F458220

General Info

Members Datasets Scaffolds Average Seq Length
518 301 509 260

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10040937|Ga0070709_100409373
Length 289
Sequence VRRLVVLDKRFIAIALNTIFQGLDWRQRLFERGQFNFSKSVGEVSHHRASELEWTGLAQDAARKEVSYADFLEQLLAIENGARLERQRDTLMKLATLPSVKTLEQYDFGFASGAPRAQIQELASLTFIERAENVVFLGPSGVGKSHLAQALAYRAVMAGIKSRFITAADLMLQLATARKQERLREYFNRAVVGPRLLIIDEIGYLPFGREEANLLFNVVAKRYERGSIILTSNLAFAQWSSAFADDKTLTAALLDRLLHHAHIVQIGGESYRLKDKRKAGQAHKRAKAD

Samples

Sample ID Description Type Environment
1 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
2 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
3 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
4 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
5 2885266251 Ralstonia sp. SET104 Isolate Nodule
6 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
7 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
112 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
113 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
253 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
301 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.26
Metatranscriptomes 0
Isolates 1.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.77
Rhizoplane 2.51
Rhizosphere 92.86
Stem 0
Stem Tuber 0
Unclassified 3.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1003937 3300002076 Bacteria 2069
2 JGI24744J21845_10012598 3300002077 Bacteria 1713
3 JGI24742J22300_10005870 3300002244 Bacteria 2022
4 JGI24751J29686_10033234 3300002459 Bacteria 1069
5 rootH2_10056772 3300003320 Bacteria 3776
6 Ga0065712_10103972 3300005290 Bacteria 1972
7 Ga0065715_10105084 3300005293 Bacteria 2887
8 Ga0065715_10143805 3300005293 Bacteria 1816
9 Ga0070676_10073703 3300005328 Bacteria 2054
10 Ga0070683_100265719 3300005329 Bacteria 1632
11 Ga0070690_100245971 3300005330 Bacteria 1263
12 Ga0070690_100258411 3300005330 Bacteria 1235
13 Ga0070690_100359825 3300005330 Bacteria 1058
14 Ga0070670_100067442 3300005331 Bacteria 3070
15 Ga0070670_100122456 3300005331 Bacteria 2243
16 Ga0070670_100141069 3300005331 Bacteria 2084
17 Ga0070670_100157144 3300005331 Bacteria 1970
18 Ga0070677_10023543 3300005333 Bacteria 2282
19 Ga0068869_100182010 3300005334 Bacteria 1648
20 Ga0070666_10089482 3300005335 Bacteria 2113
21 Ga0070666_10260734 3300005335 Bacteria 1229
22 Ga0070680_100095994 3300005336 Bacteria 2458
23 Ga0070680_100107802 3300005336 Bacteria 2317
24 Ga0070680_100420659 3300005336 Bacteria 1140
25 Ga0068868_100088988 3300005338 Bacteria 2485
26 Ga0068868_100119345 3300005338 Bacteria 2150
27 Ga0070660_100167148 3300005339 Bacteria 1775
28 Ga0070689_100064573 3300005340 Bacteria 2850
29 Ga0070689_100515733 3300005340 Bacteria 1026
30 Ga0070661_100061698 3300005344 Bacteria 2752
31 Ga0070661_100195661 3300005344 Bacteria 1543
32 Ga0070661_100331945 3300005344 Bacteria 1189
33 Ga0070668_100073141 3300005347 Bacteria 2672
34 Ga0070668_100089672 3300005347 Bacteria 2422
35 Ga0070669_100046015 3300005353 Bacteria 3181
36 Ga0070675_100083460 3300005354 Bacteria 2667
37 Ga0070675_100087360 3300005354 Bacteria 2607
38 Ga0070675_100117879 3300005354 Bacteria 2253
39 Ga0070671_100137778 3300005355 Bacteria 2058
40 Ga0070671_100232151 3300005355 Bacteria 1565
41 Ga0070671_100235148 3300005355 Bacteria 1555
42 Ga0070674_100089011 3300005356 Bacteria 2223
43 Ga0070673_100112222 3300005364 Bacteria 2262
44 Ga0070673_100120356 3300005364 Bacteria 2189
45 Ga0070673_100315049 3300005364 Bacteria 1381
46 Ga0070688_100074859 3300005365 Bacteria 2175
47 Ga0070688_100133065 3300005365 Bacteria 1680
48 Ga0070688_100340785 3300005365 Bacteria 1095
49 Ga0070659_100309367 3300005366 Bacteria 1319
50 Ga0070667_100150761 3300005367 Bacteria 2042
51 Ga0070667_100265588 3300005367 Bacteria 1538
52 Ga0070667_100520733 3300005367 Bacteria 1091
53 Ga0070709_10040937 3300005434 Bacteria 2852
54 Ga0070714_100075935 3300005435 Bacteria 2916
55 Ga0070714_100117967 3300005435 Bacteria 2357
56 Ga0070714_100206950 3300005435 Bacteria 1797
57 Ga0070713_100053706 3300005436 Bacteria 3339
58 Ga0070713_100085390 3300005436 Bacteria 2704
59 Ga0070713_100369770 3300005436 Bacteria 1334
60 Ga0070710_10041289 3300005437 Bacteria 2546
61 Ga0070711_100064589 3300005439 Bacteria 2558
62 Ga0070711_100406074 3300005439 Bacteria 1107
63 Ga0070705_100060089 3300005440 Bacteria 2253
64 Ga0070705_100463650 3300005440 Bacteria 953
65 Ga0070705_100506666 3300005440 Bacteria 917
66 Ga0070700_100072891 3300005441 Bacteria 2197
67 Ga0070708_100506761 3300005445 Bacteria 1138
68 Ga0070678_100105002 3300005456 Bacteria 2198
69 Ga0070662_100125166 3300005457 Bacteria 1975
70 Ga0070662_100368940 3300005457 Bacteria 1179
71 Ga0070681_10129528 3300005458 Bacteria 2455
72 Ga0070681_10138252 3300005458 Bacteria 2366
73 Ga0070681_10167847 3300005458 Bacteria 2117
74 Ga0070681_10177082 3300005458 Bacteria 2055
75 Ga0070681_10215125 3300005458 Bacteria 1838
76 Ga0070681_10471025 3300005458 Bacteria 1169
77 Ga0068867_100075942 3300005459 Bacteria 2522
78 Ga0070685_10065462 3300005466 Bacteria 2139
79 Ga0070685_10248247 3300005466 Bacteria 1178
80 Ga0070707_100137976 3300005468 Bacteria 2373
81 Ga0070698_100134342 3300005471 Bacteria 2428
82 Ga0070698_100149087 3300005471 Bacteria 2287
83 Ga0070699_100052661 3300005518 Bacteria 3521
84 Ga0070679_100025401 3300005530 Bacteria 5812
85 Ga0070679_100070314 3300005530 Bacteria 3492
86 Ga0070679_100125216 3300005530 Bacteria 2552
87 Ga0070679_100164621 3300005530 Bacteria 2192
88 Ga0068853_100227771 3300005539 Bacteria 1704
89 Ga0068853_100498966 3300005539 Bacteria 1149
90 Ga0068853_100655691 3300005539 Bacteria 999
91 Ga0070672_100118609 3300005543 Bacteria 2164
92 Ga0070672_100131379 3300005543 Bacteria 2058
93 Ga0070686_100102748 3300005544 Bacteria 1933
94 Ga0070696_100252479 3300005546 Bacteria 1334
95 Ga0070665_100116582 3300005548 Bacteria 2673
96 Ga0070665_100383700 3300005548 Bacteria 1412
97 Ga0068855_100173775 3300005563 Bacteria 2439
98 Ga0068855_100549678 3300005563 Bacteria 1250
99 Ga0068855_100806612 3300005563 Bacteria 997
100 Ga0070664_100058215 3300005564 Bacteria 3286
101 Ga0070664_100089788 3300005564 Bacteria 2659
102 Ga0070664_100127752 3300005564 Bacteria 2231
103 Ga0070664_100131848 3300005564 Bacteria 2196
104 Ga0070664_100143598 3300005564 Bacteria 2103
105 Ga0070664_100722149 3300005564 Bacteria 929
106 Ga0068857_100160535 3300005577 Bacteria 2040
107 Ga0068857_100175341 3300005577 Bacteria 1950
108 Ga0068854_100099866 3300005578 Bacteria 2174
109 Ga0068854_100268478 3300005578 Bacteria 1369
110 Ga0068854_100432444 3300005578 Bacteria 1095
111 Ga0068856_100247335 3300005614 Bacteria 1799
112 Ga0070702_100098071 3300005615 Bacteria 1792
113 Ga0070702_100292131 3300005615 Bacteria 1124
114 Ga0070702_100358808 3300005615 Bacteria 1029
115 Ga0068852_100093693 3300005616 Bacteria 2693
116 Ga0068852_100161675 3300005616 Bacteria 2091
117 Ga0068852_100205922 3300005616 Bacteria 1864
118 Ga0068859_100224205 3300005617 Bacteria 1968
119 Ga0068864_100008276 3300005618 Bacteria 8579
120 Ga0068864_100094049 3300005618 Bacteria 2648
121 Ga0068864_100151258 3300005618 Bacteria 2102
122 Ga0068864_100229828 3300005618 Bacteria 1715
123 Ga0068861_100067495 3300005719 Bacteria 2761
124 Ga0068861_100247120 3300005719 Bacteria 1520
125 Ga0068861_100271981 3300005719 Bacteria 1455
126 Ga0068851_10041699 3300005834 Bacteria 2309
127 Ga0068870_10045027 3300005840 Bacteria 2308
128 Ga0068870_10110698 3300005840 Bacteria 1567
129 Ga0068863_100145674 3300005841 Bacteria 2265
130 Ga0068863_100190910 3300005841 Bacteria 1968
131 Ga0068858_100144708 3300005842 Bacteria 2232
132 Ga0068860_100161532 3300005843 Bacteria 2160
133 Ga0068860_100175815 3300005843 Bacteria 2069
134 Ga0068862_100111473 3300005844 Bacteria 2402
135 Ga0068862_100149621 3300005844 Bacteria 2077
136 Ga0070717_10079634 3300006028 Bacteria 2747
137 Ga0070717_10256784 3300006028 Bacteria 1545
138 Ga0070717_10378538 3300006028 Bacteria 1269
139 Ga0070716_100075329 3300006173 Bacteria 1997
140 Ga0070716_100102769 3300006173 Bacteria 1756
141 Ga0070712_100069380 3300006175 Bacteria 2514
142 Ga0070712_100105560 3300006175 Bacteria 2092
143 Ga0097621_100144105 3300006237 Bacteria 2038
144 Ga0097621_100358916 3300006237 Bacteria 1298
145 Ga0068871_100258588 3300006358 Bacteria 1518
146 Ga0068871_100313585 3300006358 Bacteria 1379
147 Ga0075430_100103207 3300006846 Bacteria 2380
148 Ga0075433_10456588 3300006852 Bacteria 1126
149 Ga0068865_100106408 3300006881 Bacteria 2062
150 Ga0097620_100224199 3300006931 Bacteria 1968
151 Ga0099795_10065386 3300007788 Bacteria 1360
152 Ga0105240_10220683 3300009093 Bacteria 2209
153 Ga0105240_10352080 3300009093 Bacteria 1670
154 Ga0105240_10514076 3300009093 Bacteria 1330
155 Ga0105240_10690684 3300009093 Bacteria 1115
156 Ga0111539_10116016 3300009094 Bacteria 3140
157 Ga0105245_10091304 3300009098 Bacteria 2802
158 Ga0105247_10148029 3300009101 Bacteria 1545
159 Ga0105241_10394841 3300009174 Bacteria 1212
160 Ga0105241_10441635 3300009174 Bacteria 1149
161 Ga0105248_10493050 3300009177 Bacteria 1381
162 Ga0105238_10112851 3300009551 Bacteria 2698
163 Ga0105238_10404798 3300009551 Bacteria 1358
164 Ga0105249_10209316 3300009553 Bacteria 1913
165 Ga0105249_10736125 3300009553 Bacteria 1048
166 Ga0099796_10026560 3300010159 Bacteria 1840
167 Ga0105239_10226068 3300010375 Bacteria 2099
168 Ga0105246_10024267 3300011119 Bacteria 3937
169 Ga0157373_10337425 3300013100 Bacteria 1074
170 Ga0157370_10104587 3300013104 Bacteria 2650
171 Ga0157370_10121116 3300013104 Bacteria 2442
172 Ga0157370_10158350 3300013104 Bacteria 2107
173 Ga0157370_10179084 3300013104 Bacteria 1970
174 Ga0157370_10230097 3300013104 Bacteria 1716
175 Ga0157370_10317482 3300013104 Bacteria 1437
176 Ga0157369_10059593 3300013105 Bacteria 4116
177 Ga0157369_10128761 3300013105 Bacteria 2683
178 Ga0157369_10183345 3300013105 Bacteria 2202
179 Ga0157369_10222949 3300013105 Bacteria 1973
180 Ga0157374_10147663 3300013296 Bacteria 2285
181 Ga0157378_10138132 3300013297 Bacteria 2261
182 Ga0157378_10186151 3300013297 Bacteria 1956
183 Ga0163162_10118518 3300013306 Bacteria 2749
184 Ga0163162_10154383 3300013306 Bacteria 2415
185 Ga0163162_10202111 3300013306 Bacteria 2116
186 Ga0163162_10266147 3300013306 Bacteria 1846
187 Ga0157372_10231043 3300013307 Bacteria 2144
188 Ga0157375_10056372 3300013308 Bacteria 3879
189 Ga0157375_10093524 3300013308 Bacteria 3072
190 Ga0157375_10145632 3300013308 Bacteria 2500
191 Ga0163163_10138699 3300014325 Bacteria 2473
192 Ga0163163_10492773 3300014325 Bacteria 1287
193 Ga0157380_10036341 3300014326 Bacteria 3810
194 Ga0157380_10063179 3300014326 Bacteria 2968
195 Ga0157379_10148564 3300014968 Bacteria 2114
196 Ga0157376_10047001 3300014969 Bacteria 3562
197 Ga0157376_10297916 3300014969 Bacteria 1525
198 Ga0157376_10389167 3300014969 Bacteria 1345
199 Ga0163161_10070026 3300017792 Bacteria 2565
200 Ga0163161_10091147 3300017792 Bacteria 2256
201 Ga0163161_10091695 3300017792 Bacteria 2249
202 Ga0213873_10009512 3300021358 Bacteria 2021
203 Ga0213873_10033856 3300021358 Bacteria 1284
204 Ga0213873_10038007 3300021358 Bacteria 1228
205 Ga0213874_10020086 3300021377 Bacteria 1827
206 Ga0213876_10040373 3300021384 Bacteria 2465
207 Ga0213876_10054804 3300021384 Bacteria 2104
208 Ga0213871_10047324 3300021441 Bacteria 1169
209 Ga0209435_101466 3300025206 Bacteria 2968
210 Ga0207666_1016202 3300025271 Bacteria 1067
211 Ga0207697_10036379 3300025315 Bacteria 2016
212 Ga0207682_10021515 3300025893 Bacteria 2538
213 Ga0207692_10240908 3300025898 Bacteria 1080
214 Ga0207710_10075360 3300025900 Bacteria 1555
215 Ga0207688_10014136 3300025901 Bacteria 4342
216 Ga0207680_10066983 3300025903 Bacteria 2210
217 Ga0207647_10048246 3300025904 Bacteria 2645
218 Ga0207699_10066938 3300025906 Bacteria 2182
219 Ga0207699_10109795 3300025906 Bacteria 1766
220 Ga0207645_10067510 3300025907 Bacteria 2286
221 Ga0207643_10032105 3300025908 Bacteria 2930
222 Ga0207643_10054976 3300025908 Bacteria 2263
223 Ga0207684_10136420 3300025910 Bacteria 2107
224 Ga0207707_10062471 3300025912 Bacteria 3241
225 Ga0207707_10149399 3300025912 Bacteria 2043
226 Ga0207707_10153764 3300025912 Bacteria 2011
227 Ga0207707_10160182 3300025912 Bacteria 1968
228 Ga0207707_10186855 3300025912 Bacteria 1808
229 Ga0207707_10432859 3300025912 Bacteria 1127
230 Ga0207695_10181649 3300025913 Bacteria 2024
231 Ga0207695_10192941 3300025913 Bacteria 1954
232 Ga0207695_10372456 3300025913 Bacteria 1314
233 Ga0207693_10066417 3300025915 Bacteria 2824
234 Ga0207693_10094351 3300025915 Bacteria 2345
235 Ga0207693_10215517 3300025915 Bacteria 1509
236 Ga0207663_10358326 3300025916 Bacteria 1106
237 Ga0207663_10501484 3300025916 Bacteria 943
238 Ga0207660_10136423 3300025917 Bacteria 1872
239 Ga0207660_10312553 3300025917 Bacteria 1253
240 Ga0207660_10386894 3300025917 Bacteria 1125
241 Ga0207662_10068695 3300025918 Bacteria 2140
242 Ga0207657_10100005 3300025919 Bacteria 2408
243 Ga0207657_10119739 3300025919 Bacteria 2166
244 Ga0207657_10120308 3300025919 Bacteria 2161
245 Ga0207649_10070043 3300025920 Bacteria 2235
246 Ga0207649_10285762 3300025920 Bacteria 1201
247 Ga0207652_10044871 3300025921 Bacteria 3768
248 Ga0207652_10141467 3300025921 Bacteria 2151
249 Ga0207652_10157723 3300025921 Bacteria 2033
250 Ga0207646_10139776 3300025922 Bacteria 2181
251 Ga0207646_10141114 3300025922 Bacteria 2170
252 Ga0207681_10062538 3300025923 Bacteria 2563
253 Ga0207694_10114617 3300025924 Bacteria 2147
254 Ga0207650_10114365 3300025925 Bacteria 2093
255 Ga0207650_10125464 3300025925 Bacteria 2003
256 Ga0207650_10231430 3300025925 Bacteria 1491
257 Ga0207659_10121360 3300025926 Bacteria 2003
258 Ga0207659_10254798 3300025926 Bacteria 1425
259 Ga0207659_10327330 3300025926 Bacteria 1266
260 Ga0207687_10627628 3300025927 Bacteria 908
261 Ga0207700_10028957 3300025928 Bacteria 3903
262 Ga0207700_10259626 3300025928 Bacteria 1487
263 Ga0207700_10320307 3300025928 Bacteria 1343
264 Ga0207664_10135240 3300025929 Bacteria 2079
265 Ga0207664_10159672 3300025929 Bacteria 1922
266 Ga0207664_10171063 3300025929 Bacteria 1859
267 Ga0207644_10224263 3300025931 Bacteria 1491
268 Ga0207644_10248119 3300025931 Bacteria 1419
269 Ga0207706_10058711 3300025933 Bacteria 3388
270 Ga0207706_10087834 3300025933 Bacteria 2734
271 Ga0207670_10048992 3300025936 Bacteria 2823
272 Ga0207669_10082453 3300025937 Bacteria 2064
273 Ga0207704_10080164 3300025938 Bacteria 2106
274 Ga0207665_10082185 3300025939 Bacteria 2219
275 Ga0207665_10085288 3300025939 Bacteria 2180
276 Ga0207691_10065165 3300025940 Bacteria 3299
277 Ga0207691_10066763 3300025940 Bacteria 3254
278 Ga0207711_10013248 3300025941 Bacteria 6852
279 Ga0207689_10137937 3300025942 Bacteria 2008
280 Ga0207661_10107127 3300025944 Bacteria 2357
281 Ga0207679_10085019 3300025945 Bacteria 2429
282 Ga0207679_10391000 3300025945 Bacteria 1221
283 Ga0207667_10189820 3300025949 Bacteria 2109
284 Ga0207667_10533551 3300025949 Bacteria 1188
285 Ga0207651_10072939 3300025960 Bacteria 2439
286 Ga0207651_10118796 3300025960 Bacteria 2000
287 Ga0207651_10388424 3300025960 Bacteria 1184
288 Ga0207712_10126213 3300025961 Bacteria 1943
289 Ga0207712_10537092 3300025961 Bacteria 1004
290 Ga0207668_10060946 3300025972 Bacteria 2650
291 Ga0207640_10150184 3300025981 Bacteria 1711
292 Ga0207640_10279969 3300025981 Bacteria 1309
293 Ga0207658_10118769 3300025986 Bacteria 2104
294 Ga0207658_10123200 3300025986 Bacteria 2070
295 Ga0207677_10111430 3300026023 Bacteria 2039
296 Ga0207677_10230580 3300026023 Bacteria 1491
297 Ga0207677_10350380 3300026023 Bacteria 1237
298 Ga0207703_10136158 3300026035 Bacteria 2126
299 Ga0207678_10165235 3300026067 Bacteria 1890
300 Ga0207708_10124733 3300026075 Bacteria 2009
301 Ga0207702_10149949 3300026078 Bacteria 2120
302 Ga0207641_10167151 3300026088 Bacteria 2004
303 Ga0207641_10282991 3300026088 Bacteria 1560
304 Ga0207641_10529774 3300026088 Bacteria 1147
305 Ga0207648_10089116 3300026089 Bacteria 2694
306 Ga0207676_10131370 3300026095 Bacteria 2129
307 Ga0207676_10210815 3300026095 Bacteria 1723
308 Ga0207674_10077032 3300026116 Bacteria 3341
309 Ga0207674_10165649 3300026116 Bacteria 2164
310 Ga0207675_100102917 3300026118 Bacteria 2691
311 Ga0207675_100142026 3300026118 Bacteria 2281
312 Ga0207675_100423492 3300026118 Bacteria 1315
313 Ga0207683_10132764 3300026121 Bacteria 2240
314 Ga0207683_10145618 3300026121 Bacteria 2136
315 Ga0207698_10152090 3300026142 Bacteria 2010
316 Ga0207428_10091740 3300027907 Bacteria 2358
317 Ga0207428_10113056 3300027907 Bacteria 2088
318 Ga0268266_10146810 3300028379 Bacteria 2121
319 Ga0268265_10145882 3300028380 Bacteria 1988
320 Ga0268264_10159076 3300028381 Bacteria 2033
321 Ga0268264_10382729 3300028381 Bacteria 1348
322 Ga0265338_10075613 3300028800 Bacteria 2857
323 Ga0265338_10117617 3300028800 Bacteria 2126
324 Ga0307413_10093061 3300031824 Bacteria 1969
325 Ga0307412_10338004 3300031911 Bacteria 1204
326 Ga0307416_100795143 3300032002 Bacteria 1041
327 Ga0373934_0028728 3300035086 Bacteria 2169
328 Ga0373932_0080826 3300035112 Bacteria 1026
329 Ga0373954_0047922 3300035118 Bacteria 2001
330 Ga0373954_0074941 3300035118 Bacteria 1611
331 Ga0373955_0047321 3300035172 Bacteria 2328
332 Ga0373955_0068463 3300035172 Bacteria 1978
333 Ga0373924_0059572 3300035410 Bacteria 1595
334 Ga0373931_0128609 3300035691 Bacteria 1455
335 Ga0373935_0254799 3300035692 Bacteria 1229
336 Ga0373933_0079997 3300035724 Bacteria 2002
337 Ga0373947_0114259 3300035725 Bacteria 1709
338 Ga0373937_0131816 3300036401 Bacteria 2334
339 Ga0373937_0171879 3300036401 Bacteria 2033
340 Ga0373925_0088463 3300037068 Bacteria 2365
341 Ga0395899_0068292 3300037312 Bacteria 2606
342 Ga0395899_0104975 3300037312 Bacteria 2036
343 Ga0395899_0111945 3300037312 Bacteria 1961
344 Ga0395900_0000813 3300037418 Bacteria 41294
345 Ga0395900_0021498 3300037418 Bacteria 6598
346 Ga0395900_0225008 3300037418 Bacteria 1889
347 Ga0395898_0015147 3300037466 Bacteria 7915
348 Ga0395898_0098657 3300037466 Bacteria 2805
349 Ga0395898_0150555 3300037466 Bacteria 2226
350 Ga0395905_0153572 3300037471 Bacteria 2165
351 Ga0395901_0005318 3300038443 Bacteria 13006
352 Ga0395901_0033513 3300038443 Bacteria 5302
353 Ga0395901_0224732 3300038443 Bacteria 1961
354 Ga0436365_0277082 3300039437 Bacteria 4021
355 Ga0436365_0752475 3300039437 Bacteria 2909
356 Ga0436365_0755302 3300039437 Bacteria 2021
357 Ga0436365_1166190 3300039437 Bacteria 2416
358 Ga0436365_1367102 3300039437 Bacteria 2034
359 Ga0436365_1792257 3300039437 Bacteria 1719
360 Ga0436365_1801881 3300039437 Bacteria 2421
361 Ga0436360_0647305 3300039438 Bacteria 2216
362 Ga0436360_0678977 3300039438 Bacteria 1073
363 Ga0436360_1060473 3300039438 Bacteria 1591
364 Ga0436361_0032161 3300039447 Bacteria 2333
365 Ga0436361_0474349 3300039447 Bacteria 1845
366 Ga0436363_0188014 3300039450 Bacteria 1433
367 Ga0436363_0299772 3300039450 Bacteria 1384
368 Ga0436363_1710797 3300039450 Bacteria 974
369 Ga0436362_0129397 3300039453 Bacteria 2654
370 Ga0436362_0305935 3300039453 Bacteria 1625
371 Ga0439464_0013228 3300042439 Bacteria 2206
372 Ga0466969_0056378 3300044656 Bacteria 1918
373 Ga0466966_0125926 3300044684 Bacteria 1571
374 Ga0466961_0097149 3300044693 Bacteria 1857
375 Ga0466961_0136521 3300044693 Bacteria 1536
376 Ga0466963_0157818 3300044694 Bacteria 1578
377 Ga0466964_0037142 3300044706 Bacteria 1955
378 Ga0466964_0086847 3300044706 Bacteria 1354
379 Ga0453684_0482510 3300044712 Bacteria 1375
380 Ga0466971_0010586 3300044719 Bacteria 4032
381 Ga0466971_0121471 3300044719 Bacteria 1209
382 Ga0466970_0293191 3300044765 Bacteria 916
383 Ga0466957_0151404 3300044842 Bacteria 1500
384 Ga0466959_0105952 3300045049 Bacteria 2010
385 Ga0466959_0389067 3300045049 Bacteria 948
386 Ga0451576_0189110 3300045051 Bacteria 2150
387 Ga0466958_0345452 3300045836 Bacteria 957
388 Ga0466967_0184917 3300045976 Bacteria 1967
389 Ga0495592_0089700 3300046454 Bacteria 2207
390 Ga0495629_0073541 3300046459 Bacteria 2386
391 Ga0495629_0091385 3300046459 Bacteria 2124
392 Ga0495629_0194251 3300046459 Bacteria 1404
393 Ga0495651_0105013 3300046462 Bacteria 2096
394 Ga0495653_0100542 3300046463 Bacteria 2096
395 Ga0495653_0104680 3300046463 Bacteria 2044
396 Ga0495580_0079412 3300046472 Bacteria 2288
397 Ga0495582_0026138 3300046473 Bacteria 3199
398 Ga0495582_0139892 3300046473 Bacteria 1371
399 Ga0495606_0014640 3300046507 Bacteria 6102
400 Ga0495608_0062508 3300046511 Bacteria 2446
401 Ga0495618_0078108 3300046514 Bacteria 2109
402 Ga0495628_0076190 3300046516 Bacteria 2610
403 Ga0495628_0114907 3300046516 Bacteria 2067
404 Ga0495630_0082599 3300046517 Bacteria 2425
405 Ga0495630_0102276 3300046517 Bacteria 2167
406 Ga0495666_0141074 3300046526 Bacteria 1123
407 Ga0495652_0118476 3300046529 Bacteria 2116
408 Ga0495665_0053720 3300046531 Bacteria 2129
409 Ga0495640_0067653 3300046533 Bacteria 2405
410 Ga0495587_0063620 3300046536 Bacteria 2157
411 Ga0495667_0069602 3300046559 Bacteria 2296
412 Ga0495634_0063061 3300046642 Bacteria 2460
413 Ga0495634_0264096 3300046642 Bacteria 1049
414 Ga0495635_0064311 3300046663 Bacteria 2518
415 Ga0495657_0082026 3300046675 Bacteria 2084
416 Ga0495657_0165935 3300046675 Bacteria 1363
417 Ga0495599_0065520 3300046678 Bacteria 2269
418 Ga0495623_0021590 3300046679 Bacteria 4157
419 Ga0495646_0078971 3300046680 Bacteria 1922
420 Ga0495658_0023462 3300046683 Bacteria 3274
421 Ga0495658_0048420 3300046683 Bacteria 2396
422 Ga0495669_0051071 3300046684 Bacteria 1855
423 Ga0495613_0093133 3300046689 Bacteria 2181
424 Ga0495624_0057579 3300046690 Bacteria 2443
425 Ga0495624_0248606 3300046690 Bacteria 1075
426 Ga0495649_0043021 3300046694 Bacteria 2466
427 Ga0495589_0056431 3300046794 Bacteria 1933
428 Ga0495589_0082401 3300046794 Bacteria 1564
429 Ga0495600_0087425 3300046809 Bacteria 2033
430 Ga0495581_0264711 3300047315 Bacteria 1005
431 Ga0495604_0089527 3300047317 Bacteria 2287
432 Ga0495604_0108693 3300047317 Bacteria 2025
433 Ga0495636_0198482 3300047318 Bacteria 915
434 Ga0495674_0126805 3300047319 Bacteria 2152
435 Ga0495676_0090641 3300047321 Bacteria 2287
436 Ga0495680_0059341 3300047322 Bacteria 2953
437 Ga0495680_0107451 3300047322 Bacteria 2072
438 Ga0495680_0241045 3300047322 Bacteria 1284
439 Ga0495683_0045344 3300047323 Bacteria 2209
440 Ga0495675_0077139 3300047444 Bacteria 2099
441 Ga0495679_024039 3300047446 Bacteria 2058
442 Ga0495673_0040942 3300047469 Bacteria 2089
443 Ga0495684_0060076 3300047471 Bacteria 2894
444 Ga0495686_0112137 3300047472 Bacteria 1634
445 Ga0495593_0051876 3300047673 Bacteria 2169
446 Ga0495602_0124798 3300048088 Bacteria 2064
447 Ga0495614_0036808 3300048089 Bacteria 2100
448 Ga0495614_0057073 3300048089 Bacteria 1676
449 Ga0496101_0551542 3300048904 Bacteria 911
450 Ga0496102_0335832 3300048905 Bacteria 1423
451 Ga0496104_0047528 3300048907 Bacteria 4044
452 Ga0496104_0481416 3300048907 Bacteria 1152
453 Ga0496105_0163114 3300048908 Bacteria 1829
454 Ga0496105_0293840 3300048908 Bacteria 1308
455 Ga0496106_0106307 3300048909 Bacteria 2181
456 Ga0496107_0075720 3300048910 Bacteria 2450
457 Ga0496108_0100048 3300048911 Bacteria 2472
458 Ga0496108_0569186 3300048911 Bacteria 988
459 Ga0496109_0397308 3300048912 Bacteria 1302
460 Ga0496110_0613516 3300048913 Bacteria 986
461 Ga0496115_0321147 3300048918 Bacteria 1266
462 Ga0496121_0152244 3300048924 Bacteria 1701
463 Ga0496124_0000145 3300048927 Bacteria 146878
464 Ga0501031_0012979 3300049568 Bacteria 5437
465 Ga0501032_0018596 3300049569 Bacteria 4866
466 Ga0501032_0095165 3300049569 Bacteria 1974
467 Ga0501032_0195732 3300049569 Bacteria 1320
468 Ga0501033_0020555 3300049570 Bacteria 4988
469 Ga0501033_0049272 3300049570 Bacteria 3126
470 Ga0501033_0115502 3300049570 Bacteria 1950
471 Ga0501034_0180802 3300049571 Bacteria 2074
472 Ga0501034_0197932 3300049571 Bacteria 1968
473 Ga0501036_0030756 3300049572 Bacteria 4535
474 Ga0501037_0032328 3300049573 Bacteria 3863
475 Ga0501038_0014208 3300049574 Bacteria 7254
476 Ga0501038_0063646 3300049574 Bacteria 3147
477 Ga0501038_0142030 3300049574 Bacteria 1963
478 Ga0501039_0117846 3300049575 Bacteria 2079
479 Ga0501040_0014871 3300049576 Bacteria 5137
480 Ga0501042_0103665 3300049578 Bacteria 2046
481 Ga0501043_0108811 3300049579 Bacteria 2176
482 Ga0501046_0088785 3300049580 Bacteria 2380
483 Ga0501046_0108100 3300049580 Bacteria 2127
484 Ga0501046_0395388 3300049580 Bacteria 999
485 Ga0501047_0173243 3300049581 Bacteria 2026
486 Ga0501048_0050602 3300049582 Bacteria 2958
487 Ga0501048_0266551 3300049582 Bacteria 1217
488 Ga0501068_0041866 3300049584 Bacteria 2753
489 Ga0501069_0313150 3300049585 Bacteria 921
490 Ga0501070_0107999 3300049586 Bacteria 2299
491 Ga0501071_0123293 3300049587 Bacteria 1922
492 Ga0501072_0144191 3300049588 Bacteria 1899
493 Ga0501079_0378362 3300049741 Bacteria 1110
494 Ga0501035_0025050 3300049822 Bacteria 5470
495 Ga0501035_0043061 3300049822 Bacteria 4069
496 Ga0501035_0323043 3300049822 Bacteria 1296
497 Ga0501044_0151165 3300049823 Bacteria 2303
498 Ga0501044_0185524 3300049823 Bacteria 2045
499 Ga0501045_0073580 3300049824 Bacteria 2516
500 nmdc:mga0qj67_252155_c1 3300050509 Bacteria 1432
501 nmdc:mga08y16_106701_c1 3300050511 Bacteria 2916
502 nmdc:mga08y16_45282_c1 3300050511 Bacteria 4610
503 Ga0495601_0097843 3300053077 Bacteria 1893
504 Ga0495595_0029968 3300053084 Bacteria 2438
505 Ga0495595_0041746 3300053084 Bacteria 2100
506 Ga0495619_0057446 3300053085 Bacteria 2582
507 Ga0495619_0110582 3300053085 Bacteria 1877
508 Ga0501084_0277880 3300054114 Bacteria 1414
509 Ga0466962_0024434 3300061719 Bacteria 2902

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10230097 Ga0157370_102300971 230
2 3300044693 Ga0466961_0097149 Ga0466961_0097149_80_832 239
3 3300044694 Ga0466963_0157818 Ga0466963_0157818_338_1090 239
4 3300044706 Ga0466964_0086847 Ga0466964_0086847_481_1233 239
5 3300045836 Ga0466958_0345452 Ga0466958_0345452_45_797 239
6 3300045976 Ga0466967_0184917 Ga0466967_0184917_1141_1893 239
7 3300009174 Ga0105241_10394841 Ga0105241_103948412 240
8 3300013104 Ga0157370_10158350 Ga0157370_101583503 240
9 3300044765 Ga0466970_0293191 Ga0466970_0293191_61_813 240
10 3300045049 Ga0466959_0389067 Ga0466959_0389067_136_888 240
11 3300028800 Ga0265338_10117617 Ga0265338_101176173 244
12 3300048904 Ga0496101_0551542 Ga0496101_0551542_11_754 247
13 3300037312 Ga0395899_0104975 Ga0395899_0104975_81_833 249
14 3300037418 Ga0395900_0225008 Ga0395900_0225008_671_1423 249
15 3300005338 Ga0068868_100088988 Ga0068868_1000889881 250
16 3300005354 Ga0070675_100117879 Ga0070675_1001178792 250
17 3300005355 Ga0070671_100137778 Ga0070671_1001377783 250
18 3300005364 Ga0070673_100120356 Ga0070673_1001203562 250
19 3300005466 Ga0070685_10248247 Ga0070685_102482472 250
20 3300005544 Ga0070686_100102748 Ga0070686_1001027482 250
21 3300005548 Ga0070665_100383700 Ga0070665_1003837001 250
22 3300014968 Ga0157379_10148564 Ga0157379_101485642 250
23 3300025926 Ga0207659_10254798 Ga0207659_102547982 250
24 3300025960 Ga0207651_10388424 Ga0207651_103884242 250
25 3300044719 Ga0466971_0121471 Ga0466971_0121471_309_1097 251
26 3300037312 Ga0395899_0068292 Ga0395899_0068292_713_1501 252
27 3300037312 Ga0395899_0111945 Ga0395899_0111945_73_861 252
28 3300037418 Ga0395900_0000813 Ga0395900_0000813_3861_4649 252
29 3300037418 Ga0395900_0021498 Ga0395900_0021498_74_862 252
30 3300037466 Ga0395898_0015147 Ga0395898_0015147_3341_4129 252
31 3300038443 Ga0395901_0224732 Ga0395901_0224732_74_862 252
32 3300044684 Ga0466966_0125926 Ga0466966_0125926_705_1493 252
33 3300044842 Ga0466957_0151404 Ga0466957_0151404_25_813 252
34 3300026088 Ga0207641_10529774 Ga0207641_105297741 255
35 3300005293 Ga0065715_10143805 Ga0065715_101438052 256
36 3300005330 Ga0070690_100245971 Ga0070690_1002459711 256
37 3300005330 Ga0070690_100359825 Ga0070690_1003598251 256
38 3300005331 Ga0070670_100141069 Ga0070670_1001410691 256
39 3300005331 Ga0070670_100157144 Ga0070670_1001571442 256
40 3300005335 Ga0070666_10260734 Ga0070666_102607342 256
41 3300005340 Ga0070689_100515733 Ga0070689_1005157332 256
42 3300005355 Ga0070671_100232151 Ga0070671_1002321512 256
43 3300005365 Ga0070688_100133065 Ga0070688_1001330652 256
44 3300005365 Ga0070688_100340785 Ga0070688_1003407851 256
45 3300005367 Ga0070667_100265588 Ga0070667_1002655882 256
46 3300005435 Ga0070714_100117967 Ga0070714_1001179672 256
47 3300005436 Ga0070713_100085390 Ga0070713_1000853902 256
48 3300005437 Ga0070710_10041289 Ga0070710_100412892 256
49 3300005439 Ga0070711_100064589 Ga0070711_1000645893 256
50 3300005439 Ga0070711_100406074 Ga0070711_1004060742 256
51 3300005440 Ga0070705_100060089 Ga0070705_1000600892 256
52 3300005440 Ga0070705_100506666 Ga0070705_1005066661 256
53 3300005445 Ga0070708_100506761 Ga0070708_1005067611 256
54 3300005457 Ga0070662_100368940 Ga0070662_1003689401 256
55 3300005458 Ga0070681_10471025 Ga0070681_104710252 256
56 3300005468 Ga0070707_100137976 Ga0070707_1001379762 256
57 3300005471 Ga0070698_100134342 Ga0070698_1001343422 256
58 3300005471 Ga0070698_100149087 Ga0070698_1001490872 256
59 3300005518 Ga0070699_100052661 Ga0070699_1000526612 256
60 3300005564 Ga0070664_100722149 Ga0070664_1007221491 256
61 3300005615 Ga0070702_100292131 Ga0070702_1002921312 256
62 3300005618 Ga0068864_100094049 Ga0068864_1000940492 256
63 3300005840 Ga0068870_10110698 Ga0068870_101106982 256
64 3300006028 Ga0070717_10079634 Ga0070717_100796342 256
65 3300006028 Ga0070717_10256784 Ga0070717_102567842 256
66 3300006173 Ga0070716_100075329 Ga0070716_1000753292 256
67 3300006175 Ga0070712_100069380 Ga0070712_1000693802 256
68 3300006175 Ga0070712_100105560 Ga0070712_1001055602 256
69 3300006237 Ga0097621_100358916 Ga0097621_1003589162 256
70 3300006852 Ga0075433_10456588 Ga0075433_104565882 256
71 3300007788 Ga0099795_10065386 Ga0099795_100653862 256
72 3300009098 Ga0105245_10091304 Ga0105245_100913042 256
73 3300009101 Ga0105247_10148029 Ga0105247_101480292 256
74 3300009177 Ga0105248_10493050 Ga0105248_104930502 256
75 3300009553 Ga0105249_10209316 Ga0105249_102093162 256
76 3300010159 Ga0099796_10026560 Ga0099796_100265602 256
77 3300010375 Ga0105239_10226068 Ga0105239_102260682 256
78 3300011119 Ga0105246_10024267 Ga0105246_100242672 256
79 3300013297 Ga0157378_10138132 Ga0157378_101381323 256
80 3300013306 Ga0163162_10266147 Ga0163162_102661472 256
81 3300013308 Ga0157375_10093524 Ga0157375_100935244 256
82 3300014325 Ga0163163_10138699 Ga0163163_101386992 256
83 3300014325 Ga0163163_10492773 Ga0163163_104927732 256
84 3300014969 Ga0157376_10297916 Ga0157376_102979161 256
85 3300014969 Ga0157376_10389167 Ga0157376_103891672 256
86 3300017792 Ga0163161_10091147 Ga0163161_100911472 256
87 3300021384 Ga0213876_10054804 Ga0213876_100548042 256
88 3300025900 Ga0207710_10075360 Ga0207710_100753602 256
89 3300025906 Ga0207699_10066938 Ga0207699_100669381 256
90 3300025908 Ga0207643_10032105 Ga0207643_100321053 256
91 3300025910 Ga0207684_10136420 Ga0207684_101364202 256
92 3300025912 Ga0207707_10432859 Ga0207707_104328591 256
93 3300025915 Ga0207693_10066417 Ga0207693_100664172 256
94 3300025915 Ga0207693_10215517 Ga0207693_102155171 256
95 3300025916 Ga0207663_10358326 Ga0207663_103583262 256
96 3300025916 Ga0207663_10501484 Ga0207663_105014842 256
97 3300025918 Ga0207662_10068695 Ga0207662_100686952 256
98 3300025922 Ga0207646_10141114 Ga0207646_101411142 256
99 3300025925 Ga0207650_10231430 Ga0207650_102314301 256
100 3300025927 Ga0207687_10627628 Ga0207687_106276281 256
101 3300025928 Ga0207700_10028957 Ga0207700_100289572 256
102 3300025929 Ga0207664_10135240 Ga0207664_101352402 256
103 3300025929 Ga0207664_10159672 Ga0207664_101596721 256
104 3300025931 Ga0207644_10248119 Ga0207644_102481192 256
105 3300025933 Ga0207706_10087834 Ga0207706_100878343 256
106 3300025939 Ga0207665_10085288 Ga0207665_100852882 256
107 3300026023 Ga0207677_10111430 Ga0207677_101114302 256
108 3300026023 Ga0207677_10230580 Ga0207677_102305802 256
109 3300026067 Ga0207678_10165235 Ga0207678_101652352 256
110 3300026075 Ga0207708_10124733 Ga0207708_101247332 256
111 3300026095 Ga0207676_10210815 Ga0207676_102108151 256
112 3300026121 Ga0207683_10132764 Ga0207683_101327642 256
113 3300026121 Ga0207683_10145618 Ga0207683_101456182 256
114 3300027907 Ga0207428_10113056 Ga0207428_101130562 256
115 3300037466 Ga0395898_0150555 Ga0395898_0150555_1227_1997 256
116 3300038443 Ga0395901_0005318 Ga0395901_0005318_1100_1870 256
117 3300039437 Ga0436365_1166190 Ga0436365_1166190_1252_2037 256
118 3300046459 Ga0495629_0194251 Ga0495629_0194251_55_825 256
119 3300046683 Ga0495658_0048420 Ga0495658_0048420_356_1141 256
120 3300047322 Ga0495680_0241045 Ga0495680_0241045_100_870 256
121 3300048907 Ga0496104_0047528 Ga0496104_0047528_3069_3854 256
122 3300048908 Ga0496105_0293840 Ga0496105_0293840_255_1040 256
123 3300048909 Ga0496106_0106307 Ga0496106_0106307_1306_2076 256
124 3300048910 Ga0496107_0075720 Ga0496107_0075720_1527_2297 256
125 3300048911 Ga0496108_0100048 Ga0496108_0100048_1545_2315 256
126 3300048912 Ga0496109_0397308 Ga0496109_0397308_422_1192 256
127 3300048913 Ga0496110_0613516 Ga0496110_0613516_13_783 256
128 3300049569 Ga0501032_0018596 Ga0501032_0018596_1954_2724 256
129 3300049570 Ga0501033_0020555 Ga0501033_0020555_181_951 256
130 3300049574 Ga0501038_0014208 Ga0501038_0014208_5323_6093 256
131 3300049580 Ga0501046_0395388 Ga0501046_0395388_144_929 256
132 3300049822 Ga0501035_0025050 Ga0501035_0025050_2735_3505 256
133 3300050511 nmdc:mga08y16_106701_c1 nmdc:mga08y16_106701_c1_1225_1995 256
134 3300021358 Ga0213873_10009512 Ga0213873_100095122 257
135 3300028800 Ga0265338_10075613 Ga0265338_100756132 257
136 3300035692 Ga0373935_0254799 Ga0373935_0254799_259_1047 257
137 3300035725 Ga0373947_0114259 Ga0373947_0114259_210_998 257
138 3300037068 Ga0373925_0088463 Ga0373925_0088463_347_1135 257
139 3300039437 Ga0436365_0755302 Ga0436365_0755302_529_1320 257
140 3300044693 Ga0466961_0136521 Ga0466961_0136521_580_1353 257
141 3300044712 Ga0453684_0482510 Ga0453684_0482510_364_1140 257
142 3300044719 Ga0466971_0010586 Ga0466971_0010586_633_1406 257
143 3300046472 Ga0495580_0079412 Ga0495580_0079412_226_1014 257
144 3300049585 Ga0501069_0313150 Ga0501069_0313150_64_837 257
145 3300049587 Ga0501071_0123293 Ga0501071_0123293_90_863 257
146 3300049588 Ga0501072_0144191 Ga0501072_0144191_112_885 257
147 3300054114 Ga0501084_0277880 Ga0501084_0277880_41_814 257
148 3300061719 Ga0466962_0024434 Ga0466962_0024434_1681_2454 257
149 iso_pu_bacteria 2512047030 2512344627 257
150 iso_pu_bacteria 2513237082 2513558562 257
151 iso_pu_bacteria 2513237082 2513558705 257
152 iso_pu_bacteria 2744054900 2746091657 257
153 iso_pu_bacteria 2744054901 2746099189 257
154 iso_pu_bacteria 2885266251 2885270236 257
155 iso_pu_bacteria 2901300506 2901306031 257
156 iso_pu_bacteria 8056161164 8056163231 257
157 3300005336 Ga0070680_100107802 Ga0070680_1001078023 258
158 3300005366 Ga0070659_100309367 Ga0070659_1003093672 258
159 3300005530 Ga0070679_100125216 Ga0070679_1001252163 258
160 3300005563 Ga0068855_100173775 Ga0068855_1001737751 258
161 3300005564 Ga0070664_100058215 Ga0070664_1000582153 258
162 3300005564 Ga0070664_100143598 Ga0070664_1001435983 258
163 3300009093 Ga0105240_10514076 Ga0105240_105140762 258
164 3300009174 Ga0105241_10441635 Ga0105241_104416352 258
165 3300009551 Ga0105238_10112851 Ga0105238_101128512 258
166 3300013104 Ga0157370_10121116 Ga0157370_101211161 258
167 3300013105 Ga0157369_10128761 Ga0157369_101287612 258
168 3300021384 Ga0213876_10040373 Ga0213876_100403732 258
169 3300025912 Ga0207707_10062471 Ga0207707_100624712 258
170 3300025917 Ga0207660_10136423 Ga0207660_101364231 258
171 3300025920 Ga0207649_10285762 Ga0207649_102857622 258
172 3300025921 Ga0207652_10157723 Ga0207652_101577231 258
173 3300025924 Ga0207694_10114617 Ga0207694_101146173 258
174 3300025945 Ga0207679_10085019 Ga0207679_100850191 258
175 3300025949 Ga0207667_10189820 Ga0207667_101898203 258
176 3300031824 Ga0307413_10093061 Ga0307413_100930611 258
177 3300032002 Ga0307416_100795143 Ga0307416_1007951431 258
178 3300037466 Ga0395898_0098657 Ga0395898_0098657_396_1172 258
179 3300039437 Ga0436365_1801881 Ga0436365_1801881_61_837 258
180 3300048908 Ga0496105_0163114 Ga0496105_0163114_942_1718 258
181 3300048918 Ga0496115_0321147 Ga0496115_0321147_307_1083 258
182 3300048924 Ga0496121_0152244 Ga0496121_0152244_837_1613 258
183 3300003320 rootH2_10056772 rootH2_100567722 259
184 3300005336 Ga0070680_100095994 Ga0070680_1000959942 259
185 3300005344 Ga0070661_100331945 Ga0070661_1003319452 259
186 3300005434 Ga0070709_10040937 Ga0070709_100409373 259
187 3300005435 Ga0070714_100206950 Ga0070714_1002069501 259
188 3300005458 Ga0070681_10129528 Ga0070681_101295282 259
189 3300005458 Ga0070681_10215125 Ga0070681_102151252 259
190 3300005530 Ga0070679_100025401 Ga0070679_1000254012 259
191 3300005539 Ga0068853_100655691 Ga0068853_1006556912 259
192 3300005563 Ga0068855_100806612 Ga0068855_1008066121 259
193 3300005564 Ga0070664_100131848 Ga0070664_1001318482 259
194 3300005577 Ga0068857_100160535 Ga0068857_1001605351 259
195 3300005577 Ga0068857_100175341 Ga0068857_1001753411 259
196 3300005578 Ga0068854_100268478 Ga0068854_1002684782 259
197 3300005578 Ga0068854_100432444 Ga0068854_1004324442 259
198 3300005614 Ga0068856_100247335 Ga0068856_1002473352 259
199 3300005616 Ga0068852_100093693 Ga0068852_1000936933 259
200 3300005616 Ga0068852_100205922 Ga0068852_1002059221 259
201 3300005618 Ga0068864_100229828 Ga0068864_1002298282 259
202 3300005719 Ga0068861_100271981 Ga0068861_1002719812 259
203 3300005834 Ga0068851_10041699 Ga0068851_100416993 259
204 3300006237 Ga0097621_100144105 Ga0097621_1001441052 259
205 3300006846 Ga0075430_100103207 Ga0075430_1001032072 259
206 3300009093 Ga0105240_10220683 Ga0105240_102206833 259
207 3300009093 Ga0105240_10352080 Ga0105240_103520801 259
208 3300009551 Ga0105238_10404798 Ga0105238_104047981 259
209 3300013104 Ga0157370_10104587 Ga0157370_101045873 259
210 3300013105 Ga0157369_10183345 Ga0157369_101833453 259
211 3300013307 Ga0157372_10231043 Ga0157372_102310433 259
212 3300025913 Ga0207695_10181649 Ga0207695_101816491 259
213 3300025913 Ga0207695_10192941 Ga0207695_101929411 259
214 3300025913 Ga0207695_10372456 Ga0207695_103724561 259
215 3300025919 Ga0207657_10100005 Ga0207657_101000052 259
216 3300025928 Ga0207700_10259626 Ga0207700_102596262 259
217 3300025929 Ga0207664_10171063 Ga0207664_101710631 259
218 3300025981 Ga0207640_10279969 Ga0207640_102799692 259
219 3300026078 Ga0207702_10149949 Ga0207702_101499493 259
220 3300026116 Ga0207674_10077032 Ga0207674_100770325 259
221 3300026116 Ga0207674_10165649 Ga0207674_101656491 259
222 3300026118 Ga0207675_100423492 Ga0207675_1004234922 259
223 3300026142 Ga0207698_10152090 Ga0207698_101520902 259
224 3300031911 Ga0307412_10338004 Ga0307412_103380042 259
225 3300035086 Ga0373934_0028728 Ga0373934_0028728_1248_2045 259
226 3300035112 Ga0373932_0080826 Ga0373932_0080826_178_957 259
227 3300035118 Ga0373954_0047922 Ga0373954_0047922_1125_1922 259
228 3300035118 Ga0373954_0074941 Ga0373954_0074941_705_1484 259
229 3300035172 Ga0373955_0047321 Ga0373955_0047321_1454_2233 259
230 3300035172 Ga0373955_0068463 Ga0373955_0068463_1163_1960 259
231 3300035410 Ga0373924_0059572 Ga0373924_0059572_696_1475 259
232 3300035691 Ga0373931_0128609 Ga0373931_0128609_615_1394 259
233 3300035724 Ga0373933_0079997 Ga0373933_0079997_1149_1928 259
234 3300036401 Ga0373937_0131816 Ga0373937_0131816_63_860 259
235 3300036401 Ga0373937_0171879 Ga0373937_0171879_150_929 259
236 3300039437 Ga0436365_0752475 Ga0436365_0752475_281_1066 259
237 3300039437 Ga0436365_1367102 Ga0436365_1367102_1106_1903 259
238 3300044706 Ga0466964_0037142 Ga0466964_0037142_56_835 259
239 3300045051 Ga0451576_0189110 Ga0451576_0189110_215_994 259
240 3300046454 Ga0495592_0089700 Ga0495592_0089700_1182_1979 259
241 3300046459 Ga0495629_0073541 Ga0495629_0073541_447_1244 259
242 3300046462 Ga0495651_0105013 Ga0495651_0105013_1151_1948 259
243 3300046463 Ga0495653_0104680 Ga0495653_0104680_1200_1997 259
244 3300046473 Ga0495582_0026138 Ga0495582_0026138_1006_1803 259
245 3300046511 Ga0495608_0062508 Ga0495608_0062508_1126_1923 259
246 3300046514 Ga0495618_0078108 Ga0495618_0078108_170_967 259
247 3300046516 Ga0495628_0076190 Ga0495628_0076190_324_1121 259
248 3300046517 Ga0495630_0082599 Ga0495630_0082599_315_1112 259
249 3300046529 Ga0495652_0118476 Ga0495652_0118476_1144_1941 259
250 3300046533 Ga0495640_0067653 Ga0495640_0067653_347_1144 259
251 3300046536 Ga0495587_0063620 Ga0495587_0063620_168_965 259
252 3300046559 Ga0495667_0069602 Ga0495667_0069602_353_1150 259
253 3300046642 Ga0495634_0063061 Ga0495634_0063061_554_1351 259
254 3300046663 Ga0495635_0064311 Ga0495635_0064311_611_1408 259
255 3300046675 Ga0495657_0082026 Ga0495657_0082026_156_953 259
256 3300046678 Ga0495599_0065520 Ga0495599_0065520_96_893 259
257 3300046683 Ga0495658_0023462 Ga0495658_0023462_1720_2517 259
258 3300046689 Ga0495613_0093133 Ga0495613_0093133_183_980 259
259 3300046690 Ga0495624_0057579 Ga0495624_0057579_1331_2128 259
260 3300046809 Ga0495600_0087425 Ga0495600_0087425_1138_1935 259
261 3300047317 Ga0495604_0089527 Ga0495604_0089527_1209_2006 259
262 3300047322 Ga0495680_0059341 Ga0495680_0059341_662_1459 259
263 3300047471 Ga0495684_0060076 Ga0495684_0060076_1474_2271 259
264 3300048089 Ga0495614_0057073 Ga0495614_0057073_211_1008 259
265 3300049580 Ga0501046_0088785 Ga0501046_0088785_1015_1815 259
266 3300050509 nmdc:mga0qj67_252155_c1 nmdc:mga0qj67_252155_c1_248_1027 259
267 3300053077 Ga0495601_0097843 Ga0495601_0097843_63_860 259
268 3300053084 Ga0495595_0029968 Ga0495595_0029968_316_1113 259
269 3300053084 Ga0495595_0041746 Ga0495595_0041746_1242_2021 259
270 3300053085 Ga0495619_0057446 Ga0495619_0057446_507_1304 259
271 3300053085 Ga0495619_0110582 Ga0495619_0110582_1066_1845 259
272 3300005329 Ga0070683_100265719 Ga0070683_1002657191 260
273 3300005344 Ga0070661_100195661 Ga0070661_1001956612 260
274 3300005458 Ga0070681_10167847 Ga0070681_101678472 260
275 3300005530 Ga0070679_100164621 Ga0070679_1001646212 260
276 3300013105 Ga0157369_10222949 Ga0157369_102229492 260
277 3300025912 Ga0207707_10149399 Ga0207707_101493992 260
278 3300025912 Ga0207707_10160182 Ga0207707_101601822 260
279 3300025917 Ga0207660_10312553 Ga0207660_103125532 260
280 3300025921 Ga0207652_10141467 Ga0207652_101414673 260
281 3300025944 Ga0207661_10107127 Ga0207661_101071273 260
282 3300037471 Ga0395905_0153572 Ga0395905_0153572_257_1042 260
283 3300048927 Ga0496124_0000145 Ga0496124_0000145_143042_143824 260
284 3300049568 Ga0501031_0012979 Ga0501031_0012979_1419_2201 260
285 3300049569 Ga0501032_0095165 Ga0501032_0095165_1115_1897 260
286 3300049570 Ga0501033_0049272 Ga0501033_0049272_2309_3091 260
287 3300049570 Ga0501033_0115502 Ga0501033_0115502_36_818 260
288 3300049571 Ga0501034_0197932 Ga0501034_0197932_77_859 260
289 3300049572 Ga0501036_0030756 Ga0501036_0030756_1292_2074 260
290 3300049573 Ga0501037_0032328 Ga0501037_0032328_1846_2628 260
291 3300049574 Ga0501038_0063646 Ga0501038_0063646_2302_3084 260
292 3300049574 Ga0501038_0142030 Ga0501038_0142030_105_887 260
293 3300049575 Ga0501039_0117846 Ga0501039_0117846_1221_2003 260
294 3300049576 Ga0501040_0014871 Ga0501040_0014871_1235_2017 260
295 3300049578 Ga0501042_0103665 Ga0501042_0103665_145_927 260
296 3300049579 Ga0501043_0108811 Ga0501043_0108811_1296_2078 260
297 3300049580 Ga0501046_0108100 Ga0501046_0108100_111_893 260
298 3300049581 Ga0501047_0173243 Ga0501047_0173243_89_871 260
299 3300049582 Ga0501048_0050602 Ga0501048_0050602_85_867 260
300 3300049584 Ga0501068_0041866 Ga0501068_0041866_125_907 260
301 3300049586 Ga0501070_0107999 Ga0501070_0107999_156_938 260
302 3300049741 Ga0501079_0378362 Ga0501079_0378362_46_840 260
303 3300049822 Ga0501035_0043061 Ga0501035_0043061_1311_2093 260
304 3300049823 Ga0501044_0151165 Ga0501044_0151165_286_1068 260
305 3300049824 Ga0501045_0073580 Ga0501045_0073580_1177_1959 260
306 3300002076 JGI24749J21850_1003937 JGI24749J21850_10039372 261
307 3300002077 JGI24744J21845_10012598 JGI24744J21845_100125982 261
308 3300002244 JGI24742J22300_10005870 JGI24742J22300_100058701 261
309 3300002459 JGI24751J29686_10033234 JGI24751J29686_100332342 261
310 3300005290 Ga0065712_10103972 Ga0065712_101039722 261
311 3300005293 Ga0065715_10105084 Ga0065715_101050843 261
312 3300005328 Ga0070676_10073703 Ga0070676_100737033 261
313 3300005330 Ga0070690_100258411 Ga0070690_1002584111 261
314 3300005331 Ga0070670_100067442 Ga0070670_1000674422 261
315 3300005331 Ga0070670_100122456 Ga0070670_1001224562 261
316 3300005333 Ga0070677_10023543 Ga0070677_100235432 261
317 3300005334 Ga0068869_100182010 Ga0068869_1001820102 261
318 3300005335 Ga0070666_10089482 Ga0070666_100894821 261
319 3300005336 Ga0070680_100420659 Ga0070680_1004206592 261
320 3300005338 Ga0068868_100119345 Ga0068868_1001193452 261
321 3300005339 Ga0070660_100167148 Ga0070660_1001671481 261
322 3300005340 Ga0070689_100064573 Ga0070689_1000645732 261
323 3300005344 Ga0070661_100061698 Ga0070661_1000616982 261
324 3300005347 Ga0070668_100073141 Ga0070668_1000731413 261
325 3300005347 Ga0070668_100089672 Ga0070668_1000896723 261
326 3300005353 Ga0070669_100046015 Ga0070669_1000460152 261
327 3300005354 Ga0070675_100083460 Ga0070675_1000834603 261
328 3300005354 Ga0070675_100087360 Ga0070675_1000873602 261
329 3300005355 Ga0070671_100235148 Ga0070671_1002351482 261
330 3300005356 Ga0070674_100089011 Ga0070674_1000890112 261
331 3300005364 Ga0070673_100112222 Ga0070673_1001122222 261
332 3300005364 Ga0070673_100315049 Ga0070673_1003150492 261
333 3300005365 Ga0070688_100074859 Ga0070688_1000748592 261
334 3300005367 Ga0070667_100150761 Ga0070667_1001507612 261
335 3300005367 Ga0070667_100520733 Ga0070667_1005207331 261
336 3300005435 Ga0070714_100075935 Ga0070714_1000759353 261
337 3300005436 Ga0070713_100053706 Ga0070713_1000537062 261
338 3300005436 Ga0070713_100369770 Ga0070713_1003697702 261
339 3300005440 Ga0070705_100463650 Ga0070705_1004636501 261
340 3300005441 Ga0070700_100072891 Ga0070700_1000728913 261
341 3300005456 Ga0070678_100105002 Ga0070678_1001050022 261
342 3300005457 Ga0070662_100125166 Ga0070662_1001251661 261
343 3300005458 Ga0070681_10138252 Ga0070681_101382522 261
344 3300005458 Ga0070681_10177082 Ga0070681_101770821 261
345 3300005459 Ga0068867_100075942 Ga0068867_1000759422 261
346 3300005466 Ga0070685_10065462 Ga0070685_100654622 261
347 3300005530 Ga0070679_100070314 Ga0070679_1000703143 261
348 3300005539 Ga0068853_100227771 Ga0068853_1002277712 261
349 3300005539 Ga0068853_100498966 Ga0068853_1004989661 261
350 3300005543 Ga0070672_100118609 Ga0070672_1001186091 261
351 3300005543 Ga0070672_100131379 Ga0070672_1001313791 261
352 3300005546 Ga0070696_100252479 Ga0070696_1002524792 261
353 3300005548 Ga0070665_100116582 Ga0070665_1001165824 261
354 3300005563 Ga0068855_100549678 Ga0068855_1005496782 261
355 3300005564 Ga0070664_100089788 Ga0070664_1000897882 261
356 3300005564 Ga0070664_100127752 Ga0070664_1001277522 261
357 3300005578 Ga0068854_100099866 Ga0068854_1000998662 261
358 3300005615 Ga0070702_100098071 Ga0070702_1000980712 261
359 3300005615 Ga0070702_100358808 Ga0070702_1003588081 261
360 3300005616 Ga0068852_100161675 Ga0068852_1001616752 261
361 3300005617 Ga0068859_100224205 Ga0068859_1002242051 261
362 3300005618 Ga0068864_100008276 Ga0068864_1000082762 261
363 3300005618 Ga0068864_100151258 Ga0068864_1001512582 261
364 3300005719 Ga0068861_100067495 Ga0068861_1000674952 261
365 3300005719 Ga0068861_100247120 Ga0068861_1002471202 261
366 3300005840 Ga0068870_10045027 Ga0068870_100450271 261
367 3300005841 Ga0068863_100145674 Ga0068863_1001456741 261
368 3300005841 Ga0068863_100190910 Ga0068863_1001909102 261
369 3300005842 Ga0068858_100144708 Ga0068858_1001447082 261
370 3300005843 Ga0068860_100161532 Ga0068860_1001615321 261
371 3300005843 Ga0068860_100175815 Ga0068860_1001758153 261
372 3300005844 Ga0068862_100111473 Ga0068862_1001114732 261
373 3300005844 Ga0068862_100149621 Ga0068862_1001496213 261
374 3300006028 Ga0070717_10378538 Ga0070717_103785381 261
375 3300006173 Ga0070716_100102769 Ga0070716_1001027692 261
376 3300006358 Ga0068871_100258588 Ga0068871_1002585882 261
377 3300006358 Ga0068871_100313585 Ga0068871_1003135852 261
378 3300006881 Ga0068865_100106408 Ga0068865_1001064082 261
379 3300006931 Ga0097620_100224199 Ga0097620_1002241991 261
380 3300009093 Ga0105240_10690684 Ga0105240_106906841 261
381 3300009094 Ga0111539_10116016 Ga0111539_101160161 261
382 3300009553 Ga0105249_10736125 Ga0105249_107361251 261
383 3300013100 Ga0157373_10337425 Ga0157373_103374251 261
384 3300013104 Ga0157370_10179084 Ga0157370_101790842 261
385 3300013104 Ga0157370_10317482 Ga0157370_103174821 261
386 3300013105 Ga0157369_10059593 Ga0157369_100595934 261
387 3300013296 Ga0157374_10147663 Ga0157374_101476633 261
388 3300013297 Ga0157378_10186151 Ga0157378_101861512 261
389 3300013306 Ga0163162_10118518 Ga0163162_101185183 261
390 3300013306 Ga0163162_10154383 Ga0163162_101543834 261
391 3300013306 Ga0163162_10202111 Ga0163162_102021112 261
392 3300013308 Ga0157375_10056372 Ga0157375_100563724 261
393 3300013308 Ga0157375_10145632 Ga0157375_101456322 261
394 3300014326 Ga0157380_10036341 Ga0157380_100363413 261
395 3300014326 Ga0157380_10063179 Ga0157380_100631791 261
396 3300014969 Ga0157376_10047001 Ga0157376_100470015 261
397 3300017792 Ga0163161_10070026 Ga0163161_100700263 261
398 3300017792 Ga0163161_10091695 Ga0163161_100916952 261
399 3300021358 Ga0213873_10033856 Ga0213873_100338562 261
400 3300021358 Ga0213873_10038007 Ga0213873_100380072 261
401 3300021377 Ga0213874_10020086 Ga0213874_100200862 261
402 3300021441 Ga0213871_10047324 Ga0213871_100473242 261
403 3300025206 Ga0209435_101466 Ga0209435_1014662 261
404 3300025271 Ga0207666_1016202 Ga0207666_10162022 261
405 3300025315 Ga0207697_10036379 Ga0207697_100363792 261
406 3300025893 Ga0207682_10021515 Ga0207682_100215152 261
407 3300025898 Ga0207692_10240908 Ga0207692_102409081 261
408 3300025901 Ga0207688_10014136 Ga0207688_100141362 261
409 3300025903 Ga0207680_10066983 Ga0207680_100669831 261
410 3300025904 Ga0207647_10048246 Ga0207647_100482462 261
411 3300025906 Ga0207699_10109795 Ga0207699_101097951 261
412 3300025907 Ga0207645_10067510 Ga0207645_100675103 261
413 3300025908 Ga0207643_10054976 Ga0207643_100549761 261
414 3300025912 Ga0207707_10153764 Ga0207707_101537642 261
415 3300025912 Ga0207707_10186855 Ga0207707_101868551 261
416 3300025915 Ga0207693_10094351 Ga0207693_100943512 261
417 3300025917 Ga0207660_10386894 Ga0207660_103868941 261
418 3300025919 Ga0207657_10119739 Ga0207657_101197391 261
419 3300025919 Ga0207657_10120308 Ga0207657_101203083 261
420 3300025920 Ga0207649_10070043 Ga0207649_100700433 261
421 3300025921 Ga0207652_10044871 Ga0207652_100448713 261
422 3300025922 Ga0207646_10139776 Ga0207646_101397761 261
423 3300025923 Ga0207681_10062538 Ga0207681_100625382 261
424 3300025925 Ga0207650_10114365 Ga0207650_101143652 261
425 3300025925 Ga0207650_10125464 Ga0207650_101254643 261
426 3300025926 Ga0207659_10121360 Ga0207659_101213601 261
427 3300025926 Ga0207659_10327330 Ga0207659_103273302 261
428 3300025928 Ga0207700_10320307 Ga0207700_103203072 261
429 3300025931 Ga0207644_10224263 Ga0207644_102242631 261
430 3300025933 Ga0207706_10058711 Ga0207706_100587111 261
431 3300025936 Ga0207670_10048992 Ga0207670_100489923 261
432 3300025937 Ga0207669_10082453 Ga0207669_100824531 261
433 3300025938 Ga0207704_10080164 Ga0207704_100801643 261
434 3300025939 Ga0207665_10082185 Ga0207665_100821852 261
435 3300025940 Ga0207691_10065165 Ga0207691_100651654 261
436 3300025940 Ga0207691_10066763 Ga0207691_100667633 261
437 3300025941 Ga0207711_10013248 Ga0207711_100132487 261
438 3300025942 Ga0207689_10137937 Ga0207689_101379372 261
439 3300025945 Ga0207679_10391000 Ga0207679_103910002 261
440 3300025949 Ga0207667_10533551 Ga0207667_105335511 261
441 3300025960 Ga0207651_10072939 Ga0207651_100729391 261
442 3300025960 Ga0207651_10118796 Ga0207651_101187961 261
443 3300025961 Ga0207712_10126213 Ga0207712_101262131 261
444 3300025961 Ga0207712_10537092 Ga0207712_105370922 261
445 3300025972 Ga0207668_10060946 Ga0207668_100609463 261
446 3300025981 Ga0207640_10150184 Ga0207640_101501842 261
447 3300025986 Ga0207658_10118769 Ga0207658_101187692 261
448 3300025986 Ga0207658_10123200 Ga0207658_101232001 261
449 3300026023 Ga0207677_10350380 Ga0207677_103503801 261
450 3300026035 Ga0207703_10136158 Ga0207703_101361582 261
451 3300026088 Ga0207641_10167151 Ga0207641_101671513 261
452 3300026088 Ga0207641_10282991 Ga0207641_102829912 261
453 3300026089 Ga0207648_10089116 Ga0207648_100891163 261
454 3300026095 Ga0207676_10131370 Ga0207676_101313704 261
455 3300026118 Ga0207675_100102917 Ga0207675_1001029173 261
456 3300026118 Ga0207675_100142026 Ga0207675_1001420262 261
457 3300027907 Ga0207428_10091740 Ga0207428_100917403 261
458 3300028379 Ga0268266_10146810 Ga0268266_101468103 261
459 3300028380 Ga0268265_10145882 Ga0268265_101458823 261
460 3300028381 Ga0268264_10159076 Ga0268264_101590762 261
461 3300028381 Ga0268264_10382729 Ga0268264_103827291 261
462 3300038443 Ga0395901_0033513 Ga0395901_0033513_2143_2931 261
463 3300039437 Ga0436365_0277082 Ga0436365_0277082_928_1737 261
464 3300039437 Ga0436365_1792257 Ga0436365_1792257_297_1097 261
465 3300039438 Ga0436360_0647305 Ga0436360_0647305_1153_1953 261
466 3300039438 Ga0436360_0678977 Ga0436360_0678977_166_966 261
467 3300039438 Ga0436360_1060473 Ga0436360_1060473_365_1165 261
468 3300039447 Ga0436361_0032161 Ga0436361_0032161_1287_2087 261
469 3300039447 Ga0436361_0474349 Ga0436361_0474349_390_1190 261
470 3300039450 Ga0436363_0188014 Ga0436363_0188014_611_1411 261
471 3300039450 Ga0436363_0299772 Ga0436363_0299772_117_917 261
472 3300039450 Ga0436363_1710797 Ga0436363_1710797_28_828 261
473 3300039453 Ga0436362_0129397 Ga0436362_0129397_503_1303 261
474 3300039453 Ga0436362_0305935 Ga0436362_0305935_466_1266 261
475 3300042439 Ga0439464_0013228 Ga0439464_0013228_1198_1998 261
476 3300044656 Ga0466969_0056378 Ga0466969_0056378_1120_1908 261
477 3300045049 Ga0466959_0105952 Ga0466959_0105952_87_875 261
478 3300046459 Ga0495629_0091385 Ga0495629_0091385_122_910 261
479 3300046463 Ga0495653_0100542 Ga0495653_0100542_107_895 261
480 3300046473 Ga0495582_0139892 Ga0495582_0139892_518_1306 261
481 3300046507 Ga0495606_0014640 Ga0495606_0014640_3548_4336 261
482 3300046516 Ga0495628_0114907 Ga0495628_0114907_1183_1971 261
483 3300046517 Ga0495630_0102276 Ga0495630_0102276_1178_1966 261
484 3300046526 Ga0495666_0141074 Ga0495666_0141074_259_1047 261
485 3300046531 Ga0495665_0053720 Ga0495665_0053720_1211_1999 261
486 3300046642 Ga0495634_0264096 Ga0495634_0264096_166_954 261
487 3300046675 Ga0495657_0165935 Ga0495657_0165935_412_1200 261
488 3300046679 Ga0495623_0021590 Ga0495623_0021590_174_962 261
489 3300046680 Ga0495646_0078971 Ga0495646_0078971_191_979 261
490 3300046684 Ga0495669_0051071 Ga0495669_0051071_188_976 261
491 3300046690 Ga0495624_0248606 Ga0495624_0248606_201_989 261
492 3300046694 Ga0495649_0043021 Ga0495649_0043021_164_952 261
493 3300046794 Ga0495589_0056431 Ga0495589_0056431_1067_1855 261
494 3300046794 Ga0495589_0082401 Ga0495589_0082401_152_940 261
495 3300047315 Ga0495581_0264711 Ga0495581_0264711_48_836 261
496 3300047317 Ga0495604_0108693 Ga0495604_0108693_146_934 261
497 3300047318 Ga0495636_0198482 Ga0495636_0198482_115_903 261
498 3300047319 Ga0495674_0126805 Ga0495674_0126805_174_962 261
499 3300047321 Ga0495676_0090641 Ga0495676_0090641_1326_2114 261
500 3300047322 Ga0495680_0107451 Ga0495680_0107451_1178_1966 261
501 3300047323 Ga0495683_0045344 Ga0495683_0045344_990_1778 261
502 3300047444 Ga0495675_0077139 Ga0495675_0077139_1208_1996 261
503 3300047446 Ga0495679_024039 Ga0495679_024039_131_919 261
504 3300047469 Ga0495673_0040942 Ga0495673_0040942_149_937 261
505 3300047472 Ga0495686_0112137 Ga0495686_0112137_743_1531 261
506 3300047673 Ga0495593_0051876 Ga0495593_0051876_202_990 261
507 3300048088 Ga0495602_0124798 Ga0495602_0124798_112_900 261
508 3300048089 Ga0495614_0036808 Ga0495614_0036808_1156_1944 261
509 3300048905 Ga0496102_0335832 Ga0496102_0335832_296_1135 261
510 3300048907 Ga0496104_0481416 Ga0496104_0481416_228_1067 261
511 3300048911 Ga0496108_0569186 Ga0496108_0569186_86_925 261
512 3300049569 Ga0501032_0195732 Ga0501032_0195732_477_1262 261
513 3300049571 Ga0501034_0180802 Ga0501034_0180802_750_1535 261
514 3300049582 Ga0501048_0266551 Ga0501048_0266551_268_1053 261
515 3300049822 Ga0501035_0323043 Ga0501035_0323043_379_1164 261
516 3300049823 Ga0501044_0185524 Ga0501044_0185524_1163_1948 261
517 3300050511 nmdc:mga08y16_45282_c1 nmdc:mga08y16_45282_c1_3076_3861 261
518 iso_pu_bacteria 2990703756 2990704508 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01695

IstB_IS21

IstB-like ATP binding protein

46

279

0.98

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

134

242

0.82

PF00308

Bac_DnaA

Bacterial DnaA ATPAse domain

101

241

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bq5-assembly3.cif.gz_C crystal structure of the istb aaa+ domain bound to adp-bef3 0.9744 71 249
5bq5-assembly3.cif.gz_C crystal structure of the istb aaa+ domain bound to adp-bef3 0.9532 71 249
5he8-assembly2.cif.gz_E bacterial initiation protein 0.8499 86 240
2w58-assembly1.cif.gz_B crystal structure of the dnai 0.8165 72 236
5he8-assembly2.cif.gz_E bacterial initiation protein 0.7984 86 240
ID Description Score Start End Superfamily
af_P96287_79_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9818 100 246 3.40.50.300
5bq5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9736 71 249 3.40.50.300
af_P96287_79_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9559 100 246 3.40.50.300
5bq5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9522 71 249 3.40.50.300
af_Q50701_63_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9225 65 245 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4Y7ZL73-F1-model_v4 deleted 0.9958 133 230
AF-A0A3A8E9I1-F1-model_v4 Replicative helicase loader DnaC (DNA replication protein DnaC) 0.9897 123 250 GO:0005524
GO:0006260
AF-A0A2P1BPA6-F1-model_v4 Transposase/IS protein 0.9895 83 253 GO:0005524
GO:0006260
GO:0016887
AF-A0A7I8YNC2-F1-model_v4 Replicative helicase loader DnaC (DNA replication protein DnaC) 0.9869 64 253 GO:0005524
GO:0006269
GO:0016887
GO:1990077
AF-A0A202DP14-F1-model_v4 ATP-binding protein 0.9864 120 249 GO:0005524
GO:0006260

Feature Viewer

pLDDT pTM Quality
86.34 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map