F458144

General Info

Members Datasets Scaffolds Average Seq Length
517 354 1034 148

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100623746|Ga0207675_1006237461
Length 179
Sequence MLHDETNFGSGTLLWPAGSGGAEKRSIMKYLHTMLRVRNLDAALHFYVDLLGMKEARRRVDEKNKYTLVFLYAPEDEELAKTSMEKTGRDQPMLELTYNWDTEDYGEARYFGHLAYEVDDIYATCEKLMKGGVTINRPPRDGNMAFVRSPDKQSVELLQKGKPLPPKEPWSSMPNTGNW

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
139 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
140 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
186 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
187 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
188 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
189 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
190 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
193 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
194 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
195 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
271 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
272 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
273 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
277 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
278 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
282 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
286 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
287 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
295 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
296 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
297 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
298 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
301 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
302 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
303 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
304 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
305 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
306 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
309 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
310 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
311 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
312 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
313 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
314 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
315 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
316 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
317 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
321 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
322 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
323 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
324 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
325 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
326 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
327 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
328 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
329 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
330 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
331 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
332 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
333 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
334 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
335 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
336 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
337 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
338 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
339 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
340 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
341 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
342 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
343 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
344 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
345 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
346 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
347 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
348 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
349 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
350 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
351 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
352 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
353 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
354 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.42
Metatranscriptomes 0
Isolates 6.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.79
Nodule 5.42
Rhizoplane 7.16
Rhizosphere 64.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100623746 3300026118 Bacteria 1083
2 JGI24740J21852_10019997 3300001979 Bacteria 2347
3 JGI24738J21930_10131175 3300002075 Bacteria 549
4 JGI25406J46586_10011795 3300003203 Bacteria 3815
5 JGI25406J46586_10087556 3300003203 Bacteria 944
6 JGI25165J46597_1019199 3300003214 Bacteria 902
7 JGI25153J46596_10000718 3300003215 Bacteria 20278
8 JGI25153J46596_10009468 3300003215 Bacteria 4522
9 JGI25160J50197_1011122 3300003354 Bacteria 3210
10 Ga0055531_10003539 3300003794 Bacteria 9921
11 Ga0055531_10025224 3300003794 Bacteria 2167
12 Ga0055531_10092342 3300003794 Bacteria 639
13 Ga0055543_1009263 3300004625 Bacteria 2126
14 Ga0065715_10018407 3300005293 Bacteria 1786
15 Ga0070658_10174003 3300005327 Bacteria 1809
16 Ga0070683_100648610 3300005329 Bacteria 1011
17 Ga0070690_100032441 3300005330 Bacteria 3263
18 Ga0070670_100608115 3300005331 Bacteria 979
19 Ga0070680_100103450 3300005336 Bacteria 2366
20 Ga0070682_100008759 3300005337 Bacteria 5710
21 Ga0070682_100240007 3300005337 Bacteria 1300
22 Ga0070682_100418681 3300005337 Bacteria 1018
23 Ga0070660_100769593 3300005339 Bacteria 809
24 Ga0070689_100026322 3300005340 Bacteria 4379
25 Ga0070689_100099886 3300005340 Bacteria 2296
26 Ga0070689_100215656 3300005340 Bacteria 1573
27 Ga0070691_10553163 3300005341 Bacteria 673
28 Ga0070671_100553982 3300005355 Bacteria 992
29 Ga0070688_100104070 3300005365 Bacteria 1876
30 Ga0070688_100315137 3300005365 Bacteria 1135
31 Ga0070659_100019409 3300005366 Bacteria 5152
32 Ga0070659_100519222 3300005366 Bacteria 1017
33 Ga0070709_10004133 3300005434 Bacteria 7830
34 Ga0070714_100095255 3300005435 Bacteria 2614
35 Ga0070714_100129969 3300005435 Bacteria 2250
36 Ga0070713_100003460 3300005436 Bacteria 10424
37 Ga0070713_100015098 3300005436 Bacteria 5757
38 Ga0070713_101084900 3300005436 Bacteria 774
39 Ga0070713_101597119 3300005436 Bacteria 633
40 Ga0070710_10001250 3300005437 Bacteria 12062
41 Ga0070701_10125710 3300005438 Bacteria 1451
42 Ga0070711_100049132 3300005439 Bacteria 2888
43 Ga0070711_101007624 3300005439 Bacteria 715
44 Ga0070705_100488482 3300005440 Bacteria 932
45 Ga0070708_101152536 3300005445 Bacteria 726
46 Ga0070663_100172238 3300005455 Bacteria 1674
47 Ga0070663_100681442 3300005455 Bacteria 872
48 Ga0070663_101735473 3300005455 Bacteria 559
49 Ga0070678_100508865 3300005456 Bacteria 1063
50 Ga0070662_100950349 3300005457 Bacteria 735
51 Ga0070679_100004000 3300005530 Bacteria 13581
52 Ga0070679_101318723 3300005530 Bacteria 668
53 Ga0070679_101716079 3300005530 Bacteria 576
54 Ga0068853_100217962 3300005539 Bacteria 1742
55 Ga0068853_100453360 3300005539 Bacteria 1206
56 Ga0068853_100970497 3300005539 Bacteria 817
57 Ga0070695_100641071 3300005545 Bacteria 838
58 Ga0070695_101356429 3300005545 Bacteria 589
59 Ga0070664_100235823 3300005564 Bacteria 1641
60 Ga0068857_100105075 3300005577 Bacteria 2535
61 Ga0068857_100326032 3300005577 Bacteria 1419
62 Ga0068854_100675905 3300005578 Bacteria 889
63 Ga0068856_100371925 3300005614 Bacteria 1448
64 Ga0070702_100216667 3300005615 Bacteria 1278
65 Ga0068859_100063594 3300005617 Bacteria 3721
66 Ga0068859_101352422 3300005617 Bacteria 785
67 Ga0068864_100136607 3300005618 Bacteria 2208
68 Ga0068861_100559330 3300005719 Bacteria 1044
69 Ga0068861_101468868 3300005719 Bacteria 668
70 Ga0068870_10057755 3300005840 Bacteria 2075
71 Ga0068863_100284827 3300005841 Bacteria 1601
72 Ga0068863_100738767 3300005841 Bacteria 979
73 Ga0068858_100156989 3300005842 Bacteria 2141
74 Ga0068860_100189015 3300005843 Bacteria 1993
75 Ga0068862_100996107 3300005844 Bacteria 829
76 Ga0068862_101064110 3300005844 Bacteria 803
77 Ga0081455_10545355 3300005937 Bacteria 768
78 Ga0081538_10022185 3300005981 Bacteria 4608
79 Ga0081539_10005791 3300005985 Bacteria 12309
80 Ga0081539_10147097 3300005985 Bacteria 1138
81 Ga0081539_10357834 3300005985 Bacteria 612
82 Ga0070717_10054006 3300006028 Bacteria 3312
83 Ga0070717_10141422 3300006028 Bacteria 2076
84 Ga0070717_10770584 3300006028 Bacteria 875
85 Ga0075365_10080265 3300006038 Bacteria 2209
86 Ga0075365_10186296 3300006038 Bacteria 1452
87 Ga0075368_10022875 3300006042 Bacteria 2382
88 Ga0075368_10030376 3300006042 Bacteria 2093
89 Ga0075368_10064062 3300006042 Bacteria 1475
90 Ga0075363_100043213 3300006048 Bacteria 2383
91 Ga0075364_10150494 3300006051 Bacteria 1568
92 Ga0070715_10018905 3300006163 Bacteria 2633
93 Ga0070715_10170374 3300006163 Bacteria 1084
94 Ga0070716_100089975 3300006173 Bacteria 1855
95 Ga0070716_100958793 3300006173 Bacteria 674
96 Ga0070712_100017413 3300006175 Bacteria 4652
97 Ga0070712_100225299 3300006175 Bacteria 1486
98 Ga0070712_100303268 3300006175 Bacteria 1293
99 Ga0070712_100850536 3300006175 Bacteria 785
100 Ga0075362_10247156 3300006177 Bacteria 877
101 Ga0075362_10285555 3300006177 Bacteria 817
102 Ga0075367_10002646 3300006178 Bacteria 8243
103 Ga0075367_10511643 3300006178 Bacteria 762
104 Ga0075369_10153482 3300006186 Bacteria 1053
105 Ga0075369_10280235 3300006186 Bacteria 776
106 Ga0075369_10578893 3300006186 Bacteria 537
107 Ga0075366_10012578 3300006195 Bacteria 4803
108 Ga0075366_10407307 3300006195 Bacteria 837
109 Ga0097621_100408494 3300006237 Bacteria 1217
110 Ga0075370_10007461 3300006353 Bacteria 5572
111 Ga0075370_10012127 3300006353 Bacteria 4548
112 Ga0075370_10146047 3300006353 Bacteria 1384
113 Ga0075370_10258050 3300006353 Bacteria 1033
114 Ga0075428_100201183 3300006844 Bacteria 2153
115 Ga0068865_101564005 3300006881 Bacteria 592
116 Ga0097620_100063593 3300006931 Bacteria 3721
117 Ga0097620_101352997 3300006931 Bacteria 785
118 Ga0099823_1028000 3300006944 Bacteria 4873
119 Ga0075435_100309669 3300007076 Bacteria 1351
120 Ga0105251_10199855 3300009011 Bacteria 901
121 Ga0105240_10129517 3300009093 Bacteria 3028
122 Ga0105245_10512223 3300009098 Bacteria 1217
123 Ga0105247_10933801 3300009101 Bacteria 672
124 Ga0105241_10803341 3300009174 Bacteria 867
125 Ga0105241_10808579 3300009174 Bacteria 864
126 Ga0105241_11161868 3300009174 Bacteria 729
127 Ga0105242_10794396 3300009176 Bacteria 936
128 Ga0105242_10954139 3300009176 Bacteria 862
129 Ga0105248_11156827 3300009177 Bacteria 875
130 Ga0105237_11148867 3300009545 Bacteria 783
131 Ga0105238_10033343 3300009551 Bacteria 5242
132 Ga0105238_10542691 3300009551 Bacteria 1167
133 Ga0105238_10866384 3300009551 Bacteria 921
134 Ga0105246_10109030 3300011119 Bacteria 2030
135 Ga0157344_1026178 3300012476 Bacteria 534
136 Ga0157374_10566894 3300013296 Bacteria 1144
137 Ga0157374_10719131 3300013296 Bacteria 1012
138 Ga0157378_10145094 3300013297 Bacteria 2207
139 Ga0157378_11844222 3300013297 Bacteria 653
140 Ga0163162_10010128 3300013306 Bacteria 9162
141 Ga0163162_11403126 3300013306 Bacteria 795
142 Ga0163163_10024410 3300014325 Bacteria 5754
143 Ga0163163_12112547 3300014325 Bacteria 623
144 Ga0157377_11143490 3300014745 Bacteria 599
145 Ga0157379_10054517 3300014968 Bacteria 3572
146 Ga0157379_11701357 3300014968 Bacteria 618
147 Ga0157376_10516899 3300014969 Bacteria 1176
148 Ga0213876_10044305 3300021384 Bacteria 2352
149 Ga0207425_1003639 3300025245 Bacteria 4858
150 Ga0209148_1000368 3300025254 Bacteria 55650
151 Ga0209233_1022472 3300025261 Bacteria 1613
152 Ga0209455_1001974 3300025272 Bacteria 8431
153 Ga0209564_1002366 3300025295 Bacteria 15161
154 Ga0209758_1000021 3300025297 Bacteria 697691
155 Ga0209758_1000539 3300025297 Bacteria 60130
156 Ga0209758_1000612 3300025297 Bacteria 55194
157 Ga0209256_1091977 3300025299 Bacteria 643
158 Ga0207426_1000830 3300025302 Bacteria 32990
159 Ga0207426_1039103 3300025302 Bacteria 1489
160 Ga0209051_1025667 3300025303 Bacteria 2391
161 Ga0209257_1000527 3300025304 Bacteria 66423
162 Ga0209257_1008762 3300025304 Bacteria 5626
163 Ga0207692_10037071 3300025898 Bacteria 2382
164 Ga0207710_10227746 3300025900 Bacteria 927
165 Ga0207710_10336864 3300025900 Bacteria 767
166 Ga0207647_10001414 3300025904 Bacteria 18436
167 Ga0207685_10067666 3300025905 Bacteria 1437
168 Ga0207699_10052671 3300025906 Bacteria 2410
169 Ga0207645_10287481 3300025907 Bacteria 1093
170 Ga0207643_10039100 3300025908 Bacteria 2668
171 Ga0207705_10109678 3300025909 Bacteria 2038
172 Ga0207671_10262547 3300025914 Bacteria 1359
173 Ga0207671_10736266 3300025914 Bacteria 783
174 Ga0207693_10015050 3300025915 Bacteria 6210
175 Ga0207693_10603172 3300025915 Bacteria 855
176 Ga0207693_10657845 3300025915 Bacteria 813
177 Ga0207663_10001270 3300025916 Bacteria 11696
178 Ga0207663_10832677 3300025916 Bacteria 736
179 Ga0207660_10890772 3300025917 Bacteria 726
180 Ga0207657_10227038 3300025919 Bacteria 1494
181 Ga0207681_10958349 3300025923 Bacteria 717
182 Ga0207694_10109820 3300025924 Bacteria 2193
183 Ga0207659_10529965 3300025926 Bacteria 999
184 Ga0207687_10047499 3300025927 Bacteria 2976
185 Ga0207687_10698506 3300025927 Bacteria 861
186 Ga0207700_10093160 3300025928 Bacteria 2383
187 Ga0207700_10680569 3300025928 Bacteria 918
188 Ga0207664_10159107 3300025929 Bacteria 1925
189 Ga0207664_10289993 3300025929 Bacteria 1438
190 Ga0207644_10181730 3300025931 Bacteria 1649
191 Ga0207644_10527083 3300025931 Bacteria 976
192 Ga0207644_10894985 3300025931 Bacteria 744
193 Ga0207690_10690165 3300025932 Bacteria 839
194 Ga0207670_10190720 3300025936 Bacteria 1551
195 Ga0207670_10333781 3300025936 Bacteria 1196
196 Ga0207665_10000474 3300025939 Bacteria 27245
197 Ga0207711_10903707 3300025941 Bacteria 821
198 Ga0207711_11766555 3300025941 Bacteria 562
199 Ga0207689_10072777 3300025942 Bacteria 2823
200 Ga0207689_10661173 3300025942 Bacteria 880
201 Ga0207679_10239575 3300025945 Bacteria 1536
202 Ga0207667_11461213 3300025949 Bacteria 656
203 Ga0207712_10000818 3300025961 Bacteria 22904
204 Ga0207712_10316503 3300025961 Bacteria 1286
205 Ga0207658_10353801 3300025986 Bacteria 1280
206 Ga0207703_10476357 3300026035 Bacteria 1169
207 Ga0207703_11189824 3300026035 Bacteria 733
208 Ga0207703_11560262 3300026035 Bacteria 635
209 Ga0207639_10012068 3300026041 Bacteria 6009
210 Ga0207639_10443084 3300026041 Bacteria 1178
211 Ga0207708_10358996 3300026075 Bacteria 1197
212 Ga0207702_10104767 3300026078 Bacteria 2504
213 Ga0207702_10387558 3300026078 Bacteria 1345
214 Ga0207702_10480507 3300026078 Bacteria 1209
215 Ga0207702_12024134 3300026078 Bacteria 566
216 Ga0207641_10323896 3300026088 Bacteria 1462
217 Ga0207676_10580511 3300026095 Bacteria 1074
218 Ga0207674_10104305 3300026116 Bacteria 2814
219 Ga0207674_10217066 3300026116 Bacteria 1861
220 Ga0207675_101793904 3300026118 Bacteria 633
221 Ga0207683_10327946 3300026121 Bacteria 1403
222 Ga0209389_1016428 3300027296 Bacteria 6705
223 Ga0209489_111950 3300027361 Bacteria 8390
224 Ga0209700_100036 3300027363 Bacteria 187888
225 Ga0209813_10111291 3300027866 Bacteria 944
226 Ga0209813_10156501 3300027866 Bacteria 820
227 Ga0268264_10428703 3300028381 Bacteria 1277
228 Ga0268264_11510124 3300028381 Bacteria 682
229 Ga0268264_11581775 3300028381 Bacteria 666
230 Ga0265319_1014098 3300028563 Bacteria 3147
231 Ga0265334_10038908 3300028573 Bacteria 1868
232 Ga0265318_10000083 3300028577 Bacteria 85655
233 Ga0265330_10000253 3300031235 Bacteria 39943
234 Ga0265332_10000266 3300031238 Bacteria 41582
235 Ga0265328_10000149 3300031239 Bacteria 33084
236 Ga0265320_10001440 3300031240 Bacteria 17329
237 Ga0265325_10026687 3300031241 Bacteria 3126
238 Ga0265325_10066407 3300031241 Bacteria 1819
239 Ga0265329_10000038 3300031242 Bacteria 54238
240 Ga0265329_10101106 3300031242 Bacteria 918
241 Ga0265340_10021446 3300031247 Bacteria 3313
242 Ga0265340_10074240 3300031247 Bacteria 1608
243 Ga0265339_10092733 3300031249 Bacteria 1581
244 Ga0265331_10000223 3300031250 Bacteria 68370
245 Ga0265316_10000647 3300031344 Bacteria 38748
246 Ga0265316_10193992 3300031344 Bacteria 1508
247 Ga0265316_10424324 3300031344 Bacteria 956
248 Ga0307408_100128389 3300031548 Bacteria 1975
249 Ga0307508_10047104 3300031616 Bacteria 3847
250 Ga0265314_10000725 3300031711 Bacteria 39871
251 Ga0265342_10000576 3300031712 Bacteria 38722
252 Ga0265342_10011652 3300031712 Bacteria 6000
253 Ga0307413_10211638 3300031824 Bacteria 1408
254 Ga0307410_10097291 3300031852 Bacteria 2102
255 Ga0307406_10144262 3300031901 Bacteria 1690
256 Ga0307407_10092376 3300031903 Bacteria 1858
257 Ga0307412_10040967 3300031911 Bacteria 2999
258 Ga0307412_10957128 3300031911 Bacteria 754
259 Ga0307416_100329698 3300032002 Bacteria 1533
260 Ga0307414_10396419 3300032004 Bacteria 1197
261 Ga0307414_11300389 3300032004 Bacteria 675
262 Ga0307411_11020775 3300032005 Bacteria 741
263 Ga0307415_101070971 3300032126 Bacteria 753
264 Ga0373945_0192154 3300035116 Bacteria 844
265 Ga0373946_0081954 3300035171 Bacteria 1414
266 Ga0373931_0293955 3300035691 Bacteria 1001
267 Ga0373935_0055517 3300035692 Bacteria 2524
268 Ga0373927_0080934 3300035695 Bacteria 2105
269 Ga0373947_0023945 3300035725 Bacteria 3555
270 Ga0373925_0081481 3300037068 Bacteria 2461
271 Ga0373925_1045544 3300037068 Bacteria 672
272 Ga0373925_1277088 3300037068 Bacteria 603
273 Ga0395899_0229632 3300037312 Bacteria 1282
274 Ga0395900_0003313 3300037418 Bacteria 17419
275 Ga0395900_0579869 3300037418 Bacteria 1064
276 Ga0395898_0226927 3300037466 Bacteria 1781
277 Ga0395905_0007404 3300037471 Bacteria 10915
278 Ga0395905_1680064 3300037471 Bacteria 540
279 Ga0436364_0373199 3300037853 Bacteria 1764
280 Ga0436364_0588913 3300037853 Bacteria 939
281 Ga0395901_0101142 3300038443 Bacteria 3025
282 Ga0395901_0639929 3300038443 Bacteria 1068
283 Ga0436365_0251177 3300039437 Bacteria 585
284 Ga0436365_1601001 3300039437 Bacteria 1304
285 Ga0436360_1312237 3300039438 Bacteria 771
286 Ga0436363_1118017 3300039450 Bacteria 576
287 Ga0436363_1383014 3300039450 Bacteria 961
288 Ga0436363_1487915 3300039450 Bacteria 693
289 Ga0439453_0005732 3300041408 Bacteria 1904
290 Ga0451787_629503 3300041441 Bacteria 665
291 Ga0451789_0285981 3300041443 Bacteria 553
292 Ga0451789_1166229 3300041443 Bacteria 3013
293 Ga0451793_0394582 3300041452 Bacteria 1588
294 Ga0451797_1142746 3300041453 Bacteria 2515
295 Ga0451802_1067594 3300041460 Bacteria 2142
296 Ga0451807_0179759 3300041486 Bacteria 21130
297 Ga0451807_2023302 3300041486 Bacteria 1138
298 Ga0451843_0409623 3300041509 Bacteria 650
299 Ga0439443_002343 3300042003 Bacteria 2254
300 Ga0439435_0032064 3300042436 Bacteria 1432
301 Ga0439460_0025329 3300042461 Bacteria 1651
302 Ga0439440_0007143 3300042993 Bacteria 2262
303 Ga0439440_0035866 3300042993 Bacteria 1191
304 Ga0466972_0003655 3300044658 Bacteria 7640
305 Ga0466966_0000182 3300044684 Bacteria 41581
306 Ga0466961_0000315 3300044693 Bacteria 32008
307 Ga0466964_0526859 3300044706 Bacteria 638
308 Ga0466968_0009273 3300044735 Bacteria 3785
309 Ga0466960_0094617 3300044901 Bacteria 1528
310 Ga0466959_0048977 3300045049 Bacteria 3104
311 Ga0451576_0394109 3300045051 Bacteria 1452
312 Ga0466958_0430173 3300045836 Bacteria 854
313 Ga0495592_0141847 3300046454 Bacteria 1670
314 Ga0495603_0486852 3300046455 Bacteria 706
315 Ga0495629_0049422 3300046459 Bacteria 2947
316 Ga0495641_0355135 3300046461 Bacteria 663
317 Ga0495580_0443060 3300046472 Bacteria 872
318 Ga0495596_0000401 3300046500 Bacteria 27678
319 Ga0495607_0013840 3300046501 Bacteria 5271
320 Ga0495583_0079165 3300046506 Bacteria 1430
321 Ga0495618_0720451 3300046514 Bacteria 585
322 Ga0495632_0077526 3300046519 Bacteria 1589
323 Ga0495643_0018017 3300046522 Bacteria 4113
324 Ga0495643_0029119 3300046522 Bacteria 3091
325 Ga0495652_1081288 3300046529 Bacteria 521
326 Ga0495640_0502912 3300046533 Bacteria 737
327 Ga0495609_0011660 3300046538 Bacteria 4183
328 Ga0495622_0234978 3300046557 Bacteria 809
329 Ga0495634_0039888 3300046642 Bacteria 3196
330 Ga0495625_0016612 3300046660 Bacteria 5784
331 Ga0495625_0298681 3300046660 Bacteria 1031
332 Ga0495635_0044777 3300046663 Bacteria 3052
333 Ga0495623_0512567 3300046679 Bacteria 632
334 Ga0495647_0266710 3300046681 Bacteria 765
335 Ga0495669_0301993 3300046684 Bacteria 772
336 Ga0495613_0494262 3300046689 Bacteria 824
337 Ga0495671_0303695 3300046692 Bacteria 767
338 Ga0495671_0378487 3300046692 Bacteria 678
339 Ga0495600_0224796 3300046809 Bacteria 1200
340 Ga0495581_0815458 3300047315 Bacteria 535
341 Ga0495604_0027627 3300047317 Bacteria 4511
342 Ga0495674_0096910 3300047319 Bacteria 2513
343 Ga0495683_0165512 3300047323 Bacteria 1020
344 Ga0495687_024005 3300047443 Bacteria 2905
345 Ga0495681_0148338 3300047470 Bacteria 986
346 Ga0495684_1061618 3300047471 Bacteria 510
347 Ga0495593_0712582 3300047673 Bacteria 504
348 Ga0495602_0223435 3300048088 Bacteria 1420
349 Ga0495602_0238196 3300048088 Bacteria 1363
350 Ga0496100_0549057 3300048903 Bacteria 894
351 Ga0496100_0643181 3300048903 Bacteria 825
352 Ga0496101_0091214 3300048904 Bacteria 2267
353 Ga0496101_0330923 3300048904 Bacteria 1196
354 Ga0496102_0145048 3300048905 Bacteria 2228
355 Ga0496102_0163462 3300048905 Bacteria 2094
356 Ga0496102_0381017 3300048905 Bacteria 1327
357 Ga0496102_0658347 3300048905 Bacteria 970
358 Ga0496104_0015957 3300048907 Bacteria 6818
359 Ga0496104_0117451 3300048907 Bacteria 2553
360 Ga0496105_0512621 3300048908 Bacteria 940
361 Ga0496105_0529450 3300048908 Bacteria 922
362 Ga0496106_0169054 3300048909 Bacteria 1732
363 Ga0496106_0430494 3300048909 Bacteria 1060
364 Ga0496108_0054049 3300048911 Bacteria 3370
365 Ga0496108_0290543 3300048911 Bacteria 1423
366 Ga0496109_0410766 3300048912 Bacteria 1279
367 Ga0496109_0488498 3300048912 Bacteria 1162
368 Ga0496110_0017391 3300048913 Bacteria 6015
369 Ga0496110_0063590 3300048913 Bacteria 3261
370 Ga0496112_0084889 3300048915 Bacteria 3132
371 Ga0496112_0351894 3300048915 Bacteria 1415
372 Ga0496112_0391421 3300048915 Bacteria 1330
373 Ga0496112_0897549 3300048915 Bacteria 808
374 Ga0496113_0243844 3300048916 Bacteria 1434
375 Ga0496114_0204797 3300048917 Bacteria 1729
376 Ga0496114_0227881 3300048917 Bacteria 1637
377 Ga0496115_0126810 3300048918 Bacteria 2103
378 Ga0496115_0172412 3300048918 Bacteria 1789
379 Ga0496121_0069018 3300048924 Bacteria 2855
380 Ga0496121_0351593 3300048924 Bacteria 981
381 Ga0496125_0176769 3300048928 Bacteria 1427
382 Ga0496126_0320981 3300048929 Bacteria 1273
383 Ga0496126_0380509 3300048929 Bacteria 1149
384 Ga0501032_0111839 3300049569 Bacteria 1807
385 Ga0501033_0005108 3300049570 Bacteria 10439
386 Ga0501033_0095660 3300049570 Bacteria 2170
387 Ga0501033_0210983 3300049570 Bacteria 1385
388 Ga0501033_0331662 3300049570 Bacteria 1067
389 Ga0501034_0379071 3300049571 Bacteria 1339
390 Ga0501034_0393975 3300049571 Bacteria 1308
391 Ga0501034_0618677 3300049571 Bacteria 987
392 Ga0501034_0825916 3300049571 Bacteria 818
393 Ga0501036_0051984 3300049572 Bacteria 3470
394 Ga0501037_0106359 3300049573 Bacteria 2022
395 Ga0501037_0793278 3300049573 Bacteria 626
396 Ga0501038_0026244 3300049574 Bacteria 5189
397 Ga0501038_0036525 3300049574 Bacteria 4311
398 Ga0501038_0897082 3300049574 Bacteria 655
399 Ga0501043_0125474 3300049579 Bacteria 2013
400 Ga0501046_0079961 3300049580 Bacteria 2527
401 Ga0501047_0073970 3300049581 Bacteria 3280
402 Ga0501047_1160111 3300049581 Bacteria 586
403 Ga0501067_0089451 3300049583 Bacteria 1709
404 Ga0501068_0142257 3300049584 Bacteria 1504
405 Ga0501069_0438298 3300049585 Bacteria 776
406 Ga0501069_0507155 3300049585 Bacteria 720
407 Ga0501070_0769879 3300049586 Bacteria 757
408 Ga0501073_0008291 3300049589 Bacteria 7706
409 Ga0501073_0118618 3300049589 Bacteria 1834
410 Ga0501076_1324701 3300049592 Bacteria 592
411 Ga0501217_089856 3300049661 Bacteria 861
412 Ga0501223_032020 3300049663 Bacteria 1023
413 Ga0501242_013614 3300049674 Bacteria 1000
414 Ga0501259_017109 3300049688 Bacteria 1254
415 Ga0501080_0129240 3300049742 Bacteria 2338
416 Ga0501080_1069199 3300049742 Bacteria 697
417 Ga0501083_0091848 3300049744 Bacteria 2004
418 Ga0501266_005770 3300049763 Bacteria 1538
419 Ga0501268_004767 3300049765 Bacteria 1922
420 Ga0501274_020834 3300049771 Bacteria 681
421 Ga0501044_0095401 3300049823 Bacteria 2997
422 Ga0501044_0127983 3300049823 Bacteria 2536
423 Ga0501044_1514802 3300049823 Bacteria 536
424 Ga0501045_0022656 3300049824 Bacteria 4498
425 nmdc:mga03683_315895_c1 3300050489 Bacteria 735
426 nmdc:mga03683_473114_c1 3300050489 Bacteria 605
427 nmdc:mga03n38_13500_c1 3300050490 Bacteria 3105
428 nmdc:mga0yw44_1014595_c1 3300050492 Bacteria 562
429 nmdc:mga0yw44_124441_c1 3300050492 Bacteria 1664
430 nmdc:mga0yw44_336454_c1 3300050492 Bacteria 1015
431 nmdc:mga0k408_206062_c1 3300050493 Bacteria 1174
432 nmdc:mga0k408_34666_c1 3300050493 Bacteria 2890
433 nmdc:mga0k408_373480_c1 3300050493 Bacteria 850
434 nmdc:mga06z11_53800_c1 3300050494 Bacteria 2072
435 nmdc:mga04h51_11617_c1 3300050495 Bacteria 2450
436 nmdc:mga04h51_51390_c1 3300050495 Bacteria 1385
437 nmdc:mga04h51_68599_c1 3300050495 Bacteria 1233
438 nmdc:mga07m45_12554_c1 3300050496 Bacteria 4479
439 nmdc:mga07m45_424127_c1 3300050496 Bacteria 772
440 nmdc:mga07m45_79170_c1 3300050496 Bacteria 1876
441 nmdc:mga05p37_200904_c1 3300050507 Bacteria 2414
442 nmdc:mga09592_338484_c1 3300050508 Bacteria 1302
443 nmdc:mga0sz30_199220_c1 3300050516 Bacteria 889
444 nmdc:mga0sz30_212076_c1 3300050516 Bacteria 861
445 nmdc:mga0sz30_285646_c1 3300050516 Bacteria 735
446 nmdc:mga0sz30_317680_c1 3300050516 Bacteria 695
447 nmdc:mga0sz30_384226_c1 3300050516 Bacteria 629
448 Ga0495601_0106024 3300053077 Bacteria 1817
449 Ga0495601_0186546 3300053077 Bacteria 1356
450 Ga0495601_0706464 3300053077 Bacteria 643
451 Ga0495655_0031134 3300053083 Bacteria 1296
452 Ga0495619_0008815 3300053085 Bacteria 6379
453 Ga0500643_000023 3300053087 Bacteria 273090
454 Ga0500646_0078923 3300053090 Bacteria 1001
455 Ga0500646_0093275 3300053090 Bacteria 935
456 Ga0500651_0259111 3300053093 Bacteria 1009
457 Ga0500566_0002031 3300053094 Bacteria 11954
458 Ga0500640_064336 3300053095 Bacteria 1584
459 Ga0500641_0030454 3300053096 Bacteria 2121
460 Ga0500572_044529 3300053111 Bacteria 1301
461 Ga0500595_027748 3300053119 Bacteria 1936
462 Ga0500597_221652 3300053120 Bacteria 786
463 Ga0500608_172779 3300053122 Bacteria 924
464 Ga0500618_127349 3300053125 Bacteria 578
465 Ga0500559_0003913 3300053136 Bacteria 7190
466 Ga0500564_105025 3300053138 Bacteria 1245
467 Ga0500616_0045660 3300053153 Bacteria 2333
468 Ga0500619_007424 3300053154 Bacteria 2597
469 Ga0500622_0008968 3300053156 Bacteria 5560
470 Ga0500624_101724 3300053157 Bacteria 591
471 Ga0500634_0173615 3300053161 Bacteria 979
472 Ga0500636_0000517 3300053177 Bacteria 20978
473 Ga0500636_0142168 3300053177 Bacteria 1327
474 Ga0500636_0187319 3300053177 Bacteria 1105
475 Ga0500649_113168 3300053722 Bacteria 1049
476 Ga0500645_102680 3300053730 Bacteria 806
477 Ga0500609_014132 3300053731 Bacteria 1081
478 Ga0500599_000630 3300053736 Bacteria 3755
479 Ga0500601_000056 3300053737 Bacteria 23535
480 Ga0501084_0130013 3300054114 Bacteria 2120
481 Ga0501082_0195247 3300060353 Bacteria 1761
482 Ga0501082_0366118 3300060353 Bacteria 1257
483 Ga0530510_1122786 3300061734 Bacteria 602
484 2508542933 2508501009 Bacteria 7784016
485 2511131036 2510917021 Bacteria 5705459
486 2513646030 2513237095 Bacteria 8976980
487 2513723641 2513237104 Bacteria 10034502
488 2517101419 2517093001 Bacteria 9002274
489 2524442299 2524023205 Bacteria 8918781
490 2745075354 2744054633 Bacteria 8678936
491 2818241142 2816332527 Bacteria 8933356
492 2844318912 2844315083 Bacteria 8138177
493 2874593505 2874590934 Bacteria 8299676
494 2874615131 2874612657 Bacteria 8252029
495 2874627285 2874620515 Bacteria 8290088
496 2874649058 2874645413 Bacteria 8214782
497 2876773078 2876771140 Bacteria 8287509
498 2876821968 2876818435 Bacteria 8274608
499 2879077124 2879074833 Bacteria 8279565
500 2879130108 2879127579 Bacteria 8294491
501 2879146975 2879142872 Bacteria 8267021
502 2885416254 2885409591 Bacteria 9235467
503 2888383870 2888378607 Bacteria 9652610
504 2904671196 2904666416 Bacteria 8226587
505 2906610209 2906602504 Bacteria 8295279
506 2906651514 2906643746 Bacteria 8722424
507 2908760522 2908756301 Bacteria 8864324
508 2932801651 2932794094 Bacteria 7915132
509 2935777468 2935769743 Bacteria 7878163
510 2935793155 2935785616 Bacteria 7962367
511 2935801010 2935793552 Bacteria 8012592
512 2935977200 2935975950 Bacteria 8347125
513 3005599059 3005594810 Bacteria 8716512
514 8006931246 8006926726 Bacteria 6749210
515 8019627842 8019619141 Bacteria 9218857
516 8019645038 8019638758 Bacteria 9062356
517 8019662569 8019659431 Bacteria 8577854
518 Ga0207675_100623746
519 JGI24740J21852_10019997
520 JGI24738J21930_10131175
521 JGI25406J46586_10011795
522 JGI25406J46586_10087556
523 JGI25165J46597_1019199
524 JGI25153J46596_10000718
525 JGI25153J46596_10009468
526 JGI25160J50197_1011122
527 Ga0055531_10003539
528 Ga0055531_10025224
529 Ga0055531_10092342
530 Ga0055543_1009263
531 Ga0065715_10018407
532 Ga0070658_10174003
533 Ga0070683_100648610
534 Ga0070690_100032441
535 Ga0070670_100608115
536 Ga0070680_100103450
537 Ga0070682_100008759
538 Ga0070682_100240007
539 Ga0070682_100418681
540 Ga0070660_100769593
541 Ga0070689_100026322
542 Ga0070689_100099886
543 Ga0070689_100215656
544 Ga0070691_10553163
545 Ga0070671_100553982
546 Ga0070688_100104070
547 Ga0070688_100315137
548 Ga0070659_100019409
549 Ga0070659_100519222
550 Ga0070709_10004133
551 Ga0070714_100095255
552 Ga0070714_100129969
553 Ga0070713_100003460
554 Ga0070713_100015098
555 Ga0070713_101084900
556 Ga0070713_101597119
557 Ga0070710_10001250
558 Ga0070701_10125710
559 Ga0070711_100049132
560 Ga0070711_101007624
561 Ga0070705_100488482
562 Ga0070708_101152536
563 Ga0070663_100172238
564 Ga0070663_100681442
565 Ga0070663_101735473
566 Ga0070678_100508865
567 Ga0070662_100950349
568 Ga0070679_100004000
569 Ga0070679_101318723
570 Ga0070679_101716079
571 Ga0068853_100217962
572 Ga0068853_100453360
573 Ga0068853_100970497
574 Ga0070695_100641071
575 Ga0070695_101356429
576 Ga0070664_100235823
577 Ga0068857_100105075
578 Ga0068857_100326032
579 Ga0068854_100675905
580 Ga0068856_100371925
581 Ga0070702_100216667
582 Ga0068859_100063594
583 Ga0068859_101352422
584 Ga0068864_100136607
585 Ga0068861_100559330
586 Ga0068861_101468868
587 Ga0068870_10057755
588 Ga0068863_100284827
589 Ga0068863_100738767
590 Ga0068858_100156989
591 Ga0068860_100189015
592 Ga0068862_100996107
593 Ga0068862_101064110
594 Ga0081455_10545355
595 Ga0081538_10022185
596 Ga0081539_10005791
597 Ga0081539_10147097
598 Ga0081539_10357834
599 Ga0070717_10054006
600 Ga0070717_10141422
601 Ga0070717_10770584
602 Ga0075365_10080265
603 Ga0075365_10186296
604 Ga0075368_10022875
605 Ga0075368_10030376
606 Ga0075368_10064062
607 Ga0075363_100043213
608 Ga0075364_10150494
609 Ga0070715_10018905
610 Ga0070715_10170374
611 Ga0070716_100089975
612 Ga0070716_100958793
613 Ga0070712_100017413
614 Ga0070712_100225299
615 Ga0070712_100303268
616 Ga0070712_100850536
617 Ga0075362_10247156
618 Ga0075362_10285555
619 Ga0075367_10002646
620 Ga0075367_10511643
621 Ga0075369_10153482
622 Ga0075369_10280235
623 Ga0075369_10578893
624 Ga0075366_10012578
625 Ga0075366_10407307
626 Ga0097621_100408494
627 Ga0075370_10007461
628 Ga0075370_10012127
629 Ga0075370_10146047
630 Ga0075370_10258050
631 Ga0075428_100201183
632 Ga0068865_101564005
633 Ga0097620_100063593
634 Ga0097620_101352997
635 Ga0099823_1028000
636 Ga0075435_100309669
637 Ga0105251_10199855
638 Ga0105240_10129517
639 Ga0105245_10512223
640 Ga0105247_10933801
641 Ga0105241_10803341
642 Ga0105241_10808579
643 Ga0105241_11161868
644 Ga0105242_10794396
645 Ga0105242_10954139
646 Ga0105248_11156827
647 Ga0105237_11148867
648 Ga0105238_10033343
649 Ga0105238_10542691
650 Ga0105238_10866384
651 Ga0105246_10109030
652 Ga0157344_1026178
653 Ga0157374_10566894
654 Ga0157374_10719131
655 Ga0157378_10145094
656 Ga0157378_11844222
657 Ga0163162_10010128
658 Ga0163162_11403126
659 Ga0163163_10024410
660 Ga0163163_12112547
661 Ga0157377_11143490
662 Ga0157379_10054517
663 Ga0157379_11701357
664 Ga0157376_10516899
665 Ga0213876_10044305
666 Ga0207425_1003639
667 Ga0209148_1000368
668 Ga0209233_1022472
669 Ga0209455_1001974
670 Ga0209564_1002366
671 Ga0209758_1000021
672 Ga0209758_1000539
673 Ga0209758_1000612
674 Ga0209256_1091977
675 Ga0207426_1000830
676 Ga0207426_1039103
677 Ga0209051_1025667
678 Ga0209257_1000527
679 Ga0209257_1008762
680 Ga0207692_10037071
681 Ga0207710_10227746
682 Ga0207710_10336864
683 Ga0207647_10001414
684 Ga0207685_10067666
685 Ga0207699_10052671
686 Ga0207645_10287481
687 Ga0207643_10039100
688 Ga0207705_10109678
689 Ga0207671_10262547
690 Ga0207671_10736266
691 Ga0207693_10015050
692 Ga0207693_10603172
693 Ga0207693_10657845
694 Ga0207663_10001270
695 Ga0207663_10832677
696 Ga0207660_10890772
697 Ga0207657_10227038
698 Ga0207681_10958349
699 Ga0207694_10109820
700 Ga0207659_10529965
701 Ga0207687_10047499
702 Ga0207687_10698506
703 Ga0207700_10093160
704 Ga0207700_10680569
705 Ga0207664_10159107
706 Ga0207664_10289993
707 Ga0207644_10181730
708 Ga0207644_10527083
709 Ga0207644_10894985
710 Ga0207690_10690165
711 Ga0207670_10190720
712 Ga0207670_10333781
713 Ga0207665_10000474
714 Ga0207711_10903707
715 Ga0207711_11766555
716 Ga0207689_10072777
717 Ga0207689_10661173
718 Ga0207679_10239575
719 Ga0207667_11461213
720 Ga0207712_10000818
721 Ga0207712_10316503
722 Ga0207658_10353801
723 Ga0207703_10476357
724 Ga0207703_11189824
725 Ga0207703_11560262
726 Ga0207639_10012068
727 Ga0207639_10443084
728 Ga0207708_10358996
729 Ga0207702_10104767
730 Ga0207702_10387558
731 Ga0207702_10480507
732 Ga0207702_12024134
733 Ga0207641_10323896
734 Ga0207676_10580511
735 Ga0207674_10104305
736 Ga0207674_10217066
737 Ga0207675_101793904
738 Ga0207683_10327946
739 Ga0209389_1016428
740 Ga0209489_111950
741 Ga0209700_100036
742 Ga0209813_10111291
743 Ga0209813_10156501
744 Ga0268264_10428703
745 Ga0268264_11510124
746 Ga0268264_11581775
747 Ga0265319_1014098
748 Ga0265334_10038908
749 Ga0265318_10000083
750 Ga0265330_10000253
751 Ga0265332_10000266
752 Ga0265328_10000149
753 Ga0265320_10001440
754 Ga0265325_10026687
755 Ga0265325_10066407
756 Ga0265329_10000038
757 Ga0265329_10101106
758 Ga0265340_10021446
759 Ga0265340_10074240
760 Ga0265339_10092733
761 Ga0265331_10000223
762 Ga0265316_10000647
763 Ga0265316_10193992
764 Ga0265316_10424324
765 Ga0307408_100128389
766 Ga0307508_10047104
767 Ga0265314_10000725
768 Ga0265342_10000576
769 Ga0265342_10011652
770 Ga0307413_10211638
771 Ga0307410_10097291
772 Ga0307406_10144262
773 Ga0307407_10092376
774 Ga0307412_10040967
775 Ga0307412_10957128
776 Ga0307416_100329698
777 Ga0307414_10396419
778 Ga0307414_11300389
779 Ga0307411_11020775
780 Ga0307415_101070971
781 Ga0373945_0192154
782 Ga0373946_0081954
783 Ga0373931_0293955
784 Ga0373935_0055517
785 Ga0373927_0080934
786 Ga0373947_0023945
787 Ga0373925_0081481
788 Ga0373925_1045544
789 Ga0373925_1277088
790 Ga0395899_0229632
791 Ga0395900_0003313
792 Ga0395900_0579869
793 Ga0395898_0226927
794 Ga0395905_0007404
795 Ga0395905_1680064
796 Ga0436364_0373199
797 Ga0436364_0588913
798 Ga0395901_0101142
799 Ga0395901_0639929
800 Ga0436365_0251177
801 Ga0436365_1601001
802 Ga0436360_1312237
803 Ga0436363_1118017
804 Ga0436363_1383014
805 Ga0436363_1487915
806 Ga0439453_0005732
807 Ga0451787_629503
808 Ga0451789_0285981
809 Ga0451789_1166229
810 Ga0451793_0394582
811 Ga0451797_1142746
812 Ga0451802_1067594
813 Ga0451807_0179759
814 Ga0451807_2023302
815 Ga0451843_0409623
816 Ga0439443_002343
817 Ga0439435_0032064
818 Ga0439460_0025329
819 Ga0439440_0007143
820 Ga0439440_0035866
821 Ga0466972_0003655
822 Ga0466966_0000182
823 Ga0466961_0000315
824 Ga0466964_0526859
825 Ga0466968_0009273
826 Ga0466960_0094617
827 Ga0466959_0048977
828 Ga0451576_0394109
829 Ga0466958_0430173
830 Ga0495592_0141847
831 Ga0495603_0486852
832 Ga0495629_0049422
833 Ga0495641_0355135
834 Ga0495580_0443060
835 Ga0495596_0000401
836 Ga0495607_0013840
837 Ga0495583_0079165
838 Ga0495618_0720451
839 Ga0495632_0077526
840 Ga0495643_0018017
841 Ga0495643_0029119
842 Ga0495652_1081288
843 Ga0495640_0502912
844 Ga0495609_0011660
845 Ga0495622_0234978
846 Ga0495634_0039888
847 Ga0495625_0016612
848 Ga0495625_0298681
849 Ga0495635_0044777
850 Ga0495623_0512567
851 Ga0495647_0266710
852 Ga0495669_0301993
853 Ga0495613_0494262
854 Ga0495671_0303695
855 Ga0495671_0378487
856 Ga0495600_0224796
857 Ga0495581_0815458
858 Ga0495604_0027627
859 Ga0495674_0096910
860 Ga0495683_0165512
861 Ga0495687_024005
862 Ga0495681_0148338
863 Ga0495684_1061618
864 Ga0495593_0712582
865 Ga0495602_0223435
866 Ga0495602_0238196
867 Ga0496100_0549057
868 Ga0496100_0643181
869 Ga0496101_0091214
870 Ga0496101_0330923
871 Ga0496102_0145048
872 Ga0496102_0163462
873 Ga0496102_0381017
874 Ga0496102_0658347
875 Ga0496104_0015957
876 Ga0496104_0117451
877 Ga0496105_0512621
878 Ga0496105_0529450
879 Ga0496106_0169054
880 Ga0496106_0430494
881 Ga0496108_0054049
882 Ga0496108_0290543
883 Ga0496109_0410766
884 Ga0496109_0488498
885 Ga0496110_0017391
886 Ga0496110_0063590
887 Ga0496112_0084889
888 Ga0496112_0351894
889 Ga0496112_0391421
890 Ga0496112_0897549
891 Ga0496113_0243844
892 Ga0496114_0204797
893 Ga0496114_0227881
894 Ga0496115_0126810
895 Ga0496115_0172412
896 Ga0496121_0069018
897 Ga0496121_0351593
898 Ga0496125_0176769
899 Ga0496126_0320981
900 Ga0496126_0380509
901 Ga0501032_0111839
902 Ga0501033_0005108
903 Ga0501033_0095660
904 Ga0501033_0210983
905 Ga0501033_0331662
906 Ga0501034_0379071
907 Ga0501034_0393975
908 Ga0501034_0618677
909 Ga0501034_0825916
910 Ga0501036_0051984
911 Ga0501037_0106359
912 Ga0501037_0793278
913 Ga0501038_0026244
914 Ga0501038_0036525
915 Ga0501038_0897082
916 Ga0501043_0125474
917 Ga0501046_0079961
918 Ga0501047_0073970
919 Ga0501047_1160111
920 Ga0501067_0089451
921 Ga0501068_0142257
922 Ga0501069_0438298
923 Ga0501069_0507155
924 Ga0501070_0769879
925 Ga0501073_0008291
926 Ga0501073_0118618
927 Ga0501076_1324701
928 Ga0501217_089856
929 Ga0501223_032020
930 Ga0501242_013614
931 Ga0501259_017109
932 Ga0501080_0129240
933 Ga0501080_1069199
934 Ga0501083_0091848
935 Ga0501266_005770
936 Ga0501268_004767
937 Ga0501274_020834
938 Ga0501044_0095401
939 Ga0501044_0127983
940 Ga0501044_1514802
941 Ga0501045_0022656
942 nmdc:mga03683_315895_c1
943 nmdc:mga03683_473114_c1
944 nmdc:mga03n38_13500_c1
945 nmdc:mga0yw44_1014595_c1
946 nmdc:mga0yw44_124441_c1
947 nmdc:mga0yw44_336454_c1
948 nmdc:mga0k408_206062_c1
949 nmdc:mga0k408_34666_c1
950 nmdc:mga0k408_373480_c1
951 nmdc:mga06z11_53800_c1
952 nmdc:mga04h51_11617_c1
953 nmdc:mga04h51_51390_c1
954 nmdc:mga04h51_68599_c1
955 nmdc:mga07m45_12554_c1
956 nmdc:mga07m45_424127_c1
957 nmdc:mga07m45_79170_c1
958 nmdc:mga05p37_200904_c1
959 nmdc:mga09592_338484_c1
960 nmdc:mga0sz30_199220_c1
961 nmdc:mga0sz30_212076_c1
962 nmdc:mga0sz30_285646_c1
963 nmdc:mga0sz30_317680_c1
964 nmdc:mga0sz30_384226_c1
965 Ga0495601_0106024
966 Ga0495601_0186546
967 Ga0495601_0706464
968 Ga0495655_0031134
969 Ga0495619_0008815
970 Ga0500643_000023
971 Ga0500646_0078923
972 Ga0500646_0093275
973 Ga0500651_0259111
974 Ga0500566_0002031
975 Ga0500640_064336
976 Ga0500641_0030454
977 Ga0500572_044529
978 Ga0500595_027748
979 Ga0500597_221652
980 Ga0500608_172779
981 Ga0500618_127349
982 Ga0500559_0003913
983 Ga0500564_105025
984 Ga0500616_0045660
985 Ga0500619_007424
986 Ga0500622_0008968
987 Ga0500624_101724
988 Ga0500634_0173615
989 Ga0500636_0000517
990 Ga0500636_0142168
991 Ga0500636_0187319
992 Ga0500649_113168
993 Ga0500645_102680
994 Ga0500609_014132
995 Ga0500599_000630
996 Ga0500601_000056
997 Ga0501084_0130013
998 Ga0501082_0195247
999 Ga0501082_0366118
1000 Ga0530510_1122786
1001 2508542933
1002 2511131036
1003 2513646030
1004 2513723641
1005 2517101419
1006 2524442299
1007 2745075354
1008 2818241142
1009 2844318912
1010 2874593505
1011 2874615131
1012 2874627285
1013 2874649058
1014 2876773078
1015 2876821968
1016 2879077124
1017 2879130108
1018 2879146975
1019 2885416254
1020 2888383870
1021 2904671196
1022 2906610209
1023 2906651514
1024 2908760522
1025 2932801651
1026 2935777468
1027 2935793155
1028 2935801010
1029 2935977200
1030 3005599059
1031 8006931246
1032 8019627842
1033 8019645038
1034 8019662569

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

29

157

0.9

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

31

147

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8775 1 131
2c21-assembly3.cif.gz_F specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme 0.8723 1 130
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8705 1 131
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.8643 1 132
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.8575 1 132
ID Description Score Start End Superfamily
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8775 1 131 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8705 1 131 3.10.180.10
2c21D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8583 1 130 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8462 1 68 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7945 5 131 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A534CJR0-F1-model_v4 Lactoylglutathione lyase 1.005 92 149 GO:0016829
AF-A0A534CJR0-F1-model_v4 Lactoylglutathione lyase 0.9877 92 149 GO:0016829
AF-A0A3C7W1R9-F1-model_v4 Lactoylglutathione lyase 0.9855 98 149 GO:0016829
AF-A0A3D2GKL9-F1-model_v4 Lactoylglutathione lyase 0.9678 81 149 GO:0016829
AF-A0A3B8WFH9-F1-model_v4 Lactoylglutathione lyase 0.9616 95 149 GO:0016829

Map