
| 6 | Ga0065712_10103972 | 3300005290 | Bacteria | 1972 |
| 7 | Ga0065715_10105084 | 3300005293 | Bacteria | 2887 |
| 8 | Ga0065715_10143805 | 3300005293 | Bacteria | 1816 |
| 9 | Ga0070676_10073703 | 3300005328 | Bacteria | 2054 |
| 10 | Ga0070683_100265719 | 3300005329 | Bacteria | 1632 |
| 11 | Ga0070690_100245971 | 3300005330 | Bacteria | 1263 |
| 12 | Ga0070690_100258411 | 3300005330 | Bacteria | 1235 |
| 13 | Ga0070690_100359825 | 3300005330 | Bacteria | 1058 |
| 14 | Ga0070670_100067442 | 3300005331 | Bacteria | 3070 |
| 15 | Ga0070670_100122456 | 3300005331 | Bacteria | 2243 |
| 16 | Ga0070670_100141069 | 3300005331 | Bacteria | 2084 |
| 17 | Ga0070670_100157144 | 3300005331 | Bacteria | 1970 |
| 18 | Ga0070677_10023543 | 3300005333 | Bacteria | 2282 |
| 19 | Ga0068869_100182010 | 3300005334 | Bacteria | 1648 |
| 20 | Ga0070666_10089482 | 3300005335 | Bacteria | 2113 |
| 21 | Ga0070666_10260734 | 3300005335 | Bacteria | 1229 |
| 22 | Ga0070680_100095994 | 3300005336 | Bacteria | 2458 |
| 23 | Ga0070680_100107802 | 3300005336 | Bacteria | 2317 |
| 24 | Ga0070680_100420659 | 3300005336 | Bacteria | 1140 |
| 25 | Ga0068868_100088988 | 3300005338 | Bacteria | 2485 |
| 26 | Ga0068868_100119345 | 3300005338 | Bacteria | 2150 |
| 27 | Ga0070660_100167148 | 3300005339 | Bacteria | 1775 |
| 28 | Ga0070689_100064573 | 3300005340 | Bacteria | 2850 |
| 29 | Ga0070689_100515733 | 3300005340 | Bacteria | 1026 |
| 30 | Ga0070661_100061698 | 3300005344 | Bacteria | 2752 |
| 31 | Ga0070661_100195661 | 3300005344 | Bacteria | 1543 |
| 32 | Ga0070661_100331945 | 3300005344 | Bacteria | 1189 |
| 33 | Ga0070668_100073141 | 3300005347 | Bacteria | 2672 |
| 34 | Ga0070668_100089672 | 3300005347 | Bacteria | 2422 |
| 35 | Ga0070669_100046015 | 3300005353 | Bacteria | 3181 |
| 36 | Ga0070675_100083460 | 3300005354 | Bacteria | 2667 |
| 37 | Ga0070675_100087360 | 3300005354 | Bacteria | 2607 |
| 38 | Ga0070675_100117879 | 3300005354 | Bacteria | 2253 |
| 39 | Ga0070671_100137778 | 3300005355 | Bacteria | 2058 |
| 40 | Ga0070671_100232151 | 3300005355 | Bacteria | 1565 |
| 41 | Ga0070671_100235148 | 3300005355 | Bacteria | 1555 |
| 42 | Ga0070674_100089011 | 3300005356 | Bacteria | 2223 |
| 43 | Ga0070673_100112222 | 3300005364 | Bacteria | 2262 |
| 44 | Ga0070673_100120356 | 3300005364 | Bacteria | 2189 |
| 45 | Ga0070673_100315049 | 3300005364 | Bacteria | 1381 |
| 46 | Ga0070688_100074859 | 3300005365 | Bacteria | 2175 |
| 47 | Ga0070688_100133065 | 3300005365 | Bacteria | 1680 |
| 48 | Ga0070688_100340785 | 3300005365 | Bacteria | 1095 |
| 49 | Ga0070659_100309367 | 3300005366 | Bacteria | 1319 |
| 50 | Ga0070667_100150761 | 3300005367 | Bacteria | 2042 |
| 51 | Ga0070667_100265588 | 3300005367 | Bacteria | 1538 |
| 52 | Ga0070667_100520733 | 3300005367 | Bacteria | 1091 |
| 53 | Ga0070709_10040937 | 3300005434 | Bacteria | 2852 |
| 54 | Ga0070714_100075935 | 3300005435 | Bacteria | 2916 |
| 55 | Ga0070714_100117967 | 3300005435 | Bacteria | 2357 |
| 56 | Ga0070714_100206950 | 3300005435 | Bacteria | 1797 |
| 57 | Ga0070713_100053706 | 3300005436 | Bacteria | 3339 |
| 58 | Ga0070713_100085390 | 3300005436 | Bacteria | 2704 |
| 59 | Ga0070713_100369770 | 3300005436 | Bacteria | 1334 |
| 60 | Ga0070710_10041289 | 3300005437 | Bacteria | 2546 |
| 61 | Ga0070711_100064589 | 3300005439 | Bacteria | 2558 |
| 62 | Ga0070711_100406074 | 3300005439 | Bacteria | 1107 |
| 63 | Ga0070705_100060089 | 3300005440 | Bacteria | 2253 |
| 64 | Ga0070705_100463650 | 3300005440 | Bacteria | 953 |
| 65 | Ga0070705_100506666 | 3300005440 | Bacteria | 917 |
| 66 | Ga0070700_100072891 | 3300005441 | Bacteria | 2197 |
| 67 | Ga0070708_100506761 | 3300005445 | Bacteria | 1138 |
| 68 | Ga0070678_100105002 | 3300005456 | Bacteria | 2198 |
| 69 | Ga0070662_100125166 | 3300005457 | Bacteria | 1975 |
| 70 | Ga0070662_100368940 | 3300005457 | Bacteria | 1179 |
| 71 | Ga0070681_10129528 | 3300005458 | Bacteria | 2455 |
| 72 | Ga0070681_10138252 | 3300005458 | Bacteria | 2366 |
| 73 | Ga0070681_10167847 | 3300005458 | Bacteria | 2117 |
| 74 | Ga0070681_10177082 | 3300005458 | Bacteria | 2055 |
| 75 | Ga0070681_10215125 | 3300005458 | Bacteria | 1838 |
| 76 | Ga0070681_10471025 | 3300005458 | Bacteria | 1169 |
| 77 | Ga0068867_100075942 | 3300005459 | Bacteria | 2522 |
| 78 | Ga0070685_10065462 | 3300005466 | Bacteria | 2139 |
| 79 | Ga0070685_10248247 | 3300005466 | Bacteria | 1178 |
| 80 | Ga0070707_100137976 | 3300005468 | Bacteria | 2373 |
| 81 | Ga0070698_100134342 | 3300005471 | Bacteria | 2428 |
| 82 | Ga0070698_100149087 | 3300005471 | Bacteria | 2287 |
| 83 | Ga0070699_100052661 | 3300005518 | Bacteria | 3521 |
| 84 | Ga0070679_100025401 | 3300005530 | Bacteria | 5812 |
| 85 | Ga0070679_100070314 | 3300005530 | Bacteria | 3492 |
| 86 | Ga0070679_100125216 | 3300005530 | Bacteria | 2552 |
| 87 | Ga0070679_100164621 | 3300005530 | Bacteria | 2192 |
| 88 | Ga0068853_100227771 | 3300005539 | Bacteria | 1704 |
| 89 | Ga0068853_100498966 | 3300005539 | Bacteria | 1149 |
| 90 | Ga0068853_100655691 | 3300005539 | Bacteria | 999 |
| 91 | Ga0070672_100118609 | 3300005543 | Bacteria | 2164 |
| 92 | Ga0070672_100131379 | 3300005543 | Bacteria | 2058 |
| 93 | Ga0070686_100102748 | 3300005544 | Bacteria | 1933 |
| 94 | Ga0070696_100252479 | 3300005546 | Bacteria | 1334 |
| 95 | Ga0070665_100116582 | 3300005548 | Bacteria | 2673 |
| 96 | Ga0070665_100383700 | 3300005548 | Bacteria | 1412 |
| 97 | Ga0068855_100173775 | 3300005563 | Bacteria | 2439 |
| 98 | Ga0068855_100549678 | 3300005563 | Bacteria | 1250 |
| 99 | Ga0068855_100806612 | 3300005563 | Bacteria | 997 |
| 100 | Ga0070664_100058215 | 3300005564 | Bacteria | 3286 |
| 101 | Ga0070664_100089788 | 3300005564 | Bacteria | 2659 |
| 102 | Ga0070664_100127752 | 3300005564 | Bacteria | 2231 |
| 103 | Ga0070664_100131848 | 3300005564 | Bacteria | 2196 |
| 104 | Ga0070664_100143598 | 3300005564 | Bacteria | 2103 |
| 105 | Ga0070664_100722149 | 3300005564 | Bacteria | 929 |
| 106 | Ga0068857_100160535 | 3300005577 | Bacteria | 2040 |
| 107 | Ga0068857_100175341 | 3300005577 | Bacteria | 1950 |
| 108 | Ga0068854_100099866 | 3300005578 | Bacteria | 2174 |
| 109 | Ga0068854_100268478 | 3300005578 | Bacteria | 1369 |
| 110 | Ga0068854_100432444 | 3300005578 | Bacteria | 1095 |
| 111 | Ga0068856_100247335 | 3300005614 | Bacteria | 1799 |
| 112 | Ga0070702_100098071 | 3300005615 | Bacteria | 1792 |
| 113 | Ga0070702_100292131 | 3300005615 | Bacteria | 1124 |
| 114 | Ga0070702_100358808 | 3300005615 | Bacteria | 1029 |
| 115 | Ga0068852_100093693 | 3300005616 | Bacteria | 2693 |
| 116 | Ga0068852_100161675 | 3300005616 | Bacteria | 2091 |
| 117 | Ga0068852_100205922 | 3300005616 | Bacteria | 1864 |
| 118 | Ga0068859_100224205 | 3300005617 | Bacteria | 1968 |
| 119 | Ga0068864_100008276 | 3300005618 | Bacteria | 8579 |
| 120 | Ga0068864_100094049 | 3300005618 | Bacteria | 2648 |
| 121 | Ga0068864_100151258 | 3300005618 | Bacteria | 2102 |
| 122 | Ga0068864_100229828 | 3300005618 | Bacteria | 1715 |
| 123 | Ga0068861_100067495 | 3300005719 | Bacteria | 2761 |
| 124 | Ga0068861_100247120 | 3300005719 | Bacteria | 1520 |
| 125 | Ga0068861_100271981 | 3300005719 | Bacteria | 1455 |
| 126 | Ga0068851_10041699 | 3300005834 | Bacteria | 2309 |
| 127 | Ga0068870_10045027 | 3300005840 | Bacteria | 2308 |
| 128 | Ga0068870_10110698 | 3300005840 | Bacteria | 1567 |
| 129 | Ga0068863_100145674 | 3300005841 | Bacteria | 2265 |
| 130 | Ga0068863_100190910 | 3300005841 | Bacteria | 1968 |
| 131 | Ga0068858_100144708 | 3300005842 | Bacteria | 2232 |
| 132 | Ga0068860_100161532 | 3300005843 | Bacteria | 2160 |
| 133 | Ga0068860_100175815 | 3300005843 | Bacteria | 2069 |
| 134 | Ga0068862_100111473 | 3300005844 | Bacteria | 2402 |
| 135 | Ga0068862_100149621 | 3300005844 | Bacteria | 2077 |
| 136 | Ga0070717_10079634 | 3300006028 | Bacteria | 2747 |
| 137 | Ga0070717_10256784 | 3300006028 | Bacteria | 1545 |
| 138 | Ga0070717_10378538 | 3300006028 | Bacteria | 1269 |
| 139 | Ga0070716_100075329 | 3300006173 | Bacteria | 1997 |
| 140 | Ga0070716_100102769 | 3300006173 | Bacteria | 1756 |
| 141 | Ga0070712_100069380 | 3300006175 | Bacteria | 2514 |
| 142 | Ga0070712_100105560 | 3300006175 | Bacteria | 2092 |
| 143 | Ga0097621_100144105 | 3300006237 | Bacteria | 2038 |
| 144 | Ga0097621_100358916 | 3300006237 | Bacteria | 1298 |
| 145 | Ga0068871_100258588 | 3300006358 | Bacteria | 1518 |
| 146 | Ga0068871_100313585 | 3300006358 | Bacteria | 1379 |
| 147 | Ga0075430_100103207 | 3300006846 | Bacteria | 2380 |
| 148 | Ga0075433_10456588 | 3300006852 | Bacteria | 1126 |
| 149 | Ga0068865_100106408 | 3300006881 | Bacteria | 2062 |
| 150 | Ga0097620_100224199 | 3300006931 | Bacteria | 1968 |
| 151 | Ga0099795_10065386 | 3300007788 | Bacteria | 1360 |
| 152 | Ga0105240_10220683 | 3300009093 | Bacteria | 2209 |
| 153 | Ga0105240_10352080 | 3300009093 | Bacteria | 1670 |
| 154 | Ga0105240_10514076 | 3300009093 | Bacteria | 1330 |
| 155 | Ga0105240_10690684 | 3300009093 | Bacteria | 1115 |
| 156 | Ga0111539_10116016 | 3300009094 | Bacteria | 3140 |
| 157 | Ga0105245_10091304 | 3300009098 | Bacteria | 2802 |
| 158 | Ga0105247_10148029 | 3300009101 | Bacteria | 1545 |
| 159 | Ga0105241_10394841 | 3300009174 | Bacteria | 1212 |
| 160 | Ga0105241_10441635 | 3300009174 | Bacteria | 1149 |
| 161 | Ga0105248_10493050 | 3300009177 | Bacteria | 1381 |
| 162 | Ga0105238_10112851 | 3300009551 | Bacteria | 2698 |
| 163 | Ga0105238_10404798 | 3300009551 | Bacteria | 1358 |
| 164 | Ga0105249_10209316 | 3300009553 | Bacteria | 1913 |
| 165 | Ga0105249_10736125 | 3300009553 | Bacteria | 1048 |
| 166 | Ga0099796_10026560 | 3300010159 | Bacteria | 1840 |
| 167 | Ga0105239_10226068 | 3300010375 | Bacteria | 2099 |
| 168 | Ga0105246_10024267 | 3300011119 | Bacteria | 3937 |
| 169 | Ga0157373_10337425 | 3300013100 | Bacteria | 1074 |
| 170 | Ga0157370_10104587 | 3300013104 | Bacteria | 2650 |
| 171 | Ga0157370_10121116 | 3300013104 | Bacteria | 2442 |
| 172 | Ga0157370_10158350 | 3300013104 | Bacteria | 2107 |
| 173 | Ga0157370_10179084 | 3300013104 | Bacteria | 1970 |
| 174 | Ga0157370_10230097 | 3300013104 | Bacteria | 1716 |
| 175 | Ga0157370_10317482 | 3300013104 | Bacteria | 1437 |
| 176 | Ga0157369_10059593 | 3300013105 | Bacteria | 4116 |
| 177 | Ga0157369_10128761 | 3300013105 | Bacteria | 2683 |
| 178 | Ga0157369_10183345 | 3300013105 | Bacteria | 2202 |
| 179 | Ga0157369_10222949 | 3300013105 | Bacteria | 1973 |
| 180 | Ga0157374_10147663 | 3300013296 | Bacteria | 2285 |
| 181 | Ga0157378_10138132 | 3300013297 | Bacteria | 2261 |
| 182 | Ga0157378_10186151 | 3300013297 | Bacteria | 1956 |
| 183 | Ga0163162_10118518 | 3300013306 | Bacteria | 2749 |
| 184 | Ga0163162_10154383 | 3300013306 | Bacteria | 2415 |
| 185 | Ga0163162_10202111 | 3300013306 | Bacteria | 2116 |
| 186 | Ga0163162_10266147 | 3300013306 | Bacteria | 1846 |
| 187 | Ga0157372_10231043 | 3300013307 | Bacteria | 2144 |
| 188 | Ga0157375_10056372 | 3300013308 | Bacteria | 3879 |
| 189 | Ga0157375_10093524 | 3300013308 | Bacteria | 3072 |
| 190 | Ga0157375_10145632 | 3300013308 | Bacteria | 2500 |
| 191 | Ga0163163_10138699 | 3300014325 | Bacteria | 2473 |
| 192 | Ga0163163_10492773 | 3300014325 | Bacteria | 1287 |
| 193 | Ga0157380_10036341 | 3300014326 | Bacteria | 3810 |
| 194 | Ga0157380_10063179 | 3300014326 | Bacteria | 2968 |
| 195 | Ga0157379_10148564 | 3300014968 | Bacteria | 2114 |
| 196 | Ga0157376_10047001 | 3300014969 | Bacteria | 3562 |
| 197 | Ga0157376_10297916 | 3300014969 | Bacteria | 1525 |
| 198 | Ga0157376_10389167 | 3300014969 | Bacteria | 1345 |
| 199 | Ga0163161_10070026 | 3300017792 | Bacteria | 2565 |
| 200 | Ga0163161_10091147 | 3300017792 | Bacteria | 2256 |
| 201 | Ga0163161_10091695 | 3300017792 | Bacteria | 2249 |
| 202 | Ga0213873_10009512 | 3300021358 | Bacteria | 2021 |
| 203 | Ga0213873_10033856 | 3300021358 | Bacteria | 1284 |
| 204 | Ga0213873_10038007 | 3300021358 | Bacteria | 1228 |
| 205 | Ga0213874_10020086 | 3300021377 | Bacteria | 1827 |
| 206 | Ga0213876_10040373 | 3300021384 | Bacteria | 2465 |
| 207 | Ga0213876_10054804 | 3300021384 | Bacteria | 2104 |
| 208 | Ga0213871_10047324 | 3300021441 | Bacteria | 1169 |
| 209 | Ga0209435_101466 | 3300025206 | Bacteria | 2968 |
| 210 | Ga0207666_1016202 | 3300025271 | Bacteria | 1067 |
| 211 | Ga0207697_10036379 | 3300025315 | Bacteria | 2016 |
| 212 | Ga0207682_10021515 | 3300025893 | Bacteria | 2538 |
| 213 | Ga0207692_10240908 | 3300025898 | Bacteria | 1080 |
| 214 | Ga0207710_10075360 | 3300025900 | Bacteria | 1555 |
| 215 | Ga0207688_10014136 | 3300025901 | Bacteria | 4342 |
| 216 | Ga0207680_10066983 | 3300025903 | Bacteria | 2210 |
| 217 | Ga0207647_10048246 | 3300025904 | Bacteria | 2645 |
| 218 | Ga0207699_10066938 | 3300025906 | Bacteria | 2182 |
| 219 | Ga0207699_10109795 | 3300025906 | Bacteria | 1766 |
| 220 | Ga0207645_10067510 | 3300025907 | Bacteria | 2286 |
| 221 | Ga0207643_10032105 | 3300025908 | Bacteria | 2930 |
| 222 | Ga0207643_10054976 | 3300025908 | Bacteria | 2263 |
| 223 | Ga0207684_10136420 | 3300025910 | Bacteria | 2107 |
| 224 | Ga0207707_10062471 | 3300025912 | Bacteria | 3241 |
| 225 | Ga0207707_10149399 | 3300025912 | Bacteria | 2043 |
| 226 | Ga0207707_10153764 | 3300025912 | Bacteria | 2011 |
| 227 | Ga0207707_10160182 | 3300025912 | Bacteria | 1968 |
| 228 | Ga0207707_10186855 | 3300025912 | Bacteria | 1808 |
| 229 | Ga0207707_10432859 | 3300025912 | Bacteria | 1127 |
| 230 | Ga0207695_10181649 | 3300025913 | Bacteria | 2024 |
| 231 | Ga0207695_10192941 | 3300025913 | Bacteria | 1954 |
| 232 | Ga0207695_10372456 | 3300025913 | Bacteria | 1314 |
| 233 | Ga0207693_10066417 | 3300025915 | Bacteria | 2824 |
| 234 | Ga0207693_10094351 | 3300025915 | Bacteria | 2345 |
| 235 | Ga0207693_10215517 | 3300025915 | Bacteria | 1509 |
| 236 | Ga0207663_10358326 | 3300025916 | Bacteria | 1106 |
| 237 | Ga0207663_10501484 | 3300025916 | Bacteria | 943 |
| 238 | Ga0207660_10136423 | 3300025917 | Bacteria | 1872 |
| 239 | Ga0207660_10312553 | 3300025917 | Bacteria | 1253 |
| 240 | Ga0207660_10386894 | 3300025917 | Bacteria | 1125 |
| 241 | Ga0207662_10068695 | 3300025918 | Bacteria | 2140 |
| 242 | Ga0207657_10100005 | 3300025919 | Bacteria | 2408 |
| 243 | Ga0207657_10119739 | 3300025919 | Bacteria | 2166 |
| 244 | Ga0207657_10120308 | 3300025919 | Bacteria | 2161 |
| 245 | Ga0207649_10070043 | 3300025920 | Bacteria | 2235 |
| 246 | Ga0207649_10285762 | 3300025920 | Bacteria | 1201 |
| 247 | Ga0207652_10044871 | 3300025921 | Bacteria | 3768 |
| 248 | Ga0207652_10141467 | 3300025921 | Bacteria | 2151 |
| 249 | Ga0207652_10157723 | 3300025921 | Bacteria | 2033 |
| 250 | Ga0207646_10139776 | 3300025922 | Bacteria | 2181 |
| 251 | Ga0207646_10141114 | 3300025922 | Bacteria | 2170 |
| 252 | Ga0207681_10062538 | 3300025923 | Bacteria | 2563 |
| 253 | Ga0207694_10114617 | 3300025924 | Bacteria | 2147 |
| 254 | Ga0207650_10114365 | 3300025925 | Bacteria | 2093 |
| 255 | Ga0207650_10125464 | 3300025925 | Bacteria | 2003 |
| 256 | Ga0207650_10231430 | 3300025925 | Bacteria | 1491 |
| 257 | Ga0207659_10121360 | 3300025926 | Bacteria | 2003 |
| 258 | Ga0207659_10254798 | 3300025926 | Bacteria | 1425 |
| 259 | Ga0207659_10327330 | 3300025926 | Bacteria | 1266 |
| 260 | Ga0207687_10627628 | 3300025927 | Bacteria | 908 |
| 261 | Ga0207700_10028957 | 3300025928 | Bacteria | 3903 |
| 262 | Ga0207700_10259626 | 3300025928 | Bacteria | 1487 |
| 263 | Ga0207700_10320307 | 3300025928 | Bacteria | 1343 |
| 264 | Ga0207664_10135240 | 3300025929 | Bacteria | 2079 |
| 265 | Ga0207664_10159672 | 3300025929 | Bacteria | 1922 |
| 266 | Ga0207664_10171063 | 3300025929 | Bacteria | 1859 |
| 267 | Ga0207644_10224263 | 3300025931 | Bacteria | 1491 |
| 268 | Ga0207644_10248119 | 3300025931 | Bacteria | 1419 |
| 269 | Ga0207706_10058711 | 3300025933 | Bacteria | 3388 |
| 270 | Ga0207706_10087834 | 3300025933 | Bacteria | 2734 |
| 271 | Ga0207670_10048992 | 3300025936 | Bacteria | 2823 |
| 272 | Ga0207669_10082453 | 3300025937 | Bacteria | 2064 |
| 273 | Ga0207704_10080164 | 3300025938 | Bacteria | 2106 |
| 274 | Ga0207665_10082185 | 3300025939 | Bacteria | 2219 |
| 275 | Ga0207665_10085288 | 3300025939 | Bacteria | 2180 |
| 276 | Ga0207691_10065165 | 3300025940 | Bacteria | 3299 |
| 277 | Ga0207691_10066763 | 3300025940 | Bacteria | 3254 |
| 278 | Ga0207711_10013248 | 3300025941 | Bacteria | 6852 |
| 279 | Ga0207689_10137937 | 3300025942 | Bacteria | 2008 |
| 280 | Ga0207661_10107127 | 3300025944 | Bacteria | 2357 |
| 281 | Ga0207679_10085019 | 3300025945 | Bacteria | 2429 |
| 282 | Ga0207679_10391000 | 3300025945 | Bacteria | 1221 |
| 283 | Ga0207667_10189820 | 3300025949 | Bacteria | 2109 |
| 284 | Ga0207667_10533551 | 3300025949 | Bacteria | 1188 |
| 285 | Ga0207651_10072939 | 3300025960 | Bacteria | 2439 |
| 286 | Ga0207651_10118796 | 3300025960 | Bacteria | 2000 |
| 287 | Ga0207651_10388424 | 3300025960 | Bacteria | 1184 |
| 288 | Ga0207712_10126213 | 3300025961 | Bacteria | 1943 |
| 289 | Ga0207712_10537092 | 3300025961 | Bacteria | 1004 |
| 290 | Ga0207668_10060946 | 3300025972 | Bacteria | 2650 |
| 291 | Ga0207640_10150184 | 3300025981 | Bacteria | 1711 |
| 292 | Ga0207640_10279969 | 3300025981 | Bacteria | 1309 |
| 293 | Ga0207658_10118769 | 3300025986 | Bacteria | 2104 |
| 294 | Ga0207658_10123200 | 3300025986 | Bacteria | 2070 |
| 295 | Ga0207677_10111430 | 3300026023 | Bacteria | 2039 |
| 296 | Ga0207677_10230580 | 3300026023 | Bacteria | 1491 |
| 297 | Ga0207677_10350380 | 3300026023 | Bacteria | 1237 |
| 298 | Ga0207703_10136158 | 3300026035 | Bacteria | 2126 |
| 299 | Ga0207678_10165235 | 3300026067 | Bacteria | 1890 |
| 300 | Ga0207708_10124733 | 3300026075 | Bacteria | 2009 |
| 301 | Ga0207702_10149949 | 3300026078 | Bacteria | 2120 |
| 302 | Ga0207641_10167151 | 3300026088 | Bacteria | 2004 |
| 303 | Ga0207641_10282991 | 3300026088 | Bacteria | 1560 |
| 304 | Ga0207641_10529774 | 3300026088 | Bacteria | 1147 |
| 305 | Ga0207648_10089116 | 3300026089 | Bacteria | 2694 |
| 306 | Ga0207676_10131370 | 3300026095 | Bacteria | 2129 |
| 307 | Ga0207676_10210815 | 3300026095 | Bacteria | 1723 |
| 308 | Ga0207674_10077032 | 3300026116 | Bacteria | 3341 |
| 309 | Ga0207674_10165649 | 3300026116 | Bacteria | 2164 |
| 310 | Ga0207675_100102917 | 3300026118 | Bacteria | 2691 |
| 311 | Ga0207675_100142026 | 3300026118 | Bacteria | 2281 |
| 312 | Ga0207675_100423492 | 3300026118 | Bacteria | 1315 |
| 313 | Ga0207683_10132764 | 3300026121 | Bacteria | 2240 |
| 314 | Ga0207683_10145618 | 3300026121 | Bacteria | 2136 |
| 315 | Ga0207698_10152090 | 3300026142 | Bacteria | 2010 |
| 316 | Ga0207428_10091740 | 3300027907 | Bacteria | 2358 |
| 317 | Ga0207428_10113056 | 3300027907 | Bacteria | 2088 |
| 318 | Ga0268266_10146810 | 3300028379 | Bacteria | 2121 |
| 319 | Ga0268265_10145882 | 3300028380 | Bacteria | 1988 |
| 320 | Ga0268264_10159076 | 3300028381 | Bacteria | 2033 |
| 321 | Ga0268264_10382729 | 3300028381 | Bacteria | 1348 |
| 322 | Ga0265338_10075613 | 3300028800 | Bacteria | 2857 |
| 323 | Ga0265338_10117617 | 3300028800 | Bacteria | 2126 |
| 324 | Ga0307413_10093061 | 3300031824 | Bacteria | 1969 |
| 325 | Ga0307412_10338004 | 3300031911 | Bacteria | 1204 |
| 326 | Ga0307416_100795143 | 3300032002 | Bacteria | 1041 |
| 327 | Ga0373934_0028728 | 3300035086 | Bacteria | 2169 |
| 328 | Ga0373932_0080826 | 3300035112 | Bacteria | 1026 |
| 329 | Ga0373954_0047922 | 3300035118 | Bacteria | 2001 |
| 330 | Ga0373954_0074941 | 3300035118 | Bacteria | 1611 |
| 331 | Ga0373955_0047321 | 3300035172 | Bacteria | 2328 |
| 332 | Ga0373955_0068463 | 3300035172 | Bacteria | 1978 |
| 333 | Ga0373924_0059572 | 3300035410 | Bacteria | 1595 |
| 334 | Ga0373931_0128609 | 3300035691 | Bacteria | 1455 |
| 335 | Ga0373935_0254799 | 3300035692 | Bacteria | 1229 |
| 336 | Ga0373933_0079997 | 3300035724 | Bacteria | 2002 |
| 337 | Ga0373947_0114259 | 3300035725 | Bacteria | 1709 |
| 338 | Ga0373937_0131816 | 3300036401 | Bacteria | 2334 |
| 339 | Ga0373937_0171879 | 3300036401 | Bacteria | 2033 |
| 340 | Ga0373925_0088463 | 3300037068 | Bacteria | 2365 |
| 341 | Ga0395899_0068292 | 3300037312 | Bacteria | 2606 |
| 342 | Ga0395899_0104975 | 3300037312 | Bacteria | 2036 |
| 343 | Ga0395899_0111945 | 3300037312 | Bacteria | 1961 |
| 344 | Ga0395900_0000813 | 3300037418 | Bacteria | 41294 |
| 345 | Ga0395900_0021498 | 3300037418 | Bacteria | 6598 |
| 346 | Ga0395900_0225008 | 3300037418 | Bacteria | 1889 |
| 347 | Ga0395898_0015147 | 3300037466 | Bacteria | 7915 |
| 348 | Ga0395898_0098657 | 3300037466 | Bacteria | 2805 |
| 349 | Ga0395898_0150555 | 3300037466 | Bacteria | 2226 |
| 350 | Ga0395905_0153572 | 3300037471 | Bacteria | 2165 |
| 351 | Ga0395901_0005318 | 3300038443 | Bacteria | 13006 |
| 352 | Ga0395901_0033513 | 3300038443 | Bacteria | 5302 |
| 353 | Ga0395901_0224732 | 3300038443 | Bacteria | 1961 |
| 354 | Ga0436365_0277082 | 3300039437 | Bacteria | 4021 |
| 355 | Ga0436365_0752475 | 3300039437 | Bacteria | 2909 |
| 356 | Ga0436365_0755302 | 3300039437 | Bacteria | 2021 |
| 357 | Ga0436365_1166190 | 3300039437 | Bacteria | 2416 |
| 358 | Ga0436365_1367102 | 3300039437 | Bacteria | 2034 |
| 359 | Ga0436365_1792257 | 3300039437 | Bacteria | 1719 |
| 360 | Ga0436365_1801881 | 3300039437 | Bacteria | 2421 |
| 361 | Ga0436360_0647305 | 3300039438 | Bacteria | 2216 |
| 362 | Ga0436360_0678977 | 3300039438 | Bacteria | 1073 |
| 363 | Ga0436360_1060473 | 3300039438 | Bacteria | 1591 |
| 364 | Ga0436361_0032161 | 3300039447 | Bacteria | 2333 |
| 365 | Ga0436361_0474349 | 3300039447 | Bacteria | 1845 |
| 366 | Ga0436363_0188014 | 3300039450 | Bacteria | 1433 |
| 367 | Ga0436363_0299772 | 3300039450 | Bacteria | 1384 |
| 368 | Ga0436363_1710797 | 3300039450 | Bacteria | 974 |
| 369 | Ga0436362_0129397 | 3300039453 | Bacteria | 2654 |
| 370 | Ga0436362_0305935 | 3300039453 | Bacteria | 1625 |
| 371 | Ga0439464_0013228 | 3300042439 | Bacteria | 2206 |
| 372 | Ga0466969_0056378 | 3300044656 | Bacteria | 1918 |
| 373 | Ga0466966_0125926 | 3300044684 | Bacteria | 1571 |
| 374 | Ga0466961_0097149 | 3300044693 | Bacteria | 1857 |
| 375 | Ga0466961_0136521 | 3300044693 | Bacteria | 1536 |
| 376 | Ga0466963_0157818 | 3300044694 | Bacteria | 1578 |
| 377 | Ga0466964_0037142 | 3300044706 | Bacteria | 1955 |
| 378 | Ga0466964_0086847 | 3300044706 | Bacteria | 1354 |
| 379 | Ga0453684_0482510 | 3300044712 | Bacteria | 1375 |
| 380 | Ga0466971_0010586 | 3300044719 | Bacteria | 4032 |
| 381 | Ga0466971_0121471 | 3300044719 | Bacteria | 1209 |
| 382 | Ga0466970_0293191 | 3300044765 | Bacteria | 916 |
| 383 | Ga0466957_0151404 | 3300044842 | Bacteria | 1500 |
| 384 | Ga0466959_0105952 | 3300045049 | Bacteria | 2010 |
| 385 | Ga0466959_0389067 | 3300045049 | Bacteria | 948 |
| 386 | Ga0451576_0189110 | 3300045051 | Bacteria | 2150 |
| 387 | Ga0466958_0345452 | 3300045836 | Bacteria | 957 |
| 388 | Ga0466967_0184917 | 3300045976 | Bacteria | 1967 |
| 389 | Ga0495592_0089700 | 3300046454 | Bacteria | 2207 |
| 390 | Ga0495629_0073541 | 3300046459 | Bacteria | 2386 |
| 391 | Ga0495629_0091385 | 3300046459 | Bacteria | 2124 |
| 392 | Ga0495629_0194251 | 3300046459 | Bacteria | 1404 |
| 393 | Ga0495651_0105013 | 3300046462 | Bacteria | 2096 |
| 394 | Ga0495653_0100542 | 3300046463 | Bacteria | 2096 |
| 395 | Ga0495653_0104680 | 3300046463 | Bacteria | 2044 |
| 396 | Ga0495580_0079412 | 3300046472 | Bacteria | 2288 |
| 397 | Ga0495582_0026138 | 3300046473 | Bacteria | 3199 |
| 398 | Ga0495582_0139892 | 3300046473 | Bacteria | 1371 |
| 399 | Ga0495606_0014640 | 3300046507 | Bacteria | 6102 |
| 400 | Ga0495608_0062508 | 3300046511 | Bacteria | 2446 |
| 401 | Ga0495618_0078108 | 3300046514 | Bacteria | 2109 |
| 402 | Ga0495628_0076190 | 3300046516 | Bacteria | 2610 |
| 403 | Ga0495628_0114907 | 3300046516 | Bacteria | 2067 |
| 404 | Ga0495630_0082599 | 3300046517 | Bacteria | 2425 |
| 405 | Ga0495630_0102276 | 3300046517 | Bacteria | 2167 |
| 406 | Ga0495666_0141074 | 3300046526 | Bacteria | 1123 |
| 407 | Ga0495652_0118476 | 3300046529 | Bacteria | 2116 |
| 408 | Ga0495665_0053720 | 3300046531 | Bacteria | 2129 |
| 409 | Ga0495640_0067653 | 3300046533 | Bacteria | 2405 |
| 410 | Ga0495587_0063620 | 3300046536 | Bacteria | 2157 |
| 411 | Ga0495667_0069602 | 3300046559 | Bacteria | 2296 |
| 412 | Ga0495634_0063061 | 3300046642 | Bacteria | 2460 |
| 413 | Ga0495634_0264096 | 3300046642 | Bacteria | 1049 |
| 414 | Ga0495635_0064311 | 3300046663 | Bacteria | 2518 |
| 415 | Ga0495657_0082026 | 3300046675 | Bacteria | 2084 |
| 416 | Ga0495657_0165935 | 3300046675 | Bacteria | 1363 |
| 417 | Ga0495599_0065520 | 3300046678 | Bacteria | 2269 |
| 418 | Ga0495623_0021590 | 3300046679 | Bacteria | 4157 |
| 419 | Ga0495646_0078971 | 3300046680 | Bacteria | 1922 |
| 420 | Ga0495658_0023462 | 3300046683 | Bacteria | 3274 |
| 421 | Ga0495658_0048420 | 3300046683 | Bacteria | 2396 |
| 422 | Ga0495669_0051071 | 3300046684 | Bacteria | 1855 |
| 423 | Ga0495613_0093133 | 3300046689 | Bacteria | 2181 |
| 424 | Ga0495624_0057579 | 3300046690 | Bacteria | 2443 |
| 425 | Ga0495624_0248606 | 3300046690 | Bacteria | 1075 |
| 426 | Ga0495649_0043021 | 3300046694 | Bacteria | 2466 |
| 427 | Ga0495589_0056431 | 3300046794 | Bacteria | 1933 |
| 428 | Ga0495589_0082401 | 3300046794 | Bacteria | 1564 |
| 429 | Ga0495600_0087425 | 3300046809 | Bacteria | 2033 |
| 430 | Ga0495581_0264711 | 3300047315 | Bacteria | 1005 |
| 431 | Ga0495604_0089527 | 3300047317 | Bacteria | 2287 |
| 432 | Ga0495604_0108693 | 3300047317 | Bacteria | 2025 |
| 433 | Ga0495636_0198482 | 3300047318 | Bacteria | 915 |
| 434 | Ga0495674_0126805 | 3300047319 | Bacteria | 2152 |
| 435 | Ga0495676_0090641 | 3300047321 | Bacteria | 2287 |
| 436 | Ga0495680_0059341 | 3300047322 | Bacteria | 2953 |
| 437 | Ga0495680_0107451 | 3300047322 | Bacteria | 2072 |
| 438 | Ga0495680_0241045 | 3300047322 | Bacteria | 1284 |
| 439 | Ga0495683_0045344 | 3300047323 | Bacteria | 2209 |
| 440 | Ga0495675_0077139 | 3300047444 | Bacteria | 2099 |
| 441 | Ga0495679_024039 | 3300047446 | Bacteria | 2058 |
| 442 | Ga0495673_0040942 | 3300047469 | Bacteria | 2089 |
| 443 | Ga0495684_0060076 | 3300047471 | Bacteria | 2894 |
| 444 | Ga0495686_0112137 | 3300047472 | Bacteria | 1634 |
| 445 | Ga0495593_0051876 | 3300047673 | Bacteria | 2169 |
| 446 | Ga0495602_0124798 | 3300048088 | Bacteria | 2064 |
| 447 | Ga0495614_0036808 | 3300048089 | Bacteria | 2100 |
| 448 | Ga0495614_0057073 | 3300048089 | Bacteria | 1676 |
| 449 | Ga0496101_0551542 | 3300048904 | Bacteria | 911 |
| 450 | Ga0496102_0335832 | 3300048905 | Bacteria | 1423 |
| 451 | Ga0496104_0047528 | 3300048907 | Bacteria | 4044 |
| 452 | Ga0496104_0481416 | 3300048907 | Bacteria | 1152 |
| 453 | Ga0496105_0163114 | 3300048908 | Bacteria | 1829 |
| 454 | Ga0496105_0293840 | 3300048908 | Bacteria | 1308 |
| 455 | Ga0496106_0106307 | 3300048909 | Bacteria | 2181 |
| 456 | Ga0496107_0075720 | 3300048910 | Bacteria | 2450 |
| 457 | Ga0496108_0100048 | 3300048911 | Bacteria | 2472 |
| 458 | Ga0496108_0569186 | 3300048911 | Bacteria | 988 |
| 459 | Ga0496109_0397308 | 3300048912 | Bacteria | 1302 |
| 460 | Ga0496110_0613516 | 3300048913 | Bacteria | 986 |
| 461 | Ga0496115_0321147 | 3300048918 | Bacteria | 1266 |
| 462 | Ga0496121_0152244 | 3300048924 | Bacteria | 1701 |
| 463 | Ga0496124_0000145 | 3300048927 | Bacteria | 146878 |
| 464 | Ga0501031_0012979 | 3300049568 | Bacteria | 5437 |
| 465 | Ga0501032_0018596 | 3300049569 | Bacteria | 4866 |
| 466 | Ga0501032_0095165 | 3300049569 | Bacteria | 1974 |
| 467 | Ga0501032_0195732 | 3300049569 | Bacteria | 1320 |
| 468 | Ga0501033_0020555 | 3300049570 | Bacteria | 4988 |
| 469 | Ga0501033_0049272 | 3300049570 | Bacteria | 3126 |
| 470 | Ga0501033_0115502 | 3300049570 | Bacteria | 1950 |
| 471 | Ga0501034_0180802 | 3300049571 | Bacteria | 2074 |
| 472 | Ga0501034_0197932 | 3300049571 | Bacteria | 1968 |
| 473 | Ga0501036_0030756 | 3300049572 | Bacteria | 4535 |
| 474 | Ga0501037_0032328 | 3300049573 | Bacteria | 3863 |
| 475 | Ga0501038_0014208 | 3300049574 | Bacteria | 7254 |
| 476 | Ga0501038_0063646 | 3300049574 | Bacteria | 3147 |
| 477 | Ga0501038_0142030 | 3300049574 | Bacteria | 1963 |
| 478 | Ga0501039_0117846 | 3300049575 | Bacteria | 2079 |
| 479 | Ga0501040_0014871 | 3300049576 | Bacteria | 5137 |
| 480 | Ga0501042_0103665 | 3300049578 | Bacteria | 2046 |
| 481 | Ga0501043_0108811 | 3300049579 | Bacteria | 2176 |
| 482 | Ga0501046_0088785 | 3300049580 | Bacteria | 2380 |
| 483 | Ga0501046_0108100 | 3300049580 | Bacteria | 2127 |
| 484 | Ga0501046_0395388 | 3300049580 | Bacteria | 999 |
| 485 | Ga0501047_0173243 | 3300049581 | Bacteria | 2026 |
| 486 | Ga0501048_0050602 | 3300049582 | Bacteria | 2958 |
| 487 | Ga0501048_0266551 | 3300049582 | Bacteria | 1217 |
| 488 | Ga0501068_0041866 | 3300049584 | Bacteria | 2753 |
| 489 | Ga0501069_0313150 | 3300049585 | Bacteria | 921 |
| 490 | Ga0501070_0107999 | 3300049586 | Bacteria | 2299 |
| 491 | Ga0501071_0123293 | 3300049587 | Bacteria | 1922 |
| 492 | Ga0501072_0144191 | 3300049588 | Bacteria | 1899 |
| 493 | Ga0501079_0378362 | 3300049741 | Bacteria | 1110 |
| 494 | Ga0501035_0025050 | 3300049822 | Bacteria | 5470 |
| 495 | Ga0501035_0043061 | 3300049822 | Bacteria | 4069 |
| 496 | Ga0501035_0323043 | 3300049822 | Bacteria | 1296 |
| 497 | Ga0501044_0151165 | 3300049823 | Bacteria | 2303 |
| 498 | Ga0501044_0185524 | 3300049823 | Bacteria | 2045 |
| 499 | Ga0501045_0073580 | 3300049824 | Bacteria | 2516 |
| 500 | nmdc:mga0qj67_252155_c1 | 3300050509 | Bacteria | 1432 |
| 501 | nmdc:mga08y16_106701_c1 | 3300050511 | Bacteria | 2916 |
| 502 | nmdc:mga08y16_45282_c1 | 3300050511 | Bacteria | 4610 |
| 503 | Ga0495601_0097843 | 3300053077 | Bacteria | 1893 |
| 504 | Ga0495595_0029968 | 3300053084 | Bacteria | 2438 |
| 505 | Ga0495595_0041746 | 3300053084 | Bacteria | 2100 |
| 506 | Ga0495619_0057446 | 3300053085 | Bacteria | 2582 |
| 507 | Ga0495619_0110582 | 3300053085 | Bacteria | 1877 |
| 508 | Ga0501084_0277880 | 3300054114 | Bacteria | 1414 |
| 509 | Ga0466962_0024434 | 3300061719 | Bacteria | 2902 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10230097 | Ga0157370_102300971 | 230 |
| 2 | 3300044693 | Ga0466961_0097149 | Ga0466961_0097149_80_832 | 239 |
| 3 | 3300044694 | Ga0466963_0157818 | Ga0466963_0157818_338_1090 | 239 |
| 4 | 3300044706 | Ga0466964_0086847 | Ga0466964_0086847_481_1233 | 239 |
| 5 | 3300045836 | Ga0466958_0345452 | Ga0466958_0345452_45_797 | 239 |
| 6 | 3300045976 | Ga0466967_0184917 | Ga0466967_0184917_1141_1893 | 239 |
| 7 | 3300009174 | Ga0105241_10394841 | Ga0105241_103948412 | 240 |
| 8 | 3300013104 | Ga0157370_10158350 | Ga0157370_101583503 | 240 |
| 9 | 3300044765 | Ga0466970_0293191 | Ga0466970_0293191_61_813 | 240 |
| 10 | 3300045049 | Ga0466959_0389067 | Ga0466959_0389067_136_888 | 240 |
| 11 | 3300028800 | Ga0265338_10117617 | Ga0265338_101176173 | 244 |
| 12 | 3300048904 | Ga0496101_0551542 | Ga0496101_0551542_11_754 | 247 |
| 13 | 3300037312 | Ga0395899_0104975 | Ga0395899_0104975_81_833 | 249 |
| 14 | 3300037418 | Ga0395900_0225008 | Ga0395900_0225008_671_1423 | 249 |
| 15 | 3300005338 | Ga0068868_100088988 | Ga0068868_1000889881 | 250 |
| 16 | 3300005354 | Ga0070675_100117879 | Ga0070675_1001178792 | 250 |
| 17 | 3300005355 | Ga0070671_100137778 | Ga0070671_1001377783 | 250 |
| 18 | 3300005364 | Ga0070673_100120356 | Ga0070673_1001203562 | 250 |
| 19 | 3300005466 | Ga0070685_10248247 | Ga0070685_102482472 | 250 |
| 20 | 3300005544 | Ga0070686_100102748 | Ga0070686_1001027482 | 250 |
| 21 | 3300005548 | Ga0070665_100383700 | Ga0070665_1003837001 | 250 |
| 22 | 3300014968 | Ga0157379_10148564 | Ga0157379_101485642 | 250 |
| 23 | 3300025926 | Ga0207659_10254798 | Ga0207659_102547982 | 250 |
| 24 | 3300025960 | Ga0207651_10388424 | Ga0207651_103884242 | 250 |
| 25 | 3300044719 | Ga0466971_0121471 | Ga0466971_0121471_309_1097 | 251 |
| 26 | 3300037312 | Ga0395899_0068292 | Ga0395899_0068292_713_1501 | 252 |
| 27 | 3300037312 | Ga0395899_0111945 | Ga0395899_0111945_73_861 | 252 |
| 28 | 3300037418 | Ga0395900_0000813 | Ga0395900_0000813_3861_4649 | 252 |
| 29 | 3300037418 | Ga0395900_0021498 | Ga0395900_0021498_74_862 | 252 |
| 30 | 3300037466 | Ga0395898_0015147 | Ga0395898_0015147_3341_4129 | 252 |
| 31 | 3300038443 | Ga0395901_0224732 | Ga0395901_0224732_74_862 | 252 |
| 32 | 3300044684 | Ga0466966_0125926 | Ga0466966_0125926_705_1493 | 252 |
| 33 | 3300044842 | Ga0466957_0151404 | Ga0466957_0151404_25_813 | 252 |
| 34 | 3300026088 | Ga0207641_10529774 | Ga0207641_105297741 | 255 |
| 35 | 3300005293 | Ga0065715_10143805 | Ga0065715_101438052 | 256 |
| 36 | 3300005330 | Ga0070690_100245971 | Ga0070690_1002459711 | 256 |
| 37 | 3300005330 | Ga0070690_100359825 | Ga0070690_1003598251 | 256 |
| 38 | 3300005331 | Ga0070670_100141069 | Ga0070670_1001410691 | 256 |
| 39 | 3300005331 | Ga0070670_100157144 | Ga0070670_1001571442 | 256 |
| 40 | 3300005335 | Ga0070666_10260734 | Ga0070666_102607342 | 256 |
| 41 | 3300005340 | Ga0070689_100515733 | Ga0070689_1005157332 | 256 |
| 42 | 3300005355 | Ga0070671_100232151 | Ga0070671_1002321512 | 256 |
| 43 | 3300005365 | Ga0070688_100133065 | Ga0070688_1001330652 | 256 |
| 44 | 3300005365 | Ga0070688_100340785 | Ga0070688_1003407851 | 256 |
| 45 | 3300005367 | Ga0070667_100265588 | Ga0070667_1002655882 | 256 |
| 46 | 3300005435 | Ga0070714_100117967 | Ga0070714_1001179672 | 256 |
| 47 | 3300005436 | Ga0070713_100085390 | Ga0070713_1000853902 | 256 |
| 48 | 3300005437 | Ga0070710_10041289 | Ga0070710_100412892 | 256 |
| 49 | 3300005439 | Ga0070711_100064589 | Ga0070711_1000645893 | 256 |
| 50 | 3300005439 | Ga0070711_100406074 | Ga0070711_1004060742 | 256 |
| 51 | 3300005440 | Ga0070705_100060089 | Ga0070705_1000600892 | 256 |
| 52 | 3300005440 | Ga0070705_100506666 | Ga0070705_1005066661 | 256 |
| 53 | 3300005445 | Ga0070708_100506761 | Ga0070708_1005067611 | 256 |
| 54 | 3300005457 | Ga0070662_100368940 | Ga0070662_1003689401 | 256 |
| 55 | 3300005458 | Ga0070681_10471025 | Ga0070681_104710252 | 256 |
| 56 | 3300005468 | Ga0070707_100137976 | Ga0070707_1001379762 | 256 |
| 57 | 3300005471 | Ga0070698_100134342 | Ga0070698_1001343422 | 256 |
| 58 | 3300005471 | Ga0070698_100149087 | Ga0070698_1001490872 | 256 |
| 59 | 3300005518 | Ga0070699_100052661 | Ga0070699_1000526612 | 256 |
| 60 | 3300005564 | Ga0070664_100722149 | Ga0070664_1007221491 | 256 |
| 61 | 3300005615 | Ga0070702_100292131 | Ga0070702_1002921312 | 256 |
| 62 | 3300005618 | Ga0068864_100094049 | Ga0068864_1000940492 | 256 |
| 63 | 3300005840 | Ga0068870_10110698 | Ga0068870_101106982 | 256 |
| 64 | 3300006028 | Ga0070717_10079634 | Ga0070717_100796342 | 256 |
| 65 | 3300006028 | Ga0070717_10256784 | Ga0070717_102567842 | 256 |
| 66 | 3300006173 | Ga0070716_100075329 | Ga0070716_1000753292 | 256 |
| 67 | 3300006175 | Ga0070712_100069380 | Ga0070712_1000693802 | 256 |
| 68 | 3300006175 | Ga0070712_100105560 | Ga0070712_1001055602 | 256 |
| 69 | 3300006237 | Ga0097621_100358916 | Ga0097621_1003589162 | 256 |
| 70 | 3300006852 | Ga0075433_10456588 | Ga0075433_104565882 | 256 |
| 71 | 3300007788 | Ga0099795_10065386 | Ga0099795_100653862 | 256 |
| 72 | 3300009098 | Ga0105245_10091304 | Ga0105245_100913042 | 256 |
| 73 | 3300009101 | Ga0105247_10148029 | Ga0105247_101480292 | 256 |
| 74 | 3300009177 | Ga0105248_10493050 | Ga0105248_104930502 | 256 |
| 75 | 3300009553 | Ga0105249_10209316 | Ga0105249_102093162 | 256 |
| 76 | 3300010159 | Ga0099796_10026560 | Ga0099796_100265602 | 256 |
| 77 | 3300010375 | Ga0105239_10226068 | Ga0105239_102260682 | 256 |
| 78 | 3300011119 | Ga0105246_10024267 | Ga0105246_100242672 | 256 |
| 79 | 3300013297 | Ga0157378_10138132 | Ga0157378_101381323 | 256 |
| 80 | 3300013306 | Ga0163162_10266147 | Ga0163162_102661472 | 256 |
| 81 | 3300013308 | Ga0157375_10093524 | Ga0157375_100935244 | 256 |
| 82 | 3300014325 | Ga0163163_10138699 | Ga0163163_101386992 | 256 |
| 83 | 3300014325 | Ga0163163_10492773 | Ga0163163_104927732 | 256 |
| 84 | 3300014969 | Ga0157376_10297916 | Ga0157376_102979161 | 256 |
| 85 | 3300014969 | Ga0157376_10389167 | Ga0157376_103891672 | 256 |
| 86 | 3300017792 | Ga0163161_10091147 | Ga0163161_100911472 | 256 |
| 87 | 3300021384 | Ga0213876_10054804 | Ga0213876_100548042 | 256 |
| 88 | 3300025900 | Ga0207710_10075360 | Ga0207710_100753602 | 256 |
| 89 | 3300025906 | Ga0207699_10066938 | Ga0207699_100669381 | 256 |
| 90 | 3300025908 | Ga0207643_10032105 | Ga0207643_100321053 | 256 |
| 91 | 3300025910 | Ga0207684_10136420 | Ga0207684_101364202 | 256 |
| 92 | 3300025912 | Ga0207707_10432859 | Ga0207707_104328591 | 256 |
| 93 | 3300025915 | Ga0207693_10066417 | Ga0207693_100664172 | 256 |
| 94 | 3300025915 | Ga0207693_10215517 | Ga0207693_102155171 | 256 |
| 95 | 3300025916 | Ga0207663_10358326 | Ga0207663_103583262 | 256 |
| 96 | 3300025916 | Ga0207663_10501484 | Ga0207663_105014842 | 256 |
| 97 | 3300025918 | Ga0207662_10068695 | Ga0207662_100686952 | 256 |
| 98 | 3300025922 | Ga0207646_10141114 | Ga0207646_101411142 | 256 |
| 99 | 3300025925 | Ga0207650_10231430 | Ga0207650_102314301 | 256 |
| 100 | 3300025927 | Ga0207687_10627628 | Ga0207687_106276281 | 256 |
| 101 | 3300025928 | Ga0207700_10028957 | Ga0207700_100289572 | 256 |
| 102 | 3300025929 | Ga0207664_10135240 | Ga0207664_101352402 | 256 |
| 103 | 3300025929 | Ga0207664_10159672 | Ga0207664_101596721 | 256 |
| 104 | 3300025931 | Ga0207644_10248119 | Ga0207644_102481192 | 256 |
| 105 | 3300025933 | Ga0207706_10087834 | Ga0207706_100878343 | 256 |
| 106 | 3300025939 | Ga0207665_10085288 | Ga0207665_100852882 | 256 |
| 107 | 3300026023 | Ga0207677_10111430 | Ga0207677_101114302 | 256 |
| 108 | 3300026023 | Ga0207677_10230580 | Ga0207677_102305802 | 256 |
| 109 | 3300026067 | Ga0207678_10165235 | Ga0207678_101652352 | 256 |
| 110 | 3300026075 | Ga0207708_10124733 | Ga0207708_101247332 | 256 |
| 111 | 3300026095 | Ga0207676_10210815 | Ga0207676_102108151 | 256 |
| 112 | 3300026121 | Ga0207683_10132764 | Ga0207683_101327642 | 256 |
| 113 | 3300026121 | Ga0207683_10145618 | Ga0207683_101456182 | 256 |
| 114 | 3300027907 | Ga0207428_10113056 | Ga0207428_101130562 | 256 |
| 115 | 3300037466 | Ga0395898_0150555 | Ga0395898_0150555_1227_1997 | 256 |
| 116 | 3300038443 | Ga0395901_0005318 | Ga0395901_0005318_1100_1870 | 256 |
| 117 | 3300039437 | Ga0436365_1166190 | Ga0436365_1166190_1252_2037 | 256 |
| 118 | 3300046459 | Ga0495629_0194251 | Ga0495629_0194251_55_825 | 256 |
| 119 | 3300046683 | Ga0495658_0048420 | Ga0495658_0048420_356_1141 | 256 |
| 120 | 3300047322 | Ga0495680_0241045 | Ga0495680_0241045_100_870 | 256 |
| 121 | 3300048907 | Ga0496104_0047528 | Ga0496104_0047528_3069_3854 | 256 |
| 122 | 3300048908 | Ga0496105_0293840 | Ga0496105_0293840_255_1040 | 256 |
| 123 | 3300048909 | Ga0496106_0106307 | Ga0496106_0106307_1306_2076 | 256 |
| 124 | 3300048910 | Ga0496107_0075720 | Ga0496107_0075720_1527_2297 | 256 |
| 125 | 3300048911 | Ga0496108_0100048 | Ga0496108_0100048_1545_2315 | 256 |
| 126 | 3300048912 | Ga0496109_0397308 | Ga0496109_0397308_422_1192 | 256 |
| 127 | 3300048913 | Ga0496110_0613516 | Ga0496110_0613516_13_783 | 256 |
| 128 | 3300049569 | Ga0501032_0018596 | Ga0501032_0018596_1954_2724 | 256 |
| 129 | 3300049570 | Ga0501033_0020555 | Ga0501033_0020555_181_951 | 256 |
| 130 | 3300049574 | Ga0501038_0014208 | Ga0501038_0014208_5323_6093 | 256 |
| 131 | 3300049580 | Ga0501046_0395388 | Ga0501046_0395388_144_929 | 256 |
| 132 | 3300049822 | Ga0501035_0025050 | Ga0501035_0025050_2735_3505 | 256 |
| 133 | 3300050511 | nmdc:mga08y16_106701_c1 | nmdc:mga08y16_106701_c1_1225_1995 | 256 |
| 134 | 3300021358 | Ga0213873_10009512 | Ga0213873_100095122 | 257 |
| 135 | 3300028800 | Ga0265338_10075613 | Ga0265338_100756132 | 257 |
| 136 | 3300035692 | Ga0373935_0254799 | Ga0373935_0254799_259_1047 | 257 |
| 137 | 3300035725 | Ga0373947_0114259 | Ga0373947_0114259_210_998 | 257 |
| 138 | 3300037068 | Ga0373925_0088463 | Ga0373925_0088463_347_1135 | 257 |
| 139 | 3300039437 | Ga0436365_0755302 | Ga0436365_0755302_529_1320 | 257 |
| 140 | 3300044693 | Ga0466961_0136521 | Ga0466961_0136521_580_1353 | 257 |
| 141 | 3300044712 | Ga0453684_0482510 | Ga0453684_0482510_364_1140 | 257 |
| 142 | 3300044719 | Ga0466971_0010586 | Ga0466971_0010586_633_1406 | 257 |
| 143 | 3300046472 | Ga0495580_0079412 | Ga0495580_0079412_226_1014 | 257 |
| 144 | 3300049585 | Ga0501069_0313150 | Ga0501069_0313150_64_837 | 257 |
| 145 | 3300049587 | Ga0501071_0123293 | Ga0501071_0123293_90_863 | 257 |
| 146 | 3300049588 | Ga0501072_0144191 | Ga0501072_0144191_112_885 | 257 |
| 147 | 3300054114 | Ga0501084_0277880 | Ga0501084_0277880_41_814 | 257 |
| 148 | 3300061719 | Ga0466962_0024434 | Ga0466962_0024434_1681_2454 | 257 |
| 149 | iso_pu_bacteria | 2512047030 | 2512344627 | 257 |
| 150 | iso_pu_bacteria | 2513237082 | 2513558562 | 257 |
| 151 | iso_pu_bacteria | 2513237082 | 2513558705 | 257 |
| 152 | iso_pu_bacteria | 2744054900 | 2746091657 | 257 |
| 153 | iso_pu_bacteria | 2744054901 | 2746099189 | 257 |
| 154 | iso_pu_bacteria | 2885266251 | 2885270236 | 257 |
| 155 | iso_pu_bacteria | 2901300506 | 2901306031 | 257 |
| 156 | iso_pu_bacteria | 8056161164 | 8056163231 | 257 |
| 157 | 3300005336 | Ga0070680_100107802 | Ga0070680_1001078023 | 258 |
| 158 | 3300005366 | Ga0070659_100309367 | Ga0070659_1003093672 | 258 |
| 159 | 3300005530 | Ga0070679_100125216 | Ga0070679_1001252163 | 258 |
| 160 | 3300005563 | Ga0068855_100173775 | Ga0068855_1001737751 | 258 |
| 161 | 3300005564 | Ga0070664_100058215 | Ga0070664_1000582153 | 258 |
| 162 | 3300005564 | Ga0070664_100143598 | Ga0070664_1001435983 | 258 |
| 163 | 3300009093 | Ga0105240_10514076 | Ga0105240_105140762 | 258 |
| 164 | 3300009174 | Ga0105241_10441635 | Ga0105241_104416352 | 258 |
| 165 | 3300009551 | Ga0105238_10112851 | Ga0105238_101128512 | 258 |
| 166 | 3300013104 | Ga0157370_10121116 | Ga0157370_101211161 | 258 |
| 167 | 3300013105 | Ga0157369_10128761 | Ga0157369_101287612 | 258 |
| 168 | 3300021384 | Ga0213876_10040373 | Ga0213876_100403732 | 258 |
| 169 | 3300025912 | Ga0207707_10062471 | Ga0207707_100624712 | 258 |
| 170 | 3300025917 | Ga0207660_10136423 | Ga0207660_101364231 | 258 |
| 171 | 3300025920 | Ga0207649_10285762 | Ga0207649_102857622 | 258 |
| 172 | 3300025921 | Ga0207652_10157723 | Ga0207652_101577231 | 258 |
| 173 | 3300025924 | Ga0207694_10114617 | Ga0207694_101146173 | 258 |
| 174 | 3300025945 | Ga0207679_10085019 | Ga0207679_100850191 | 258 |
| 175 | 3300025949 | Ga0207667_10189820 | Ga0207667_101898203 | 258 |
| 176 | 3300031824 | Ga0307413_10093061 | Ga0307413_100930611 | 258 |
| 177 | 3300032002 | Ga0307416_100795143 | Ga0307416_1007951431 | 258 |
| 178 | 3300037466 | Ga0395898_0098657 | Ga0395898_0098657_396_1172 | 258 |
| 179 | 3300039437 | Ga0436365_1801881 | Ga0436365_1801881_61_837 | 258 |
| 180 | 3300048908 | Ga0496105_0163114 | Ga0496105_0163114_942_1718 | 258 |
| 181 | 3300048918 | Ga0496115_0321147 | Ga0496115_0321147_307_1083 | 258 |
| 182 | 3300048924 | Ga0496121_0152244 | Ga0496121_0152244_837_1613 | 258 |
| 183 | 3300003320 | rootH2_10056772 | rootH2_100567722 | 259 |
| 184 | 3300005336 | Ga0070680_100095994 | Ga0070680_1000959942 | 259 |
| 185 | 3300005344 | Ga0070661_100331945 | Ga0070661_1003319452 | 259 |
| 186 | 3300005434 | Ga0070709_10040937 | Ga0070709_100409373 | 259 |
| 187 | 3300005435 | Ga0070714_100206950 | Ga0070714_1002069501 | 259 |
| 188 | 3300005458 | Ga0070681_10129528 | Ga0070681_101295282 | 259 |
| 189 | 3300005458 | Ga0070681_10215125 | Ga0070681_102151252 | 259 |
| 190 | 3300005530 | Ga0070679_100025401 | Ga0070679_1000254012 | 259 |
| 191 | 3300005539 | Ga0068853_100655691 | Ga0068853_1006556912 | 259 |
| 192 | 3300005563 | Ga0068855_100806612 | Ga0068855_1008066121 | 259 |
| 193 | 3300005564 | Ga0070664_100131848 | Ga0070664_1001318482 | 259 |
| 194 | 3300005577 | Ga0068857_100160535 | Ga0068857_1001605351 | 259 |
| 195 | 3300005577 | Ga0068857_100175341 | Ga0068857_1001753411 | 259 |
| 196 | 3300005578 | Ga0068854_100268478 | Ga0068854_1002684782 | 259 |
| 197 | 3300005578 | Ga0068854_100432444 | Ga0068854_1004324442 | 259 |
| 198 | 3300005614 | Ga0068856_100247335 | Ga0068856_1002473352 | 259 |
| 199 | 3300005616 | Ga0068852_100093693 | Ga0068852_1000936933 | 259 |
| 200 | 3300005616 | Ga0068852_100205922 | Ga0068852_1002059221 | 259 |
| 201 | 3300005618 | Ga0068864_100229828 | Ga0068864_1002298282 | 259 |
| 202 | 3300005719 | Ga0068861_100271981 | Ga0068861_1002719812 | 259 |
| 203 | 3300005834 | Ga0068851_10041699 | Ga0068851_100416993 | 259 |
| 204 | 3300006237 | Ga0097621_100144105 | Ga0097621_1001441052 | 259 |
| 205 | 3300006846 | Ga0075430_100103207 | Ga0075430_1001032072 | 259 |
| 206 | 3300009093 | Ga0105240_10220683 | Ga0105240_102206833 | 259 |
| 207 | 3300009093 | Ga0105240_10352080 | Ga0105240_103520801 | 259 |
| 208 | 3300009551 | Ga0105238_10404798 | Ga0105238_104047981 | 259 |
| 209 | 3300013104 | Ga0157370_10104587 | Ga0157370_101045873 | 259 |
| 210 | 3300013105 | Ga0157369_10183345 | Ga0157369_101833453 | 259 |
| 211 | 3300013307 | Ga0157372_10231043 | Ga0157372_102310433 | 259 |
| 212 | 3300025913 | Ga0207695_10181649 | Ga0207695_101816491 | 259 |
| 213 | 3300025913 | Ga0207695_10192941 | Ga0207695_101929411 | 259 |
| 214 | 3300025913 | Ga0207695_10372456 | Ga0207695_103724561 | 259 |
| 215 | 3300025919 | Ga0207657_10100005 | Ga0207657_101000052 | 259 |
| 216 | 3300025928 | Ga0207700_10259626 | Ga0207700_102596262 | 259 |
| 217 | 3300025929 | Ga0207664_10171063 | Ga0207664_101710631 | 259 |
| 218 | 3300025981 | Ga0207640_10279969 | Ga0207640_102799692 | 259 |
| 219 | 3300026078 | Ga0207702_10149949 | Ga0207702_101499493 | 259 |
| 220 | 3300026116 | Ga0207674_10077032 | Ga0207674_100770325 | 259 |
| 221 | 3300026116 | Ga0207674_10165649 | Ga0207674_101656491 | 259 |
| 222 | 3300026118 | Ga0207675_100423492 | Ga0207675_1004234922 | 259 |
| 223 | 3300026142 | Ga0207698_10152090 | Ga0207698_101520902 | 259 |
| 224 | 3300031911 | Ga0307412_10338004 | Ga0307412_103380042 | 259 |
| 225 | 3300035086 | Ga0373934_0028728 | Ga0373934_0028728_1248_2045 | 259 |
| 226 | 3300035112 | Ga0373932_0080826 | Ga0373932_0080826_178_957 | 259 |
| 227 | 3300035118 | Ga0373954_0047922 | Ga0373954_0047922_1125_1922 | 259 |
| 228 | 3300035118 | Ga0373954_0074941 | Ga0373954_0074941_705_1484 | 259 |
| 229 | 3300035172 | Ga0373955_0047321 | Ga0373955_0047321_1454_2233 | 259 |
| 230 | 3300035172 | Ga0373955_0068463 | Ga0373955_0068463_1163_1960 | 259 |
| 231 | 3300035410 | Ga0373924_0059572 | Ga0373924_0059572_696_1475 | 259 |
| 232 | 3300035691 | Ga0373931_0128609 | Ga0373931_0128609_615_1394 | 259 |
| 233 | 3300035724 | Ga0373933_0079997 | Ga0373933_0079997_1149_1928 | 259 |
| 234 | 3300036401 | Ga0373937_0131816 | Ga0373937_0131816_63_860 | 259 |
| 235 | 3300036401 | Ga0373937_0171879 | Ga0373937_0171879_150_929 | 259 |
| 236 | 3300039437 | Ga0436365_0752475 | Ga0436365_0752475_281_1066 | 259 |
| 237 | 3300039437 | Ga0436365_1367102 | Ga0436365_1367102_1106_1903 | 259 |
| 238 | 3300044706 | Ga0466964_0037142 | Ga0466964_0037142_56_835 | 259 |
| 239 | 3300045051 | Ga0451576_0189110 | Ga0451576_0189110_215_994 | 259 |
| 240 | 3300046454 | Ga0495592_0089700 | Ga0495592_0089700_1182_1979 | 259 |
| 241 | 3300046459 | Ga0495629_0073541 | Ga0495629_0073541_447_1244 | 259 |
| 242 | 3300046462 | Ga0495651_0105013 | Ga0495651_0105013_1151_1948 | 259 |
| 243 | 3300046463 | Ga0495653_0104680 | Ga0495653_0104680_1200_1997 | 259 |
| 244 | 3300046473 | Ga0495582_0026138 | Ga0495582_0026138_1006_1803 | 259 |
| 245 | 3300046511 | Ga0495608_0062508 | Ga0495608_0062508_1126_1923 | 259 |
| 246 | 3300046514 | Ga0495618_0078108 | Ga0495618_0078108_170_967 | 259 |
| 247 | 3300046516 | Ga0495628_0076190 | Ga0495628_0076190_324_1121 | 259 |
| 248 | 3300046517 | Ga0495630_0082599 | Ga0495630_0082599_315_1112 | 259 |
| 249 | 3300046529 | Ga0495652_0118476 | Ga0495652_0118476_1144_1941 | 259 |
| 250 | 3300046533 | Ga0495640_0067653 | Ga0495640_0067653_347_1144 | 259 |
| 251 | 3300046536 | Ga0495587_0063620 | Ga0495587_0063620_168_965 | 259 |
| 252 | 3300046559 | Ga0495667_0069602 | Ga0495667_0069602_353_1150 | 259 |
| 253 | 3300046642 | Ga0495634_0063061 | Ga0495634_0063061_554_1351 | 259 |
| 254 | 3300046663 | Ga0495635_0064311 | Ga0495635_0064311_611_1408 | 259 |
| 255 | 3300046675 | Ga0495657_0082026 | Ga0495657_0082026_156_953 | 259 |
| 256 | 3300046678 | Ga0495599_0065520 | Ga0495599_0065520_96_893 | 259 |
| 257 | 3300046683 | Ga0495658_0023462 | Ga0495658_0023462_1720_2517 | 259 |
| 258 | 3300046689 | Ga0495613_0093133 | Ga0495613_0093133_183_980 | 259 |
| 259 | 3300046690 | Ga0495624_0057579 | Ga0495624_0057579_1331_2128 | 259 |
| 260 | 3300046809 | Ga0495600_0087425 | Ga0495600_0087425_1138_1935 | 259 |
| 261 | 3300047317 | Ga0495604_0089527 | Ga0495604_0089527_1209_2006 | 259 |
| 262 | 3300047322 | Ga0495680_0059341 | Ga0495680_0059341_662_1459 | 259 |
| 263 | 3300047471 | Ga0495684_0060076 | Ga0495684_0060076_1474_2271 | 259 |
| 264 | 3300048089 | Ga0495614_0057073 | Ga0495614_0057073_211_1008 | 259 |
| 265 | 3300049580 | Ga0501046_0088785 | Ga0501046_0088785_1015_1815 | 259 |
| 266 | 3300050509 | nmdc:mga0qj67_252155_c1 | nmdc:mga0qj67_252155_c1_248_1027 | 259 |
| 267 | 3300053077 | Ga0495601_0097843 | Ga0495601_0097843_63_860 | 259 |
| 268 | 3300053084 | Ga0495595_0029968 | Ga0495595_0029968_316_1113 | 259 |
| 269 | 3300053084 | Ga0495595_0041746 | Ga0495595_0041746_1242_2021 | 259 |
| 270 | 3300053085 | Ga0495619_0057446 | Ga0495619_0057446_507_1304 | 259 |
| 271 | 3300053085 | Ga0495619_0110582 | Ga0495619_0110582_1066_1845 | 259 |
| 272 | 3300005329 | Ga0070683_100265719 | Ga0070683_1002657191 | 260 |
| 273 | 3300005344 | Ga0070661_100195661 | Ga0070661_1001956612 | 260 |
| 274 | 3300005458 | Ga0070681_10167847 | Ga0070681_101678472 | 260 |
| 275 | 3300005530 | Ga0070679_100164621 | Ga0070679_1001646212 | 260 |
| 276 | 3300013105 | Ga0157369_10222949 | Ga0157369_102229492 | 260 |
| 277 | 3300025912 | Ga0207707_10149399 | Ga0207707_101493992 | 260 |
| 278 | 3300025912 | Ga0207707_10160182 | Ga0207707_101601822 | 260 |
| 279 | 3300025917 | Ga0207660_10312553 | Ga0207660_103125532 | 260 |
| 280 | 3300025921 | Ga0207652_10141467 | Ga0207652_101414673 | 260 |
| 281 | 3300025944 | Ga0207661_10107127 | Ga0207661_101071273 | 260 |
| 282 | 3300037471 | Ga0395905_0153572 | Ga0395905_0153572_257_1042 | 260 |
| 283 | 3300048927 | Ga0496124_0000145 | Ga0496124_0000145_143042_143824 | 260 |
| 284 | 3300049568 | Ga0501031_0012979 | Ga0501031_0012979_1419_2201 | 260 |
| 285 | 3300049569 | Ga0501032_0095165 | Ga0501032_0095165_1115_1897 | 260 |
| 286 | 3300049570 | Ga0501033_0049272 | Ga0501033_0049272_2309_3091 | 260 |
| 287 | 3300049570 | Ga0501033_0115502 | Ga0501033_0115502_36_818 | 260 |
| 288 | 3300049571 | Ga0501034_0197932 | Ga0501034_0197932_77_859 | 260 |
| 289 | 3300049572 | Ga0501036_0030756 | Ga0501036_0030756_1292_2074 | 260 |
| 290 | 3300049573 | Ga0501037_0032328 | Ga0501037_0032328_1846_2628 | 260 |
| 291 | 3300049574 | Ga0501038_0063646 | Ga0501038_0063646_2302_3084 | 260 |
| 292 | 3300049574 | Ga0501038_0142030 | Ga0501038_0142030_105_887 | 260 |
| 293 | 3300049575 | Ga0501039_0117846 | Ga0501039_0117846_1221_2003 | 260 |
| 294 | 3300049576 | Ga0501040_0014871 | Ga0501040_0014871_1235_2017 | 260 |
| 295 | 3300049578 | Ga0501042_0103665 | Ga0501042_0103665_145_927 | 260 |
| 296 | 3300049579 | Ga0501043_0108811 | Ga0501043_0108811_1296_2078 | 260 |
| 297 | 3300049580 | Ga0501046_0108100 | Ga0501046_0108100_111_893 | 260 |
| 298 | 3300049581 | Ga0501047_0173243 | Ga0501047_0173243_89_871 | 260 |
| 299 | 3300049582 | Ga0501048_0050602 | Ga0501048_0050602_85_867 | 260 |
| 300 | 3300049584 | Ga0501068_0041866 | Ga0501068_0041866_125_907 | 260 |
| 301 | 3300049586 | Ga0501070_0107999 | Ga0501070_0107999_156_938 | 260 |
| 302 | 3300049741 | Ga0501079_0378362 | Ga0501079_0378362_46_840 | 260 |
| 303 | 3300049822 | Ga0501035_0043061 | Ga0501035_0043061_1311_2093 | 260 |
| 304 | 3300049823 | Ga0501044_0151165 | Ga0501044_0151165_286_1068 | 260 |
| 305 | 3300049824 | Ga0501045_0073580 | Ga0501045_0073580_1177_1959 | 260 |
| 306 | 3300002076 | JGI24749J21850_1003937 | JGI24749J21850_10039372 | 261 |
| 307 | 3300002077 | JGI24744J21845_10012598 | JGI24744J21845_100125982 | 261 |
| 308 | 3300002244 | JGI24742J22300_10005870 | JGI24742J22300_100058701 | 261 |
| 309 | 3300002459 | JGI24751J29686_10033234 | JGI24751J29686_100332342 | 261 |
| 310 | 3300005290 | Ga0065712_10103972 | Ga0065712_101039722 | 261 |
| 311 | 3300005293 | Ga0065715_10105084 | Ga0065715_101050843 | 261 |
| 312 | 3300005328 | Ga0070676_10073703 | Ga0070676_100737033 | 261 |
| 313 | 3300005330 | Ga0070690_100258411 | Ga0070690_1002584111 | 261 |
| 314 | 3300005331 | Ga0070670_100067442 | Ga0070670_1000674422 | 261 |
| 315 | 3300005331 | Ga0070670_100122456 | Ga0070670_1001224562 | 261 |
| 316 | 3300005333 | Ga0070677_10023543 | Ga0070677_100235432 | 261 |
| 317 | 3300005334 | Ga0068869_100182010 | Ga0068869_1001820102 | 261 |
| 318 | 3300005335 | Ga0070666_10089482 | Ga0070666_100894821 | 261 |
| 319 | 3300005336 | Ga0070680_100420659 | Ga0070680_1004206592 | 261 |
| 320 | 3300005338 | Ga0068868_100119345 | Ga0068868_1001193452 | 261 |
| 321 | 3300005339 | Ga0070660_100167148 | Ga0070660_1001671481 | 261 |
| 322 | 3300005340 | Ga0070689_100064573 | Ga0070689_1000645732 | 261 |
| 323 | 3300005344 | Ga0070661_100061698 | Ga0070661_1000616982 | 261 |
| 324 | 3300005347 | Ga0070668_100073141 | Ga0070668_1000731413 | 261 |
| 325 | 3300005347 | Ga0070668_100089672 | Ga0070668_1000896723 | 261 |
| 326 | 3300005353 | Ga0070669_100046015 | Ga0070669_1000460152 | 261 |
| 327 | 3300005354 | Ga0070675_100083460 | Ga0070675_1000834603 | 261 |
| 328 | 3300005354 | Ga0070675_100087360 | Ga0070675_1000873602 | 261 |
| 329 | 3300005355 | Ga0070671_100235148 | Ga0070671_1002351482 | 261 |
| 330 | 3300005356 | Ga0070674_100089011 | Ga0070674_1000890112 | 261 |
| 331 | 3300005364 | Ga0070673_100112222 | Ga0070673_1001122222 | 261 |
| 332 | 3300005364 | Ga0070673_100315049 | Ga0070673_1003150492 | 261 |
| 333 | 3300005365 | Ga0070688_100074859 | Ga0070688_1000748592 | 261 |
| 334 | 3300005367 | Ga0070667_100150761 | Ga0070667_1001507612 | 261 |
| 335 | 3300005367 | Ga0070667_100520733 | Ga0070667_1005207331 | 261 |
| 336 | 3300005435 | Ga0070714_100075935 | Ga0070714_1000759353 | 261 |
| 337 | 3300005436 | Ga0070713_100053706 | Ga0070713_1000537062 | 261 |
| 338 | 3300005436 | Ga0070713_100369770 | Ga0070713_1003697702 | 261 |
| 339 | 3300005440 | Ga0070705_100463650 | Ga0070705_1004636501 | 261 |
| 340 | 3300005441 | Ga0070700_100072891 | Ga0070700_1000728913 | 261 |
| 341 | 3300005456 | Ga0070678_100105002 | Ga0070678_1001050022 | 261 |
| 342 | 3300005457 | Ga0070662_100125166 | Ga0070662_1001251661 | 261 |
| 343 | 3300005458 | Ga0070681_10138252 | Ga0070681_101382522 | 261 |
| 344 | 3300005458 | Ga0070681_10177082 | Ga0070681_101770821 | 261 |
| 345 | 3300005459 | Ga0068867_100075942 | Ga0068867_1000759422 | 261 |
| 346 | 3300005466 | Ga0070685_10065462 | Ga0070685_100654622 | 261 |
| 347 | 3300005530 | Ga0070679_100070314 | Ga0070679_1000703143 | 261 |
| 348 | 3300005539 | Ga0068853_100227771 | Ga0068853_1002277712 | 261 |
| 349 | 3300005539 | Ga0068853_100498966 | Ga0068853_1004989661 | 261 |
| 350 | 3300005543 | Ga0070672_100118609 | Ga0070672_1001186091 | 261 |
| 351 | 3300005543 | Ga0070672_100131379 | Ga0070672_1001313791 | 261 |
| 352 | 3300005546 | Ga0070696_100252479 | Ga0070696_1002524792 | 261 |
| 353 | 3300005548 | Ga0070665_100116582 | Ga0070665_1001165824 | 261 |
| 354 | 3300005563 | Ga0068855_100549678 | Ga0068855_1005496782 | 261 |
| 355 | 3300005564 | Ga0070664_100089788 | Ga0070664_1000897882 | 261 |
| 356 | 3300005564 | Ga0070664_100127752 | Ga0070664_1001277522 | 261 |
| 357 | 3300005578 | Ga0068854_100099866 | Ga0068854_1000998662 | 261 |
| 358 | 3300005615 | Ga0070702_100098071 | Ga0070702_1000980712 | 261 |
| 359 | 3300005615 | Ga0070702_100358808 | Ga0070702_1003588081 | 261 |
| 360 | 3300005616 | Ga0068852_100161675 | Ga0068852_1001616752 | 261 |
| 361 | 3300005617 | Ga0068859_100224205 | Ga0068859_1002242051 | 261 |
| 362 | 3300005618 | Ga0068864_100008276 | Ga0068864_1000082762 | 261 |
| 363 | 3300005618 | Ga0068864_100151258 | Ga0068864_1001512582 | 261 |
| 364 | 3300005719 | Ga0068861_100067495 | Ga0068861_1000674952 | 261 |
| 365 | 3300005719 | Ga0068861_100247120 | Ga0068861_1002471202 | 261 |
| 366 | 3300005840 | Ga0068870_10045027 | Ga0068870_100450271 | 261 |
| 367 | 3300005841 | Ga0068863_100145674 | Ga0068863_1001456741 | 261 |
| 368 | 3300005841 | Ga0068863_100190910 | Ga0068863_1001909102 | 261 |
| 369 | 3300005842 | Ga0068858_100144708 | Ga0068858_1001447082 | 261 |
| 370 | 3300005843 | Ga0068860_100161532 | Ga0068860_1001615321 | 261 |
| 371 | 3300005843 | Ga0068860_100175815 | Ga0068860_1001758153 | 261 |
| 372 | 3300005844 | Ga0068862_100111473 | Ga0068862_1001114732 | 261 |
| 373 | 3300005844 | Ga0068862_100149621 | Ga0068862_1001496213 | 261 |
| 374 | 3300006028 | Ga0070717_10378538 | Ga0070717_103785381 | 261 |
| 375 | 3300006173 | Ga0070716_100102769 | Ga0070716_1001027692 | 261 |
| 376 | 3300006358 | Ga0068871_100258588 | Ga0068871_1002585882 | 261 |
| 377 | 3300006358 | Ga0068871_100313585 | Ga0068871_1003135852 | 261 |
| 378 | 3300006881 | Ga0068865_100106408 | Ga0068865_1001064082 | 261 |
| 379 | 3300006931 | Ga0097620_100224199 | Ga0097620_1002241991 | 261 |
| 380 | 3300009093 | Ga0105240_10690684 | Ga0105240_106906841 | 261 |
| 381 | 3300009094 | Ga0111539_10116016 | Ga0111539_101160161 | 261 |
| 382 | 3300009553 | Ga0105249_10736125 | Ga0105249_107361251 | 261 |
| 383 | 3300013100 | Ga0157373_10337425 | Ga0157373_103374251 | 261 |
| 384 | 3300013104 | Ga0157370_10179084 | Ga0157370_101790842 | 261 |
| 385 | 3300013104 | Ga0157370_10317482 | Ga0157370_103174821 | 261 |
| 386 | 3300013105 | Ga0157369_10059593 | Ga0157369_100595934 | 261 |
| 387 | 3300013296 | Ga0157374_10147663 | Ga0157374_101476633 | 261 |
| 388 | 3300013297 | Ga0157378_10186151 | Ga0157378_101861512 | 261 |
| 389 | 3300013306 | Ga0163162_10118518 | Ga0163162_101185183 | 261 |
| 390 | 3300013306 | Ga0163162_10154383 | Ga0163162_101543834 | 261 |
| 391 | 3300013306 | Ga0163162_10202111 | Ga0163162_102021112 | 261 |
| 392 | 3300013308 | Ga0157375_10056372 | Ga0157375_100563724 | 261 |
| 393 | 3300013308 | Ga0157375_10145632 | Ga0157375_101456322 | 261 |
| 394 | 3300014326 | Ga0157380_10036341 | Ga0157380_100363413 | 261 |
| 395 | 3300014326 | Ga0157380_10063179 | Ga0157380_100631791 | 261 |
| 396 | 3300014969 | Ga0157376_10047001 | Ga0157376_100470015 | 261 |
| 397 | 3300017792 | Ga0163161_10070026 | Ga0163161_100700263 | 261 |
| 398 | 3300017792 | Ga0163161_10091695 | Ga0163161_100916952 | 261 |
| 399 | 3300021358 | Ga0213873_10033856 | Ga0213873_100338562 | 261 |
| 400 | 3300021358 | Ga0213873_10038007 | Ga0213873_100380072 | 261 |
| 401 | 3300021377 | Ga0213874_10020086 | Ga0213874_100200862 | 261 |
| 402 | 3300021441 | Ga0213871_10047324 | Ga0213871_100473242 | 261 |
| 403 | 3300025206 | Ga0209435_101466 | Ga0209435_1014662 | 261 |
| 404 | 3300025271 | Ga0207666_1016202 | Ga0207666_10162022 | 261 |
| 405 | 3300025315 | Ga0207697_10036379 | Ga0207697_100363792 | 261 |
| 406 | 3300025893 | Ga0207682_10021515 | Ga0207682_100215152 | 261 |
| 407 | 3300025898 | Ga0207692_10240908 | Ga0207692_102409081 | 261 |
| 408 | 3300025901 | Ga0207688_10014136 | Ga0207688_100141362 | 261 |
| 409 | 3300025903 | Ga0207680_10066983 | Ga0207680_100669831 | 261 |
| 410 | 3300025904 | Ga0207647_10048246 | Ga0207647_100482462 | 261 |
| 411 | 3300025906 | Ga0207699_10109795 | Ga0207699_101097951 | 261 |
| 412 | 3300025907 | Ga0207645_10067510 | Ga0207645_100675103 | 261 |
| 413 | 3300025908 | Ga0207643_10054976 | Ga0207643_100549761 | 261 |
| 414 | 3300025912 | Ga0207707_10153764 | Ga0207707_101537642 | 261 |
| 415 | 3300025912 | Ga0207707_10186855 | Ga0207707_101868551 | 261 |
| 416 | 3300025915 | Ga0207693_10094351 | Ga0207693_100943512 | 261 |
| 417 | 3300025917 | Ga0207660_10386894 | Ga0207660_103868941 | 261 |
| 418 | 3300025919 | Ga0207657_10119739 | Ga0207657_101197391 | 261 |
| 419 | 3300025919 | Ga0207657_10120308 | Ga0207657_101203083 | 261 |
| 420 | 3300025920 | Ga0207649_10070043 | Ga0207649_100700433 | 261 |
| 421 | 3300025921 | Ga0207652_10044871 | Ga0207652_100448713 | 261 |
| 422 | 3300025922 | Ga0207646_10139776 | Ga0207646_101397761 | 261 |
| 423 | 3300025923 | Ga0207681_10062538 | Ga0207681_100625382 | 261 |
| 424 | 3300025925 | Ga0207650_10114365 | Ga0207650_101143652 | 261 |
| 425 | 3300025925 | Ga0207650_10125464 | Ga0207650_101254643 | 261 |
| 426 | 3300025926 | Ga0207659_10121360 | Ga0207659_101213601 | 261 |
| 427 | 3300025926 | Ga0207659_10327330 | Ga0207659_103273302 | 261 |
| 428 | 3300025928 | Ga0207700_10320307 | Ga0207700_103203072 | 261 |
| 429 | 3300025931 | Ga0207644_10224263 | Ga0207644_102242631 | 261 |
| 430 | 3300025933 | Ga0207706_10058711 | Ga0207706_100587111 | 261 |
| 431 | 3300025936 | Ga0207670_10048992 | Ga0207670_100489923 | 261 |
| 432 | 3300025937 | Ga0207669_10082453 | Ga0207669_100824531 | 261 |
| 433 | 3300025938 | Ga0207704_10080164 | Ga0207704_100801643 | 261 |
| 434 | 3300025939 | Ga0207665_10082185 | Ga0207665_100821852 | 261 |
| 435 | 3300025940 | Ga0207691_10065165 | Ga0207691_100651654 | 261 |
| 436 | 3300025940 | Ga0207691_10066763 | Ga0207691_100667633 | 261 |
| 437 | 3300025941 | Ga0207711_10013248 | Ga0207711_100132487 | 261 |
| 438 | 3300025942 | Ga0207689_10137937 | Ga0207689_101379372 | 261 |
| 439 | 3300025945 | Ga0207679_10391000 | Ga0207679_103910002 | 261 |
| 440 | 3300025949 | Ga0207667_10533551 | Ga0207667_105335511 | 261 |
| 441 | 3300025960 | Ga0207651_10072939 | Ga0207651_100729391 | 261 |
| 442 | 3300025960 | Ga0207651_10118796 | Ga0207651_101187961 | 261 |
| 443 | 3300025961 | Ga0207712_10126213 | Ga0207712_101262131 | 261 |
| 444 | 3300025961 | Ga0207712_10537092 | Ga0207712_105370922 | 261 |
| 445 | 3300025972 | Ga0207668_10060946 | Ga0207668_100609463 | 261 |
| 446 | 3300025981 | Ga0207640_10150184 | Ga0207640_101501842 | 261 |
| 447 | 3300025986 | Ga0207658_10118769 | Ga0207658_101187692 | 261 |
| 448 | 3300025986 | Ga0207658_10123200 | Ga0207658_101232001 | 261 |
| 449 | 3300026023 | Ga0207677_10350380 | Ga0207677_103503801 | 261 |
| 450 | 3300026035 | Ga0207703_10136158 | Ga0207703_101361582 | 261 |
| 451 | 3300026088 | Ga0207641_10167151 | Ga0207641_101671513 | 261 |
| 452 | 3300026088 | Ga0207641_10282991 | Ga0207641_102829912 | 261 |
| 453 | 3300026089 | Ga0207648_10089116 | Ga0207648_100891163 | 261 |
| 454 | 3300026095 | Ga0207676_10131370 | Ga0207676_101313704 | 261 |
| 455 | 3300026118 | Ga0207675_100102917 | Ga0207675_1001029173 | 261 |
| 456 | 3300026118 | Ga0207675_100142026 | Ga0207675_1001420262 | 261 |
| 457 | 3300027907 | Ga0207428_10091740 | Ga0207428_100917403 | 261 |
| 458 | 3300028379 | Ga0268266_10146810 | Ga0268266_101468103 | 261 |
| 459 | 3300028380 | Ga0268265_10145882 | Ga0268265_101458823 | 261 |
| 460 | 3300028381 | Ga0268264_10159076 | Ga0268264_101590762 | 261 |
| 461 | 3300028381 | Ga0268264_10382729 | Ga0268264_103827291 | 261 |
| 462 | 3300038443 | Ga0395901_0033513 | Ga0395901_0033513_2143_2931 | 261 |
| 463 | 3300039437 | Ga0436365_0277082 | Ga0436365_0277082_928_1737 | 261 |
| 464 | 3300039437 | Ga0436365_1792257 | Ga0436365_1792257_297_1097 | 261 |
| 465 | 3300039438 | Ga0436360_0647305 | Ga0436360_0647305_1153_1953 | 261 |
| 466 | 3300039438 | Ga0436360_0678977 | Ga0436360_0678977_166_966 | 261 |
| 467 | 3300039438 | Ga0436360_1060473 | Ga0436360_1060473_365_1165 | 261 |
| 468 | 3300039447 | Ga0436361_0032161 | Ga0436361_0032161_1287_2087 | 261 |
| 469 | 3300039447 | Ga0436361_0474349 | Ga0436361_0474349_390_1190 | 261 |
| 470 | 3300039450 | Ga0436363_0188014 | Ga0436363_0188014_611_1411 | 261 |
| 471 | 3300039450 | Ga0436363_0299772 | Ga0436363_0299772_117_917 | 261 |
| 472 | 3300039450 | Ga0436363_1710797 | Ga0436363_1710797_28_828 | 261 |
| 473 | 3300039453 | Ga0436362_0129397 | Ga0436362_0129397_503_1303 | 261 |
| 474 | 3300039453 | Ga0436362_0305935 | Ga0436362_0305935_466_1266 | 261 |
| 475 | 3300042439 | Ga0439464_0013228 | Ga0439464_0013228_1198_1998 | 261 |
| 476 | 3300044656 | Ga0466969_0056378 | Ga0466969_0056378_1120_1908 | 261 |
| 477 | 3300045049 | Ga0466959_0105952 | Ga0466959_0105952_87_875 | 261 |
| 478 | 3300046459 | Ga0495629_0091385 | Ga0495629_0091385_122_910 | 261 |
| 479 | 3300046463 | Ga0495653_0100542 | Ga0495653_0100542_107_895 | 261 |
| 480 | 3300046473 | Ga0495582_0139892 | Ga0495582_0139892_518_1306 | 261 |
| 481 | 3300046507 | Ga0495606_0014640 | Ga0495606_0014640_3548_4336 | 261 |
| 482 | 3300046516 | Ga0495628_0114907 | Ga0495628_0114907_1183_1971 | 261 |
| 483 | 3300046517 | Ga0495630_0102276 | Ga0495630_0102276_1178_1966 | 261 |
| 484 | 3300046526 | Ga0495666_0141074 | Ga0495666_0141074_259_1047 | 261 |
| 485 | 3300046531 | Ga0495665_0053720 | Ga0495665_0053720_1211_1999 | 261 |
| 486 | 3300046642 | Ga0495634_0264096 | Ga0495634_0264096_166_954 | 261 |
| 487 | 3300046675 | Ga0495657_0165935 | Ga0495657_0165935_412_1200 | 261 |
| 488 | 3300046679 | Ga0495623_0021590 | Ga0495623_0021590_174_962 | 261 |
| 489 | 3300046680 | Ga0495646_0078971 | Ga0495646_0078971_191_979 | 261 |
| 490 | 3300046684 | Ga0495669_0051071 | Ga0495669_0051071_188_976 | 261 |
| 491 | 3300046690 | Ga0495624_0248606 | Ga0495624_0248606_201_989 | 261 |
| 492 | 3300046694 | Ga0495649_0043021 | Ga0495649_0043021_164_952 | 261 |
| 493 | 3300046794 | Ga0495589_0056431 | Ga0495589_0056431_1067_1855 | 261 |
| 494 | 3300046794 | Ga0495589_0082401 | Ga0495589_0082401_152_940 | 261 |
| 495 | 3300047315 | Ga0495581_0264711 | Ga0495581_0264711_48_836 | 261 |
| 496 | 3300047317 | Ga0495604_0108693 | Ga0495604_0108693_146_934 | 261 |
| 497 | 3300047318 | Ga0495636_0198482 | Ga0495636_0198482_115_903 | 261 |
| 498 | 3300047319 | Ga0495674_0126805 | Ga0495674_0126805_174_962 | 261 |
| 499 | 3300047321 | Ga0495676_0090641 | Ga0495676_0090641_1326_2114 | 261 |
| 500 | 3300047322 | Ga0495680_0107451 | Ga0495680_0107451_1178_1966 | 261 |
| 501 | 3300047323 | Ga0495683_0045344 | Ga0495683_0045344_990_1778 | 261 |
| 502 | 3300047444 | Ga0495675_0077139 | Ga0495675_0077139_1208_1996 | 261 |
| 503 | 3300047446 | Ga0495679_024039 | Ga0495679_024039_131_919 | 261 |
| 504 | 3300047469 | Ga0495673_0040942 | Ga0495673_0040942_149_937 | 261 |
| 505 | 3300047472 | Ga0495686_0112137 | Ga0495686_0112137_743_1531 | 261 |
| 506 | 3300047673 | Ga0495593_0051876 | Ga0495593_0051876_202_990 | 261 |
| 507 | 3300048088 | Ga0495602_0124798 | Ga0495602_0124798_112_900 | 261 |
| 508 | 3300048089 | Ga0495614_0036808 | Ga0495614_0036808_1156_1944 | 261 |
| 509 | 3300048905 | Ga0496102_0335832 | Ga0496102_0335832_296_1135 | 261 |
| 510 | 3300048907 | Ga0496104_0481416 | Ga0496104_0481416_228_1067 | 261 |
| 511 | 3300048911 | Ga0496108_0569186 | Ga0496108_0569186_86_925 | 261 |
| 512 | 3300049569 | Ga0501032_0195732 | Ga0501032_0195732_477_1262 | 261 |
| 513 | 3300049571 | Ga0501034_0180802 | Ga0501034_0180802_750_1535 | 261 |
| 514 | 3300049582 | Ga0501048_0266551 | Ga0501048_0266551_268_1053 | 261 |
| 515 | 3300049822 | Ga0501035_0323043 | Ga0501035_0323043_379_1164 | 261 |
| 516 | 3300049823 | Ga0501044_0185524 | Ga0501044_0185524_1163_1948 | 261 |
| 517 | 3300050511 | nmdc:mga08y16_45282_c1 | nmdc:mga08y16_45282_c1_3076_3861 | 261 |
| 518 | iso_pu_bacteria | 2990703756 | 2990704508 | 261 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5bq5-assembly3.cif.gz_C | crystal structure of the istb aaa+ domain bound to adp-bef3 | 0.9744 | 71 | 249 |
| 5bq5-assembly3.cif.gz_C | crystal structure of the istb aaa+ domain bound to adp-bef3 | 0.9532 | 71 | 249 |
| 5he8-assembly2.cif.gz_E | bacterial initiation protein | 0.8499 | 86 | 240 |
| 2w58-assembly1.cif.gz_B | crystal structure of the dnai | 0.8165 | 72 | 236 |
| 5he8-assembly2.cif.gz_E | bacterial initiation protein | 0.7984 | 86 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P96287_79_227_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9818 | 100 | 246 | 3.40.50.300 |
| 5bq5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9736 | 71 | 249 | 3.40.50.300 |
| af_P96287_79_227_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9559 | 100 | 246 | 3.40.50.300 |
| 5bq5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9522 | 71 | 249 | 3.40.50.300 |
| af_Q50701_63_248_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9225 | 65 | 245 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Y7ZL73-F1-model_v4 | deleted | 0.9958 | 133 | 230 |
|
| AF-A0A3A8E9I1-F1-model_v4 | Replicative helicase loader DnaC (DNA replication protein DnaC) | 0.9897 | 123 | 250 |
GO:0005524
GO:0006260 |
| AF-A0A2P1BPA6-F1-model_v4 | Transposase/IS protein | 0.9895 | 83 | 253 |
GO:0005524
GO:0006260 GO:0016887 |
| AF-A0A7I8YNC2-F1-model_v4 | Replicative helicase loader DnaC (DNA replication protein DnaC) | 0.9869 | 64 | 253 |
GO:0005524
GO:0006269 GO:0016887 GO:1990077 |
| AF-A0A202DP14-F1-model_v4 | ATP-binding protein | 0.9864 | 120 | 249 |
GO:0005524
GO:0006260 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar