F458190

General Info

Members Datasets Scaffolds Average Seq Length
517 469 1034 206

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221550|2643769949
Length 239
Sequence AAQHTAPLDFWLPNLDIGRNFQTVEMMEHAMSDQAKDERAPEEIEATQAAAERTEGGVEGDYEALMRLLKENEDLKDRALRAAAEMENLRRRTARDVQDARAYAIANFARDMLQVADNLQRALDAIPAEAKASGDAGFKALIEGVDITARGMLGTLERHGVKKLEPKGEKFDPNFHQAMFEVPNPEVATGTVVEVVQPGYSIGERVLRPAMVGVSKGGSKPAASAAEPGPVNEQAEKDA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
85 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
86 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
87 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
88 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
89 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
90 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
91 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
112 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
113 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
123 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
158 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
164 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
165 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
166 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
167 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
168 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
169 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
170 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
171 2512875024
172 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
173 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
174 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
175 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
176 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
177 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
178 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
179 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
180 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
181 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
182 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
183 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
184 2643221557 Ensifer sp. Root558 Isolate Unclassified
185 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
186 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
187 2643221610 Ensifer sp. Root74 Isolate Unclassified
188 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
189 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
190 2643221651 Afipia sp. Root123D2 Isolate Unclassified
191 2643221668 Ensifer sp. Root423 Isolate Unclassified
192 2643221675 Ensifer sp. Root1298 Isolate Unclassified
193 2643221680 Ensifer sp. Root1312 Isolate Unclassified
194 2643221726 Ensifer sp. Root954 Isolate Unclassified
195 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
196 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
197 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
198 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
199 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
200 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
201 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
202 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
203 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
204 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
205 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
206 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
207 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
208 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
209 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
210 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
211 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
212 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
213 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
214 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
215 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
216 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
217 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
218 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
219 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
220 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
221 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
222 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
223 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
224 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
225 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
226 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
227 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
228 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
229 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
230 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
231 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
232 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
233 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
234 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
235 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
236 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
237 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
238 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
239 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
240 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
241 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
242 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
243 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
244 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
245 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
246 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
247 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
248 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
249 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
250 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
251 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
252 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
253 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
254 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
255 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
256 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
257 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
258 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
259 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
260 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
261 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
262 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
263 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
264 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
265 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
266 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
267 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
268 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
269 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
270 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
271 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
272 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
273 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
274 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
275 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
276 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
277 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
278 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
279 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
280 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
281 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
282 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
283 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
284 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
285 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
286 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
287 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
288 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
289 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
290 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
291 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
292 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
293 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
294 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
295 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
296 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
297 2904699407
298 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
299 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
300 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
301 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
302 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
303 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
304 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
305 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
306 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
307 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
308 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
309 2906610324
310 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
311 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
312 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
313 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
314 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
315 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
316 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
317 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
318 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
319 2922425934
320 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
321 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
322 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
323 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
324 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
325 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
326 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
327 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
328 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
329 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
330 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
331 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
332 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
333 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
334 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
335 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
336 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
337 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
338 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
339 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
340 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
341 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
342 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
343 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
344 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
345 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
346 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
347 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
348 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
349 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
350 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
351 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
352 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
353 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
354 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
355 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
356 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
357 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
358 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
359 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
360 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
361 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
362 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
363 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
364 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
365 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
366 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
367 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
368 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
369 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
370 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
371 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
372 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
373 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
374 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
375 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
376 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
377 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
378 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
379 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
380 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
381 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
382 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
383 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
384 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
385 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
386 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
387 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
388 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
389 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
390 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
391 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
392 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
393 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
394 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
395 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
396 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
397 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
398 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
399 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
400 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
401 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
402 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
403 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
404 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
405 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
406 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
407 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
408 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
409 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
410 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
411 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
412 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
413 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
414 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
415 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
416 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
417 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
418 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
419 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
420 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
421 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
422 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
423 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
424 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
425 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
426 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
427 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
428 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
429 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
430 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
431 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
432 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
433 3004167301 Mesorhizobium loti 582 Isolate Unclassified
434 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
435 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
436 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
437 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
438 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
439 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
440 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
441 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
442 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
443 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
444 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
445 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
446 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
447 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
448 641522639 Methylobacterium sp. 4-46 Isolate Nodule
449 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
450 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
451 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
452 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
453 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
454 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
455 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
456 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
457 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
458 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
459 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
460 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
461 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
462 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
463 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
464 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
465 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
466 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
467 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
468 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
469 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 40.47
Metatranscriptomes 0
Isolates 59.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.61
Nodule 48.55
Rhizoplane 2.32
Rhizosphere 30.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10011211 3300001989 Bacteria 3311
2 JGI25157J39369_1000713 3300002741 Bacteria 17898
3 JGI25165J46597_1000034 3300003214 Bacteria 292458
4 Ga0065712_10024365 3300005290 Bacteria 1194
5 Ga0070660_100065456 3300005339 Bacteria 2829
6 Ga0070689_100256881 3300005340 Bacteria 1443
7 Ga0070675_100358193 3300005354 Bacteria 1295
8 Ga0070667_100312925 3300005367 Bacteria 1416
9 Ga0070708_100230476 3300005445 Bacteria 1738
10 Ga0070663_100274378 3300005455 Bacteria 1342
11 Ga0068867_100668630 3300005459 Bacteria 913
12 Ga0070707_100081649 3300005468 Bacteria 3121
13 Ga0070698_100172470 3300005471 Bacteria 2103
14 Ga0068853_100714446 3300005539 Bacteria 956
15 Ga0070665_100098620 3300005548 Bacteria 2926
16 Ga0070665_100408579 3300005548 Bacteria 1366
17 Ga0068855_100171929 3300005563 Bacteria 2454
18 Ga0068857_100077107 3300005577 Bacteria 2973
19 Ga0068854_100068045 3300005578 Bacteria 2596
20 Ga0068854_100965026 3300005578 Bacteria 753
21 Ga0068852_100068444 3300005616 Bacteria 3107
22 Ga0068852_100652835 3300005616 Bacteria 1060
23 Ga0068860_100533943 3300005843 Bacteria 1174
24 Ga0081455_10285355 3300005937 Bacteria 1191
25 Ga0081540_1051858 3300005983 Bacteria 2025
26 Ga0070717_10063143 3300006028 Bacteria 3073
27 Ga0075365_10004434 3300006038 Bacteria 7434
28 Ga0075368_10020573 3300006042 Bacteria 2500
29 Ga0075362_10015515 3300006177 Bacteria 3100
30 Ga0075367_10017602 3300006178 Bacteria 3926
31 Ga0075367_10038215 3300006178 Bacteria 2793
32 Ga0075367_10043418 3300006178 Bacteria 2633
33 Ga0075367_10068262 3300006178 Bacteria 2132
34 Ga0075366_10101509 3300006195 Bacteria 1726
35 Ga0075370_10039390 3300006353 Bacteria 2662
36 Ga0075434_100791998 3300006871 Bacteria 964
37 Ga0105240_10280017 3300009093 Bacteria 1916
38 Ga0105240_10387672 3300009093 Bacteria 1577
39 Ga0105245_10773870 3300009098 Bacteria 997
40 Ga0105241_11369286 3300009174 Bacteria 676
41 Ga0105237_10041191 3300009545 Bacteria 4659
42 Ga0105237_10058430 3300009545 Bacteria 3860
43 Ga0105238_10017728 3300009551 Bacteria 7239
44 Ga0105238_10350709 3300009551 Bacteria 1465
45 Ga0105238_10601973 3300009551 Bacteria 1107
46 Ga0105239_10125443 3300010375 Bacteria 2853
47 Ga0105239_10359782 3300010375 Bacteria 1643
48 Ga0105246_11176464 3300011119 Bacteria 704
49 Ga0157369_10116677 3300013105 Bacteria 2834
50 Ga0157369_10221253 3300013105 Bacteria 1982
51 Ga0157374_10061085 3300013296 Bacteria 3528
52 Ga0157378_10260678 3300013297 Bacteria 1663
53 Ga0163162_10950857 3300013306 Bacteria 970
54 Ga0182008_10023524 3300014497 Bacteria 3145
55 Ga0182007_10013195 3300015262 Bacteria 3159
56 Ga0163161_10073184 3300017792 Bacteria 2511
57 Ga0209026_1000100 3300025250 Bacteria 156131
58 Ga0209148_1000069 3300025254 Bacteria 334444
59 Ga0209148_1007554 3300025254 Bacteria 2248
60 Ga0209759_1000438 3300025256 Bacteria 49192
61 Ga0209233_1000028 3300025261 Bacteria 642062
62 Ga0209455_1000135 3300025272 Bacteria 148007
63 Ga0207697_10111915 3300025315 Bacteria 1170
64 Ga0207710_10066530 3300025900 Bacteria 1644
65 Ga0207680_10209802 3300025903 Bacteria 1331
66 Ga0207647_10031319 3300025904 Bacteria 3423
67 Ga0207647_10207995 3300025904 Bacteria 1131
68 Ga0207695_10112356 3300025913 Bacteria 2702
69 Ga0207671_10310240 3300025914 Bacteria 1247
70 Ga0207657_10050891 3300025919 Bacteria 3602
71 Ga0207646_10027422 3300025922 Bacteria 5195
72 Ga0207694_10039157 3300025924 Bacteria 3647
73 Ga0207694_10079896 3300025924 Bacteria 2566
74 Ga0207694_10725478 3300025924 Bacteria 839
75 Ga0207659_10880849 3300025926 Bacteria 770
76 Ga0207687_10545916 3300025927 Bacteria 972
77 Ga0207690_10226857 3300025932 Bacteria 1432
78 Ga0207706_10181459 3300025933 Bacteria 1848
79 Ga0207669_10308043 3300025937 Bacteria 1207
80 Ga0207712_10326332 3300025961 Bacteria 1268
81 Ga0207678_10286594 3300026067 Bacteria 1414
82 Ga0207648_10275022 3300026089 Bacteria 1505
83 Ga0207674_10109326 3300026116 Bacteria 2741
84 Ga0207683_10483714 3300026121 Bacteria 1143
85 Ga0207698_10182834 3300026142 Bacteria 1859
86 Ga0209813_10018545 3300027866 Bacteria 1924
87 Ga0268266_10366051 3300028379 Bacteria 1357
88 Ga0268266_10988647 3300028379 Bacteria 814
89 Ga0307508_10036573 3300031616 Bacteria 4420
90 Ga0307516_10021423 3300031730 Bacteria 6650
91 Ga0307412_10282113 3300031911 Bacteria 1305
92 Ga0307416_100589468 3300032002 Bacteria 1190
93 Ga0307414_10283853 3300032004 Bacteria 1392
94 Ga0373927_0039153 3300035695 Bacteria 3076
95 Ga0373947_0430637 3300035725 Bacteria 892
96 Ga0395900_0253125 3300037418 Bacteria 1762
97 Ga0395900_0351658 3300037418 Bacteria 1447
98 Ga0395898_0227743 3300037466 Bacteria 1778
99 Ga0395905_0015019 3300037471 Bacteria 7381
100 Ga0395905_0531754 3300037471 Bacteria 1076
101 Ga0395905_0709839 3300037471 Bacteria 908
102 Ga0436364_0643199 3300037853 Bacteria 1162
103 Ga0395901_1157177 3300038443 Bacteria 741
104 Ga0436360_1027456 3300039438 Bacteria 1293
105 Ga0451797_0404916 3300041453 Bacteria 869
106 Ga0451847_0593506 3300041503 Bacteria 718
107 Ga0451849_0804019 3300041505 Bacteria 1166
108 Ga0439431_0115036 3300041997 Bacteria 747
109 Ga0439441_099896 3300042001 Bacteria 649
110 Ga0439458_0005561 3300042157 Bacteria 2833
111 Ga0439464_0155718 3300042439 Bacteria 716
112 Ga0466972_0021098 3300044658 Bacteria 3251
113 Ga0466966_0012060 3300044684 Bacteria 5727
114 Ga0466961_0216061 3300044693 Bacteria 1182
115 Ga0466971_0117534 3300044719 Bacteria 1230
116 Ga0466970_0141021 3300044765 Bacteria 1328
117 Ga0466960_0058696 3300044901 Bacteria 1880
118 Ga0466959_0026291 3300045049 Bacteria 4314
119 Ga0466967_0235524 3300045976 Bacteria 1745
120 Ga0466967_0320469 3300045976 Bacteria 1495
121 Ga0495603_0320155 3300046455 Bacteria 890
122 Ga0495582_0032354 3300046473 Bacteria 2876
123 Ga0495605_0212969 3300046474 Bacteria 838
124 Ga0495664_0124522 3300046477 Bacteria 1559
125 Ga0495584_0337941 3300046491 Bacteria 765
126 Ga0495606_0243586 3300046507 Bacteria 1001
127 Ga0495610_0096392 3300046512 Bacteria 1332
128 Ga0495630_0714570 3300046517 Bacteria 766
129 Ga0495637_0055602 3300046520 Bacteria 1641
130 Ga0495643_0011427 3300046522 Bacteria 5407
131 Ga0495668_0018028 3300046616 Bacteria 4086
132 Ga0495668_0191479 3300046616 Bacteria 1120
133 Ga0495677_0022059 3300047445 Bacteria 2308
134 Ga0495681_0144611 3300047470 Bacteria 1002
135 Ga0495614_0252645 3300048089 Bacteria 807
136 Ga0496102_0269958 3300048905 Bacteria 1604
137 Ga0496105_0567961 3300048908 Bacteria 884
138 Ga0496106_0513929 3300048909 Bacteria 962
139 Ga0496108_0330183 3300048911 Bacteria 1330
140 Ga0496109_0611528 3300048912 Bacteria 1026
141 Ga0496110_0146547 3300048913 Bacteria 2136
142 Ga0496112_0019648 3300048915 Bacteria 6381
143 Ga0496112_0165144 3300048915 Bacteria 2180
144 Ga0496113_0168947 3300048916 Bacteria 1732
145 Ga0496117_0296667 3300048920 Bacteria 858
146 Ga0496118_0057992 3300048921 Bacteria 2898
147 Ga0496119_0009239 3300048922 Bacteria 8496
148 Ga0496119_0260939 3300048922 Bacteria 869
149 Ga0496120_0001725 3300048923 Bacteria 24868
150 Ga0496120_0054040 3300048923 Bacteria 2279
151 Ga0496121_0077263 3300048924 Bacteria 2652
152 Ga0496124_0165698 3300048927 Bacteria 1718
153 Ga0496125_0171790 3300048928 Bacteria 1456
154 Ga0496126_0004226 3300048929 Bacteria 17298
155 Ga0496126_0320421 3300048929 Bacteria 1274
156 Ga0501032_0000018 3300049569 Bacteria 156275
157 Ga0501032_0236233 3300049569 Bacteria 1188
158 Ga0501032_0352105 3300049569 Bacteria 949
159 Ga0501033_0000032 3300049570 Bacteria 156304
160 Ga0501033_0044845 3300049570 Bacteria 3291
161 Ga0501034_0000103 3300049571 Bacteria 156304
162 Ga0501034_0001008 3300049571 Bacteria 40385
163 Ga0501034_0431273 3300049571 Bacteria 1238
164 Ga0501036_0000012 3300049572 Bacteria 156304
165 Ga0501036_0948209 3300049572 Bacteria 705
166 Ga0501037_0000018 3300049573 Bacteria 156304
167 Ga0501038_0000017 3300049574 Bacteria 156304
168 Ga0501038_0402447 3300049574 Bacteria 1059
169 Ga0501039_0000024 3300049575 Bacteria 156304
170 Ga0501039_0460404 3300049575 Bacteria 999
171 Ga0501040_0076039 3300049576 Bacteria 2321
172 Ga0501043_0000594 3300049579 Bacteria 32093
173 Ga0501043_0087337 3300049579 Bacteria 2451
174 Ga0501046_0241154 3300049580 Bacteria 1333
175 Ga0501047_0000117 3300049581 Bacteria 96579
176 Ga0501067_0130951 3300049583 Bacteria 1396
177 Ga0501067_0239426 3300049583 Bacteria 1010
178 Ga0501067_0334178 3300049583 Bacteria 844
179 Ga0501067_0392607 3300049583 Bacteria 774
180 Ga0501068_0915366 3300049584 Bacteria 577
181 Ga0501069_0123526 3300049585 Bacteria 1479
182 Ga0501070_0030348 3300049586 Bacteria 4529
183 Ga0501071_0099782 3300049587 Bacteria 2140
184 Ga0501073_0463328 3300049589 Bacteria 876
185 Ga0501035_0000040 3300049822 Bacteria 156262
186 Ga0501035_0031380 3300049822 Bacteria 4839
187 Ga0501035_0240925 3300049822 Bacteria 1538
188 Ga0501044_0000040 3300049823 Bacteria 156304
189 Ga0501045_0319851 3300049824 Bacteria 1155
190 Ga0501045_0349598 3300049824 Bacteria 1100
191 nmdc:mga03n38_252421_c1 3300050490 Bacteria 932
192 nmdc:mga00v17_124193_c1 3300050491 Bacteria 1646
193 nmdc:mga00v17_374029_c1 3300050491 Bacteria 926
194 nmdc:mga00v17_6972_c1 3300050491 Bacteria 6012
195 nmdc:mga0yw44_151400_c1 3300050492 Bacteria 1513
196 nmdc:mga0yw44_1843_c1 3300050492 Bacteria 8705
197 nmdc:mga06z11_29200_c1 3300050494 Bacteria 2654
198 nmdc:mga06z11_71140_c1 3300050494 Bacteria 1841
199 nmdc:mga04h51_20171_c1 3300050495 Bacteria 1986
200 nmdc:mga07m45_111760_c1 3300050496 Bacteria 1574
201 nmdc:mga07m45_311300_c1 3300050496 Bacteria 915
202 Ga0495612_0127913 3300053078 Bacteria 1096
203 Ga0500610_0041057 3300053079 Bacteria 2392
204 Ga0495655_0002995 3300053083 Bacteria 2738
205 Ga0500616_0088865 3300053153 Bacteria 1535
206 Ga0500620_000241 3300053155 Bacteria 10689
207 Ga0501082_0757406 3300060353 Bacteria 850
208 Ga0466962_0170927 3300061719 Bacteria 1058
209 2643769949 2643221550 Bacteria 4619371
210 2503199808 2503198000 Bacteria 6884444
211 2509114718 2508501123 Bacteria 6283661
212 2509142386 2508501127 Bacteria 7037543
213 2509369735 2509276018 Bacteria 6910194
214 2509394718 2509276022 Bacteria 6200534
215 2510318689 2510065059 Bacteria 6847884
216 2512932739 2512875016 Bacteria 6529530
217 2512960801 2512875024 Bacteria 7195110
218 2513608903 2513237090 Bacteria 7096802
219 2513658769 2513237096 Bacteria 8722461
220 2513674625 2513237098 Bacteria 9902361
221 2513860532 2513237137 Bacteria 9558895
222 2513921033 2513237145 Bacteria 8979722
223 2514585874 2513237351 Bacteria 6968952
224 2517888796 2517572143 Bacteria 9484767
225 2545678074 2545555834 Bacteria 8130841
226 2588518833 2588253730 Bacteria 6881675
227 2597810990 2597489875 Bacteria 7010078
228 2599939783 2599185301 Bacteria 6161860
229 2603858487 2602042107 Bacteria 6226103
230 2643805967 2643221557 Bacteria 7184309
231 2643840135 2643221564 Bacteria 4193379
232 2643987520 2643221595 Bacteria 6565519
233 2644066143 2643221610 Bacteria 7480339
234 2644133800 2643221623 Bacteria 5239945
235 2644157961 2643221627 Bacteria 6761570
236 2644290907 2643221651 Bacteria 4798932
237 2644377227 2643221668 Bacteria 7306521
238 2644417474 2643221675 Bacteria 7473456
239 2644450870 2643221680 Bacteria 7473610
240 2644692707 2643221726 Bacteria 7455827
241 2694628929 2693429783 Bacteria 7019804
242 2694637158 2693429784 Bacteria 7241525
243 2728754951 2728368998 Bacteria 8720350
244 2738744764 2738541281 Bacteria 5112672
245 2739353994 2738543032 Bacteria 5115625
246 2756671125 2756170246 Bacteria 7451806
247 2792748192 2791355123 Bacteria 8049106
248 2793067618 2791355197 Bacteria 8420563
249 2829750712 2829745981 Bacteria 5406054
250 2841737547 2841734538 Bacteria 6784580
251 2844008881 2844002411 Bacteria 7168230
252 2844012399 2844009547 Bacteria 6728125
253 2847674795 2847670302 Bacteria 6165597
254 2847690877 2847686936 Bacteria 6278406
255 2856317320 2856314179 Bacteria 6477897
256 2856322896 2856320880 Bacteria 7263508
257 2856334667 2856328259 Bacteria 6528202
258 2856339635 2856334872 Bacteria 7037011
259 2856343684 2856342000 Bacteria 7176905
260 2856351798 2856349417 Bacteria 6230045
261 2856366933 2856364286 Bacteria 6939991
262 2857352179 2857349434 Bacteria 7926032
263 2857372193 2857367948 Bacteria 6965560
264 2869165721 2869162929 Bacteria 6399702
265 2869235916 2869234852 Bacteria 6654993
266 2869246601 2869242130 Bacteria 6609239
267 2869256144 2869249662 Bacteria 6868783
268 2869257781 2869256925 Bacteria 6981691
269 2869264798 2869264136 Bacteria 6880765
270 2869278379 2869271264 Bacteria 6908218
271 2869282446 2869278585 Bacteria 7077053
272 2869287655 2869285874 Bacteria 6901219
273 2871435603 2871429161 Bacteria 6547891
274 2871438602 2871435913 Bacteria 6880295
275 2871449608 2871444079 Bacteria 6423508
276 2871455559 2871451962 Bacteria 7336357
277 2871466524 2871459585 Bacteria 6866887
278 2871469121 2871466892 Bacteria 6923287
279 2871475520 2871474448 Bacteria 6806570
280 2871482606 2871481445 Bacteria 6700002
281 2871493421 2871488783 Bacteria 6929816
282 2871496463 2871495908 Bacteria 6935695
283 2874106030 2874102143 Bacteria 6342645
284 2874114234 2874109183 Bacteria 6517025
285 2874119369 2874116593 Bacteria 6674494
286 2874129020 2874123672 Bacteria 7238285
287 2874134511 2874131515 Bacteria 6820270
288 2874142102 2874139085 Bacteria 7021506
289 2874151286 2874146452 Bacteria 7533118
290 2874158920 2874155637 Bacteria 6724144
291 2874163118 2874162495 Bacteria 6174670
292 2874174987 2874168670 Bacteria 8062617
293 2876365010 2876363079 Bacteria 6544991
294 2876374873 2876369609 Bacteria 6807521
295 2876391605 2876386047 Bacteria 6698674
296 2876397795 2876392853 Bacteria 6660880
297 2876402661 2876399893 Bacteria 6927900
298 2876407989 2876406927 Bacteria 6191900
299 2876417339 2876413966 Bacteria 6831344
300 2876424453 2876420981 Bacteria 6687741
301 2878038358 2878035449 Bacteria 6555736
302 2878732776 2878730984 Bacteria 6380721
303 2878744715 2878738818 Bacteria 7136951
304 2878749166 2878745973 Bacteria 6867388
305 2878757465 2878753008 Bacteria 6922523
306 2878760691 2878760144 Bacteria 6823465
307 2878767684 2878767105 Bacteria 6898628
308 2878776111 2878774303 Bacteria 6108671
309 2878786387 2878781027 Bacteria 6834456
310 2878790104 2878788777 Bacteria 6567085
311 2881149676 2881147464 Bacteria 7779814
312 2881160867 2881155292 Bacteria 6461656
313 2881166557 2881161766 Bacteria 7127907
314 2881849160 2881845957 Bacteria 6611900
315 2881858463 2881853255 Bacteria 6698367
316 2881864994 2881861095 Bacteria 7128710
317 2882913195 2882912400 Bacteria 6801539
318 2885308036 2885305155 Bacteria 7348390
319 2885313047 2885312484 Bacteria 6415165
320 2885319290 2885318864 Bacteria 6729568
321 2885333584 2885326080 Bacteria 7134805
322 2885336351 2885334103 Bacteria 7216818
323 2885353448 2885350715 Bacteria 6787678
324 2885376180 2885374607 Bacteria 8927485
325 2885385065 2885383462 Bacteria 9473874
326 2888338127 2888337043 Bacteria 6629336
327 2888345466 2888343758 Bacteria 6611049
328 2888354771 2888350351 Bacteria 7372807
329 2889016388 2889010040 Bacteria 6749192
330 2889018586 2889016732 Bacteria 6700763
331 2889308524 2889306138 Bacteria 6358934
332 2889917187 2889914905 Bacteria 5702301
333 2902410665 2902405164 Bacteria 6784948
334 2903450017 2903448605 Bacteria 7357801
335 2903498630 2903492973 Bacteria 13473544
336 2903501193 2903492973 Bacteria 13473544
337 2903515909 2903513507 Bacteria 6344008
338 2903522255 2903521522 Bacteria 6525694
339 2903528633 2903528002 Bacteria 6586099
340 2903541257 2903540706 Bacteria 7062119
341 2903749515 2903748898 Bacteria 9972761
342 2903770799 2903768456 Bacteria 9749579
343 2904664446 2904659560 Bacteria 6685615
344 2904708763
345 2906310204 2906308376 Bacteria 6841989
346 2906324269 2906321335 Bacteria 6579571
347 2906333097 2906328253 Bacteria 6585166
348 2906364868 2906363423 Bacteria 6856682
349 2906375904 2906370794 Bacteria 6881062
350 2906382272 2906378014 Bacteria 6911440
351 2906392386 2906386501 Bacteria 5977019
352 2906403442 2906401398 Bacteria 6693206
353 2906409077 2906408224 Bacteria 6162342
354 2906417383 2906414383 Bacteria 6580790
355 2906430001 2906427513 Bacteria 6375796
356 2906613824
357 2906642374 2906635258 Bacteria 8601019
358 2906667409 2906660503 Bacteria 8595048
359 2919073760 2919073203 Bacteria 6531949
360 2922135708 2922130491 Bacteria 7173936
361 2922156398 2922151315 Bacteria 6902399
362 2922159092 2922158528 Bacteria 6573167
363 2922173716 2922172374 Bacteria 6167644
364 2922182464 2922178524 Bacteria 6025201
365 2922192892 2922185730 Bacteria 7113964
366 2922434274
367 2924713525 2924710171 Bacteria 6752351
368 2924723395 2924718760 Bacteria 6331356
369 2924727628 2924726620 Bacteria 6271473
370 2924737368 2924733363 Bacteria 7574837
371 2924742985 2924741084 Bacteria 6661321
372 2924749605 2924748358 Bacteria 6154725
373 2924761884 2924754689 Bacteria 6774424
374 2924765242 2924762789 Bacteria 6561353
375 2924782746 2924776078 Bacteria 7492003
376 2924786761 2924784321 Bacteria 7416538
377 2928127668 2928125067 Bacteria 5937560
378 2935636566 2935630451 Bacteria 8169952
379 2937817028 2937813078 Bacteria 7783518
380 2937840216 2937836603 Bacteria 6811263
381 2937852223 2937848649 Bacteria 6983481
382 2937866413 2937861824 Bacteria 6660327
383 2937870078 2937868953 Bacteria 6639878
384 2937881387 2937877337 Bacteria 7246526
385 2937892007 2937891427 Bacteria 6357007
386 2937977478 2937972304 Bacteria 7532020
387 2937995113 2937994558 Bacteria 7036190
388 2938021755 2938014810 Bacteria 6700592
389 2941513201 2941507105 Bacteria 8166816
390 2941521144 2941515067 Bacteria 8166720
391 2941528919 2941523033 Bacteria 8169134
392 2958039228 2958034702 Bacteria 6989922
393 2958041951 2958041894 Bacteria 13082850
394 2958053142 2958041894 Bacteria 13082850
395 2958070433 2958064165 Bacteria 7158582
396 2958071423 2958071322 Bacteria 6815895
397 2958088056 2958084443 Bacteria 7312792
398 2958097692 2958092219 Bacteria 6861151
399 2958103707 2958100919 Bacteria 6800575
400 2958110047 2958108152 Bacteria 6681128
401 2958120973 2958115193 Bacteria 6923548
402 2958129503 2958122699 Bacteria 7280457
403 2958149724 2958144490 Bacteria 6677056
404 2958165622 2958165035 Bacteria 6906348
405 2958176370 2958172287 Bacteria 6716688
406 2958181871 2958179912 Bacteria 6874908
407 2961079715 2961077736 Bacteria 7079850
408 2961119445 2961114664 Bacteria 6680456
409 2961132523 2961127735 Bacteria 7196641
410 2961144447 2961136820 Bacteria 6775228
411 2961164081 2961163497 Bacteria 6901077
412 2961175206 2961170736 Bacteria 7072258
413 2961189423 2961183825 Bacteria 6688536
414 2963646465 2963644680 Bacteria 6530403
415 2965018853 2965018300 Bacteria 6883036
416 2965027118 2965025482 Bacteria 6532201
417 2965043212 2965040258 Bacteria 6855979
418 2965053173 2965047637 Bacteria 6623551
419 2965063042 2965062239 Bacteria 7412989
420 2965109690 2965102966 Bacteria 6800987
421 2965114644 2965110997 Bacteria 6693150
422 2965124941 2965119406 Bacteria 6956431
423 2967999792 2967996073 Bacteria 6787468
424 2968008150 2968003550 Bacteria 6929263
425 2968020554 2968016561 Bacteria 7022047
426 2968090736 2968083720 Bacteria 7351627
427 2968091250 2968091066 Bacteria 6052692
428 2968099187 2968097103 Bacteria 6107094
429 2968115700 2968110612 Bacteria 6814636
430 2968119058 2968117919 Bacteria 6536078
431 2968134549 2968128360 Bacteria 6270294
432 2968145071 2968138860 Bacteria 6605449
433 2968172484 2968171901 Bacteria 6894245
434 2970473851 2970469710 Bacteria 6969209
435 2970492797 2970489779 Bacteria 6517260
436 2970507794 2970503327 Bacteria 7099517
437 2970517687 2970510686 Bacteria 7006402
438 2970527182 2970524798 Bacteria 6840927
439 2970537182 2970532167 Bacteria 6553173
440 2970551212 2970547951 Bacteria 6931819
441 2970555544 2970554993 Bacteria 6814252
442 2970597055 2970593180 Bacteria 7073582
443 2970626392 2970619444 Bacteria 6986144
444 2970627703 2970627176 Bacteria 6680862
445 2977826624 2977821940 Bacteria 6906439
446 2977832218 2977828996 Bacteria 7007971
447 2977847319 2977843712 Bacteria 6753583
448 2977857007 2977851361 Bacteria 6694324
449 2977859053 2977858184 Bacteria 6215359
450 2977864951 2977864932 Bacteria 7534097
451 2977875199 2977872689 Bacteria 7270173
452 2977902073 2977898635 Bacteria 6675551
453 2977908646 2977907340 Bacteria 6577984
454 2977916326 2977915119 Bacteria 6829656
455 2977926526 2977922695 Bacteria 6956781
456 2977937836 2977935797 Bacteria 6252826
457 2977945136 2977942078 Bacteria 7570577
458 2977956046 2977950692 Bacteria 6893264
459 2977958549 2977957713 Bacteria 6877875
460 2977978654 2977971508 Bacteria 7472917
461 2977992292 2977986579 Bacteria 6581278
462 2979710938 2979710463 Bacteria 6785254
463 2979749539 2979742915 Bacteria 7301278
464 2979768007 2979764755 Bacteria 6610066
465 2979774460 2979772303 Bacteria 6618277
466 2979782859 2979779861 Bacteria 6219781
467 2979793639 2979793036 Bacteria 6808957
468 2979812978 2979808191 Bacteria 7179355
469 2987639363 2987636660 Bacteria 8088555
470 2987648133 2987645492 Bacteria 6117018
471 2987652281 2987652177 Bacteria 6969023
472 2987660089 2987659509 Bacteria 6966464
473 2987669643 2987666974 Bacteria 6509233
474 2987676168 2987673487 Bacteria 6884027
475 2996316590 2996310559 Bacteria 6357320
476 2996348806 2996341866 Bacteria 6643098
477 2996352828 2996348954 Bacteria 7239054
478 2996387262 2996386984 Bacteria 6978667
479 3000139433 3000135777 Bacteria 6891109
480 3003931617 3003930520 Bacteria 5667563
481 3004167446 3004167301 Bacteria 8330599
482 3004189137 3004188549 Bacteria 6952365
483 3004200129 3004195979 Bacteria 6776956
484 3004204393 3004203850 Bacteria 7307914
485 3004217864 3004211236 Bacteria 7417683
486 3004221088 3004218560 Bacteria 7421728
487 3004239323 3004232784 Bacteria 6662140
488 3004240735 3004239961 Bacteria 6892290
489 3004250553 3004248173 Bacteria 6563236
490 3004274116 3004268573 Bacteria 7043476
491 3004279510 3004275668 Bacteria 7114440
492 3004295637 3004289098 Bacteria 6135450
493 3004335963 3004334049 Bacteria 8449246
494 3005475022 3005474847 Bacteria 9259049
495 637075824 637000159 Bacteria 7596297
496 641642411 641522639 Bacteria 7737025
497 649871603 649633066 Bacteria 6690028
498 8004306409 8004300914 Bacteria 6132239
499 8004317248 8004312739 Bacteria 7444653
500 8004362321 8004361976 Bacteria 6858373
501 8004379040 8004374579 Bacteria 6898112
502 8004389440 8004387939 Bacteria 7049250
503 8004451182 8004445564 Bacteria 6322258
504 8004634508 8004633249 Bacteria 6723080
505 8004643360 8004640170 Bacteria 6723001
506 8004695570 8004695233 Bacteria 6731676
507 8004712275 8004703790 Bacteria 8006957
508 8004717838 8004714634 Bacteria 6776161
509 8004729833 8004727605 Bacteria 6643904
510 8005662671 8005658619 Bacteria 4500593
511 8006936301 8006933436 Bacteria 10410654
512 8006976270 8006973647 Bacteria 10679141
513 8019562367 8019555841 Bacteria 9642137
514 8019572438 8019565922 Bacteria 9639779
515 8055619262 8055617313 Bacteria 7548464
516 8056687431 8056681323 Bacteria 8472857
517 8056693359 8056689827 Bacteria 6712655
518 JGI24739J22299_10011211
519 JGI25157J39369_1000713
520 JGI25165J46597_1000034
521 Ga0065712_10024365
522 Ga0070660_100065456
523 Ga0070689_100256881
524 Ga0070675_100358193
525 Ga0070667_100312925
526 Ga0070708_100230476
527 Ga0070663_100274378
528 Ga0068867_100668630
529 Ga0070707_100081649
530 Ga0070698_100172470
531 Ga0068853_100714446
532 Ga0070665_100098620
533 Ga0070665_100408579
534 Ga0068855_100171929
535 Ga0068857_100077107
536 Ga0068854_100068045
537 Ga0068854_100965026
538 Ga0068852_100068444
539 Ga0068852_100652835
540 Ga0068860_100533943
541 Ga0081455_10285355
542 Ga0081540_1051858
543 Ga0070717_10063143
544 Ga0075365_10004434
545 Ga0075368_10020573
546 Ga0075362_10015515
547 Ga0075367_10017602
548 Ga0075367_10038215
549 Ga0075367_10043418
550 Ga0075367_10068262
551 Ga0075366_10101509
552 Ga0075370_10039390
553 Ga0075434_100791998
554 Ga0105240_10280017
555 Ga0105240_10387672
556 Ga0105245_10773870
557 Ga0105241_11369286
558 Ga0105237_10041191
559 Ga0105237_10058430
560 Ga0105238_10017728
561 Ga0105238_10350709
562 Ga0105238_10601973
563 Ga0105239_10125443
564 Ga0105239_10359782
565 Ga0105246_11176464
566 Ga0157369_10116677
567 Ga0157369_10221253
568 Ga0157374_10061085
569 Ga0157378_10260678
570 Ga0163162_10950857
571 Ga0182008_10023524
572 Ga0182007_10013195
573 Ga0163161_10073184
574 Ga0209026_1000100
575 Ga0209148_1000069
576 Ga0209148_1007554
577 Ga0209759_1000438
578 Ga0209233_1000028
579 Ga0209455_1000135
580 Ga0207697_10111915
581 Ga0207710_10066530
582 Ga0207680_10209802
583 Ga0207647_10031319
584 Ga0207647_10207995
585 Ga0207695_10112356
586 Ga0207671_10310240
587 Ga0207657_10050891
588 Ga0207646_10027422
589 Ga0207694_10039157
590 Ga0207694_10079896
591 Ga0207694_10725478
592 Ga0207659_10880849
593 Ga0207687_10545916
594 Ga0207690_10226857
595 Ga0207706_10181459
596 Ga0207669_10308043
597 Ga0207712_10326332
598 Ga0207678_10286594
599 Ga0207648_10275022
600 Ga0207674_10109326
601 Ga0207683_10483714
602 Ga0207698_10182834
603 Ga0209813_10018545
604 Ga0268266_10366051
605 Ga0268266_10988647
606 Ga0307508_10036573
607 Ga0307516_10021423
608 Ga0307412_10282113
609 Ga0307416_100589468
610 Ga0307414_10283853
611 Ga0373927_0039153
612 Ga0373947_0430637
613 Ga0395900_0253125
614 Ga0395900_0351658
615 Ga0395898_0227743
616 Ga0395905_0015019
617 Ga0395905_0531754
618 Ga0395905_0709839
619 Ga0436364_0643199
620 Ga0395901_1157177
621 Ga0436360_1027456
622 Ga0451797_0404916
623 Ga0451847_0593506
624 Ga0451849_0804019
625 Ga0439431_0115036
626 Ga0439441_099896
627 Ga0439458_0005561
628 Ga0439464_0155718
629 Ga0466972_0021098
630 Ga0466966_0012060
631 Ga0466961_0216061
632 Ga0466971_0117534
633 Ga0466970_0141021
634 Ga0466960_0058696
635 Ga0466959_0026291
636 Ga0466967_0235524
637 Ga0466967_0320469
638 Ga0495603_0320155
639 Ga0495582_0032354
640 Ga0495605_0212969
641 Ga0495664_0124522
642 Ga0495584_0337941
643 Ga0495606_0243586
644 Ga0495610_0096392
645 Ga0495630_0714570
646 Ga0495637_0055602
647 Ga0495643_0011427
648 Ga0495668_0018028
649 Ga0495668_0191479
650 Ga0495677_0022059
651 Ga0495681_0144611
652 Ga0495614_0252645
653 Ga0496102_0269958
654 Ga0496105_0567961
655 Ga0496106_0513929
656 Ga0496108_0330183
657 Ga0496109_0611528
658 Ga0496110_0146547
659 Ga0496112_0019648
660 Ga0496112_0165144
661 Ga0496113_0168947
662 Ga0496117_0296667
663 Ga0496118_0057992
664 Ga0496119_0009239
665 Ga0496119_0260939
666 Ga0496120_0001725
667 Ga0496120_0054040
668 Ga0496121_0077263
669 Ga0496124_0165698
670 Ga0496125_0171790
671 Ga0496126_0004226
672 Ga0496126_0320421
673 Ga0501032_0000018
674 Ga0501032_0236233
675 Ga0501032_0352105
676 Ga0501033_0000032
677 Ga0501033_0044845
678 Ga0501034_0000103
679 Ga0501034_0001008
680 Ga0501034_0431273
681 Ga0501036_0000012
682 Ga0501036_0948209
683 Ga0501037_0000018
684 Ga0501038_0000017
685 Ga0501038_0402447
686 Ga0501039_0000024
687 Ga0501039_0460404
688 Ga0501040_0076039
689 Ga0501043_0000594
690 Ga0501043_0087337
691 Ga0501046_0241154
692 Ga0501047_0000117
693 Ga0501067_0130951
694 Ga0501067_0239426
695 Ga0501067_0334178
696 Ga0501067_0392607
697 Ga0501068_0915366
698 Ga0501069_0123526
699 Ga0501070_0030348
700 Ga0501071_0099782
701 Ga0501073_0463328
702 Ga0501035_0000040
703 Ga0501035_0031380
704 Ga0501035_0240925
705 Ga0501044_0000040
706 Ga0501045_0319851
707 Ga0501045_0349598
708 nmdc:mga03n38_252421_c1
709 nmdc:mga00v17_124193_c1
710 nmdc:mga00v17_374029_c1
711 nmdc:mga00v17_6972_c1
712 nmdc:mga0yw44_151400_c1
713 nmdc:mga0yw44_1843_c1
714 nmdc:mga06z11_29200_c1
715 nmdc:mga06z11_71140_c1
716 nmdc:mga04h51_20171_c1
717 nmdc:mga07m45_111760_c1
718 nmdc:mga07m45_311300_c1
719 Ga0495612_0127913
720 Ga0500610_0041057
721 Ga0495655_0002995
722 Ga0500616_0088865
723 Ga0500620_000241
724 Ga0501082_0757406
725 Ga0466962_0170927
726 2643769949
727 2503199808
728 2509114718
729 2509142386
730 2509369735
731 2509394718
732 2510318689
733 2512932739
734 2512960801
735 2513608903
736 2513658769
737 2513674625
738 2513860532
739 2513921033
740 2514585874
741 2517888796
742 2545678074
743 2588518833
744 2597810990
745 2599939783
746 2603858487
747 2643805967
748 2643840135
749 2643987520
750 2644066143
751 2644133800
752 2644157961
753 2644290907
754 2644377227
755 2644417474
756 2644450870
757 2644692707
758 2694628929
759 2694637158
760 2728754951
761 2738744764
762 2739353994
763 2756671125
764 2792748192
765 2793067618
766 2829750712
767 2841737547
768 2844008881
769 2844012399
770 2847674795
771 2847690877
772 2856317320
773 2856322896
774 2856334667
775 2856339635
776 2856343684
777 2856351798
778 2856366933
779 2857352179
780 2857372193
781 2869165721
782 2869235916
783 2869246601
784 2869256144
785 2869257781
786 2869264798
787 2869278379
788 2869282446
789 2869287655
790 2871435603
791 2871438602
792 2871449608
793 2871455559
794 2871466524
795 2871469121
796 2871475520
797 2871482606
798 2871493421
799 2871496463
800 2874106030
801 2874114234
802 2874119369
803 2874129020
804 2874134511
805 2874142102
806 2874151286
807 2874158920
808 2874163118
809 2874174987
810 2876365010
811 2876374873
812 2876391605
813 2876397795
814 2876402661
815 2876407989
816 2876417339
817 2876424453
818 2878038358
819 2878732776
820 2878744715
821 2878749166
822 2878757465
823 2878760691
824 2878767684
825 2878776111
826 2878786387
827 2878790104
828 2881149676
829 2881160867
830 2881166557
831 2881849160
832 2881858463
833 2881864994
834 2882913195
835 2885308036
836 2885313047
837 2885319290
838 2885333584
839 2885336351
840 2885353448
841 2885376180
842 2885385065
843 2888338127
844 2888345466
845 2888354771
846 2889016388
847 2889018586
848 2889308524
849 2889917187
850 2902410665
851 2903450017
852 2903498630
853 2903501193
854 2903515909
855 2903522255
856 2903528633
857 2903541257
858 2903749515
859 2903770799
860 2904664446
861 2904708763
862 2906310204
863 2906324269
864 2906333097
865 2906364868
866 2906375904
867 2906382272
868 2906392386
869 2906403442
870 2906409077
871 2906417383
872 2906430001
873 2906613824
874 2906642374
875 2906667409
876 2919073760
877 2922135708
878 2922156398
879 2922159092
880 2922173716
881 2922182464
882 2922192892
883 2922434274
884 2924713525
885 2924723395
886 2924727628
887 2924737368
888 2924742985
889 2924749605
890 2924761884
891 2924765242
892 2924782746
893 2924786761
894 2928127668
895 2935636566
896 2937817028
897 2937840216
898 2937852223
899 2937866413
900 2937870078
901 2937881387
902 2937892007
903 2937977478
904 2937995113
905 2938021755
906 2941513201
907 2941521144
908 2941528919
909 2958039228
910 2958041951
911 2958053142
912 2958070433
913 2958071423
914 2958088056
915 2958097692
916 2958103707
917 2958110047
918 2958120973
919 2958129503
920 2958149724
921 2958165622
922 2958176370
923 2958181871
924 2961079715
925 2961119445
926 2961132523
927 2961144447
928 2961164081
929 2961175206
930 2961189423
931 2963646465
932 2965018853
933 2965027118
934 2965043212
935 2965053173
936 2965063042
937 2965109690
938 2965114644
939 2965124941
940 2967999792
941 2968008150
942 2968020554
943 2968090736
944 2968091250
945 2968099187
946 2968115700
947 2968119058
948 2968134549
949 2968145071
950 2968172484
951 2970473851
952 2970492797
953 2970507794
954 2970517687
955 2970527182
956 2970537182
957 2970551212
958 2970555544
959 2970597055
960 2970626392
961 2970627703
962 2977826624
963 2977832218
964 2977847319
965 2977857007
966 2977859053
967 2977864951
968 2977875199
969 2977902073
970 2977908646
971 2977916326
972 2977926526
973 2977937836
974 2977945136
975 2977956046
976 2977958549
977 2977978654
978 2977992292
979 2979710938
980 2979749539
981 2979768007
982 2979774460
983 2979782859
984 2979793639
985 2979812978
986 2987639363
987 2987648133
988 2987652281
989 2987660089
990 2987669643
991 2987676168
992 2996316590
993 2996348806
994 2996352828
995 2996387262
996 3000139433
997 3003931617
998 3004167446
999 3004189137
1000 3004200129
1001 3004204393
1002 3004217864
1003 3004221088
1004 3004239323
1005 3004240735
1006 3004250553
1007 3004274116
1008 3004279510
1009 3004295637
1010 3004335963
1011 3005475022
1012 637075824
1013 641642411
1014 649871603
1015 8004306409
1016 8004317248
1017 8004362321
1018 8004379040
1019 8004389440
1020 8004451182
1021 8004634508
1022 8004643360
1023 8004695570
1024 8004712275
1025 8004717838
1026 8004729833
1027 8005662671
1028 8006936301
1029 8006976270
1030 8019562367
1031 8019572438
1032 8055619262
1033 8056687431
1034 8056693359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01025

GrpE

GrpE

25

216

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dkg-assembly1.cif.gz_A crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak 0.7995 28 163
4l0r-assembly1.cif.gz_B crystal structure of fgf2-interacting protein from homo sapiens. northeast structural genomics consortium target hr9027a. 0.7391 42 104
6tms-assembly1.cif.gz_G crystal structure of a de novo designed hexameric helical-bundle protein 0.7264 42 102
1dkg-assembly1.cif.gz_B crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak 0.7262 28 162
1k4t-assembly1.cif.gz_A human dna topoisomerase i (70 kda) in complex with the poison topotecan and covalent complex with a 22 base pair dna duplex 0.7031 53 103
ID Description Score Start End Superfamily
af_Q99LP6_159_215_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9802 106 162 2.30.22.10
af_Q2FXZ1_152_207_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9753 106 160 2.30.22.10
af_A0A0P0VLJ4_201_256_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9735 106 160 2.30.22.10
af_Q99LP6_159_215_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9636 106 162 2.30.22.10
af_P09372_138_194_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9521 106 162 2.30.22.10
ID Description Score Start End GO Terms
AF-A0A2I0Q764-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.8797 28 163 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A6I1J9N1-F1-model_v4 Protein GrpE 0.8754 52 177 GO:0000774
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A6I1J9N1-F1-model_v4 Protein GrpE 0.8627 52 177 GO:0000774
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A170WFH3-F1-model_v4 GrpE protein homolog 0.8604 46 163 GO:0000774
GO:0001405
GO:0006457
GO:0030150
GO:0042803
GO:0051082
GO:0051087
AF-A0A4W2HRV1-F1-model_v4 GrpE protein homolog 0.8575 50 164 GO:0000774
GO:0001405
GO:0006457
GO:0030150
GO:0042803
GO:0051082
GO:0051087

Map