F458134

General Info

Members Datasets Scaffolds Average Seq Length
517 275 1034 102

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_11349156|Ga0157380_113491561
Length 116
Sequence MQPKAAYASTLYNHFMSQQKITVIVAKDLEDLIPVFLKNRHKEVDTLRVALASADFEQLRQLGHRMKGVGNSYGFARVSVIGKEIEDGARSGDRAGLEASIAGYADYLAKLEVAYE

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
127 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
128 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
137 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
138 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
164 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
169 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
170 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
171 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
172 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
173 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
174 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
214 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
215 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
216 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
217 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
218 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
245 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
246 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
247 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
248 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
249 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
250 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
256 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 0.19
Rhizosphere 98.84
Stem 0
Stem Tuber 0
Unclassified 11.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_11349156 3300014326 Bacteria 762
2 rootH1_10269420 3300003323 Bacteria 1265
3 Ga0065707_10263762 3300005295 Bacteria 1090
4 Ga0070683_100202497 3300005329 Bacteria 1885
5 Ga0070690_100118807 3300005330 Bacteria 1772
6 Ga0070690_100309668 3300005330 Unclassified 1135
7 Ga0070690_100598087 3300005330 Bacteria 837
8 Ga0068869_100033387 3300005334 Bacteria 3633
9 Ga0068869_101541437 3300005334 Bacteria 591
10 Ga0070680_100099503 3300005336 Bacteria 2413
11 Ga0070680_100175894 3300005336 Bacteria 1802
12 Ga0070680_101096488 3300005336 Bacteria 688
13 Ga0070689_100032819 3300005340 Bacteria 3952
14 Ga0070689_100067322 3300005340 Bacteria 2792
15 Ga0070689_100254454 3300005340 Bacteria 1450
16 Ga0070687_100095451 3300005343 Unclassified 1653
17 Ga0070687_100399386 3300005343 Bacteria 901
18 Ga0070687_100480795 3300005343 Bacteria 832
19 Ga0070687_100996108 3300005343 Bacteria 607
20 Ga0070692_10029573 3300005345 Bacteria 2731
21 Ga0070692_10112770 3300005345 Bacteria 1506
22 Ga0070668_100123244 3300005347 Bacteria 2074
23 Ga0070669_100028912 3300005353 Bacteria 3993
24 Ga0070669_100343729 3300005353 Bacteria 1210
25 Ga0070675_100116969 3300005354 Bacteria 2262
26 Ga0070675_102056055 3300005354 Bacteria 527
27 Ga0070674_100323866 3300005356 Bacteria 1236
28 Ga0070673_100212073 3300005364 Bacteria 1673
29 Ga0070673_100313191 3300005364 Bacteria 1385
30 Ga0070673_101270554 3300005364 Bacteria 691
31 Ga0070688_100076589 3300005365 Bacteria 2153
32 Ga0070688_101206376 3300005365 Bacteria 608
33 Ga0070667_101184776 3300005367 Bacteria 715
34 Ga0070714_100057763 3300005435 Bacteria 3322
35 Ga0070701_10299040 3300005438 Bacteria 989
36 Ga0070705_100004915 3300005440 Bacteria 6511
37 Ga0070705_100447045 3300005440 Bacteria 969
38 Ga0070700_100047346 3300005441 Bacteria 2660
39 Ga0070700_100179923 3300005441 Bacteria 1471
40 Ga0070700_100211897 3300005441 Unclassified 1367
41 Ga0070700_100245015 3300005441 Bacteria 1283
42 Ga0070700_100408705 3300005441 Bacteria 1023
43 Ga0070694_100025193 3300005444 Bacteria 3848
44 Ga0070694_100032664 3300005444 Bacteria 3419
45 Ga0070694_100214283 3300005444 Bacteria 1442
46 Ga0070694_100239617 3300005444 Bacteria 1368
47 Ga0070694_100903298 3300005444 Bacteria 729
48 Ga0070708_100319638 3300005445 Bacteria 1462
49 Ga0070708_101785226 3300005445 Bacteria 571
50 Ga0070678_100621752 3300005456 Unclassified 966
51 Ga0070662_101174850 3300005457 Bacteria 659
52 Ga0068867_100000699 3300005459 Bacteria 22369
53 Ga0068867_100716910 3300005459 Bacteria 884
54 Ga0068867_101056045 3300005459 Unclassified 739
55 Ga0070685_10230002 3300005466 Bacteria 1219
56 Ga0070706_100040437 3300005467 Bacteria 4304
57 Ga0070706_100737123 3300005467 Bacteria 913
58 Ga0070707_100123470 3300005468 Bacteria 2514
59 Ga0070707_100458873 3300005468 Bacteria 1235
60 Ga0070707_100524080 3300005468 Bacteria 1147
61 Ga0070699_100007598 3300005518 Bacteria 9424
62 Ga0070699_100027831 3300005518 Bacteria 4876
63 Ga0070679_101314318 3300005530 Bacteria 669
64 Ga0070684_100059727 3300005535 Bacteria 3334
65 Ga0070697_100040929 3300005536 Bacteria 3749
66 Ga0070697_100822955 3300005536 Bacteria 822
67 Ga0070697_101275773 3300005536 Bacteria 655
68 Ga0070686_100293904 3300005544 Bacteria 1203
69 Ga0070686_100966125 3300005544 Bacteria 697
70 Ga0070695_100001179 3300005545 Bacteria 14369
71 Ga0070695_100097537 3300005545 Bacteria 1974
72 Ga0070695_100157713 3300005545 Bacteria 1590
73 Ga0070695_100324105 3300005545 Bacteria 1146
74 Ga0070696_100001672 3300005546 Bacteria 14528
75 Ga0070696_100092111 3300005546 Bacteria 2160
76 Ga0070696_100196155 3300005546 Bacteria 1505
77 Ga0070696_100348720 3300005546 Bacteria 1146
78 Ga0070696_100453245 3300005546 Bacteria 1013
79 Ga0070696_100762459 3300005546 Bacteria 794
80 Ga0070704_100115664 3300005549 Bacteria 2050
81 Ga0070704_100241040 3300005549 Bacteria 1480
82 Ga0070704_101291202 3300005549 Unclassified 668
83 Ga0068856_100500578 3300005614 Bacteria 1236
84 Ga0070702_100017482 3300005615 Bacteria 3699
85 Ga0070702_101010123 3300005615 Bacteria 659
86 Ga0068859_100782992 3300005617 Bacteria 1042
87 Ga0068866_10190943 3300005718 Bacteria 1217
88 Ga0068861_100003377 3300005719 Bacteria 10583
89 Ga0068861_100262391 3300005719 Bacteria 1479
90 Ga0068861_100442188 3300005719 Bacteria 1163
91 Ga0068861_101018379 3300005719 Unclassified 791
92 Ga0068861_101729184 3300005719 Bacteria 619
93 Ga0068870_10055763 3300005840 Bacteria 2107
94 Ga0068858_102021658 3300005842 Bacteria 570
95 Ga0068860_102768028 3300005843 Unclassified 509
96 Ga0068862_100006699 3300005844 Bacteria 9558
97 Ga0068862_100051284 3300005844 Bacteria 3528
98 Ga0068862_102386681 3300005844 Bacteria 541
99 Ga0075364_10666451 3300006051 Bacteria 710
100 Ga0070715_10026278 3300006163 Bacteria 2315
101 Ga0070715_10070851 3300006163 Bacteria 1557
102 Ga0070716_100024451 3300006173 Bacteria 3215
103 Ga0097621_100009592 3300006237 Bacteria 7035
104 Ga0097621_101907983 3300006237 Unclassified 567
105 Ga0068871_100004668 3300006358 Bacteria 9577
106 Ga0068871_101297642 3300006358 Bacteria 685
107 Ga0075428_100095349 3300006844 Bacteria 3243
108 Ga0075428_100277783 3300006844 Bacteria 1802
109 Ga0075430_100003294 3300006846 Bacteria 13542
110 Ga0075430_100018269 3300006846 Bacteria 5969
111 Ga0075430_100053434 3300006846 Bacteria 3401
112 Ga0075430_100282804 3300006846 Bacteria 1373
113 Ga0075430_100378400 3300006846 Unclassified 1168
114 Ga0075430_100899091 3300006846 Bacteria 729
115 Ga0075431_100048739 3300006847 Bacteria 4369
116 Ga0075431_100082538 3300006847 Bacteria 3318
117 Ga0075431_100101937 3300006847 Bacteria 2962
118 Ga0075431_100316157 3300006847 Unclassified 1575
119 Ga0075431_100464614 3300006847 Bacteria 1260
120 Ga0075431_101511734 3300006847 Bacteria 630
121 Ga0075431_101901581 3300006847 Bacteria 551
122 Ga0075433_10132171 3300006852 Bacteria 2217
123 Ga0075433_10674471 3300006852 Bacteria 906
124 Ga0075434_100068233 3300006871 Bacteria 3542
125 Ga0075434_100422254 3300006871 Bacteria 1354
126 Ga0075434_100543144 3300006871 Bacteria 1182
127 Ga0075434_101637795 3300006871 Bacteria 652
128 Ga0075434_102285789 3300006871 Unclassified 544
129 Ga0075429_100074538 3300006880 Bacteria 2956
130 Ga0075429_100094803 3300006880 Bacteria 2603
131 Ga0075429_100321466 3300006880 Bacteria 1354
132 Ga0075429_100365965 3300006880 Bacteria 1262
133 Ga0068865_100121718 3300006881 Bacteria 1941
134 Ga0068865_100553868 3300006881 Bacteria 966
135 Ga0068865_100757961 3300006881 Bacteria 834
136 Ga0075436_100004918 3300006914 Bacteria 9183
137 Ga0075436_100016711 3300006914 Bacteria 5023
138 Ga0075436_100079149 3300006914 Bacteria 2277
139 Ga0075436_100460904 3300006914 Unclassified 926
140 Ga0075436_100938311 3300006914 Unclassified 648
141 Ga0097620_100782868 3300006931 Bacteria 1042
142 Ga0075435_100028033 3300007076 Bacteria 4414
143 Ga0075435_100072703 3300007076 Bacteria 2810
144 Ga0075435_100290629 3300007076 Unclassified 1396
145 Ga0075435_100406814 3300007076 Bacteria 1171
146 Ga0099794_10024417 3300007265 Bacteria 2775
147 Ga0099794_10408446 3300007265 Bacteria 710
148 Ga0111539_10042981 3300009094 Bacteria 5421
149 Ga0111539_10395447 3300009094 Bacteria 1610
150 Ga0111539_10458600 3300009094 Bacteria 1484
151 Ga0111539_10561630 3300009094 Bacteria 1329
152 Ga0111539_11898450 3300009094 Bacteria 691
153 Ga0114129_10017705 3300009147 Bacteria 10145
154 Ga0114129_10052708 3300009147 Bacteria 5710
155 Ga0114129_11075634 3300009147 Bacteria 1008
156 Ga0114129_11133627 3300009147 Bacteria 977
157 Ga0114129_12109652 3300009147 Bacteria 680
158 Ga0114129_13173703 3300009147 Bacteria 535
159 Ga0105243_10005794 3300009148 Bacteria 9592
160 Ga0105243_11501647 3300009148 Unclassified 697
161 Ga0105242_10549677 3300009176 Unclassified 1107
162 Ga0105242_10746677 3300009176 Bacteria 963
163 Ga0105242_11778217 3300009176 Bacteria 654
164 Ga0105242_12204814 3300009176 Bacteria 596
165 Ga0105248_11464920 3300009177 Unclassified 773
166 Ga0105238_13030499 3300009551 Bacteria 504
167 Ga0105249_10231279 3300009553 Bacteria 1823
168 Ga0157369_11690010 3300013105 Bacteria 643
169 Ga0157372_12327007 3300013307 Bacteria 615
170 Ga0157375_11279412 3300013308 Unclassified 862
171 Ga0157375_12144782 3300013308 Bacteria 665
172 Ga0157380_10017620 3300014326 Bacteria 5287
173 Ga0157380_10590212 3300014326 Unclassified 1097
174 Ga0157380_11512794 3300014326 Bacteria 724
175 Ga0157377_10106085 3300014745 Bacteria 1682
176 Ga0157377_11449279 3300014745 Unclassified 544
177 Ga0157376_10720780 3300014969 Bacteria 1004
178 Ga0157376_11171503 3300014969 Bacteria 796
179 Ga0207653_10261317 3300025885 Bacteria 665
180 Ga0207642_10497477 3300025899 Bacteria 746
181 Ga0207699_10498938 3300025906 Bacteria 878
182 Ga0207645_10288563 3300025907 Unclassified 1091
183 Ga0207643_10169770 3300025908 Bacteria 1316
184 Ga0207707_10033537 3300025912 Bacteria 4492
185 Ga0207707_10669037 3300025912 Bacteria 874
186 Ga0207660_10085216 3300025917 Bacteria 2330
187 Ga0207660_10197887 3300025917 Bacteria 1568
188 Ga0207660_10873576 3300025917 Bacteria 734
189 Ga0207662_10137642 3300025918 Bacteria 1545
190 Ga0207662_10410146 3300025918 Bacteria 920
191 Ga0207662_10699439 3300025918 Bacteria 710
192 Ga0207662_11000301 3300025918 Bacteria 594
193 Ga0207652_11427989 3300025921 Bacteria 595
194 Ga0207646_10155652 3300025922 Bacteria 2061
195 Ga0207646_11598301 3300025922 Bacteria 562
196 Ga0207681_10017771 3300025923 Bacteria 4470
197 Ga0207681_10812174 3300025923 Bacteria 781
198 Ga0207694_10968089 3300025924 Bacteria 720
199 Ga0207659_10091676 3300025926 Bacteria 2270
200 Ga0207664_10844059 3300025929 Bacteria 823
201 Ga0207706_10889549 3300025933 Bacteria 753
202 Ga0207686_10810592 3300025934 Bacteria 751
203 Ga0207686_11221817 3300025934 Bacteria 616
204 Ga0207709_10000934 3300025935 Bacteria 21962
205 Ga0207709_10566173 3300025935 Bacteria 895
206 Ga0207670_10043255 3300025936 Bacteria 2973
207 Ga0207670_10225028 3300025936 Bacteria 1438
208 Ga0207669_10519683 3300025937 Bacteria 956
209 Ga0207704_10002850 3300025938 Bacteria 7810
210 Ga0207704_11145143 3300025938 Bacteria 662
211 Ga0207704_11183659 3300025938 Bacteria 651
212 Ga0207665_10010514 3300025939 Bacteria 6079
213 Ga0207691_10250997 3300025940 Bacteria 1527
214 Ga0207661_10141897 3300025944 Bacteria 2068
215 Ga0207651_10412277 3300025960 Unclassified 1151
216 Ga0207651_10503696 3300025960 Unclassified 1047
217 Ga0207651_11378320 3300025960 Bacteria 634
218 Ga0207712_10002777 3300025961 Bacteria 11198
219 Ga0207668_10307610 3300025972 Bacteria 1310
220 Ga0207658_10656076 3300025986 Bacteria 946
221 Ga0207708_10051968 3300026075 Bacteria 3121
222 Ga0207708_10176700 3300026075 Bacteria 1694
223 Ga0207708_10278010 3300026075 Bacteria 1356
224 Ga0207708_10920406 3300026075 Bacteria 757
225 Ga0207708_11976088 3300026075 Bacteria 511
226 Ga0207702_10555164 3300026078 Bacteria 1124
227 Ga0207648_10002925 3300026089 Bacteria 18080
228 Ga0207648_10729563 3300026089 Bacteria 919
229 Ga0207674_10112611 3300026116 Bacteria 2695
230 Ga0207675_100022509 3300026118 Bacteria 5867
231 Ga0207675_100237872 3300026118 Bacteria 1759
232 Ga0207675_100503892 3300026118 Bacteria 1205
233 Ga0207675_100857277 3300026118 Bacteria 923
234 Ga0209969_1046905 3300027360 Bacteria 675
235 Ga0209967_1021663 3300027364 Bacteria 940
236 Ga0209967_1065475 3300027364 Bacteria 565
237 Ga0209981_1007358 3300027378 Bacteria 1484
238 Ga0209996_1010022 3300027395 Unclassified 1253
239 Ga0209996_1020765 3300027395 Bacteria 921
240 Ga0210000_1001370 3300027462 Bacteria 3434
241 Ga0210000_1002070 3300027462 Bacteria 2839
242 Ga0209995_1008706 3300027471 Bacteria 1638
243 Ga0209995_1067217 3300027471 Bacteria 612
244 Ga0209968_1002882 3300027526 Bacteria 2583
245 Ga0209968_1012932 3300027526 Bacteria 1305
246 Ga0209999_1003113 3300027543 Bacteria 2960
247 Ga0209999_1013190 3300027543 Unclassified 1499
248 Ga0209982_1069653 3300027552 Bacteria 576
249 Ga0209970_1004988 3300027614 Unclassified 2193
250 Ga0209983_1102290 3300027665 Unclassified 649
251 Ga0209971_1004213 3300027682 Bacteria 3412
252 Ga0209971_1027721 3300027682 Bacteria 1355
253 Ga0209966_1002908 3300027695 Bacteria 2870
254 Ga0209966_1057143 3300027695 Bacteria 838
255 Ga0209974_10060112 3300027876 Bacteria 1286
256 Ga0207428_10042033 3300027907 Bacteria 3698
257 Ga0207428_10070549 3300027907 Bacteria 2746
258 Ga0207428_10209108 3300027907 Bacteria 1466
259 Ga0207428_10209264 3300027907 Bacteria 1466
260 Ga0268265_10004917 3300028380 Bacteria 9188
261 Ga0268265_10058562 3300028380 Bacteria 2942
262 Ga0268264_11904279 3300028381 Bacteria 604
263 Ga0265331_10119717 3300031250 Bacteria 1204
264 Ga0307408_101055691 3300031548 Bacteria 751
265 Ga0307408_101927759 3300031548 Bacteria 567
266 Ga0316575_10131649 3300031665 Unclassified 1026
267 Ga0316579_10013700 3300031691 Bacteria 3491
268 Ga0316578_10236006 3300031728 Unclassified 1098
269 Ga0307405_10914164 3300031731 Unclassified 743
270 Ga0307406_11800040 3300031901 Bacteria 544
271 Ga0307412_10372719 3300031911 Bacteria 1153
272 Ga0307412_10592175 3300031911 Bacteria 938
273 Ga0307412_11130009 3300031911 Bacteria 698
274 Ga0307409_100124666 3300031995 Bacteria 2189
275 Ga0307416_100026297 3300032002 Bacteria 4286
276 Ga0307416_100744471 3300032002 Bacteria 1072
277 Ga0307416_100963048 3300032002 Unclassified 955
278 Ga0307416_101750604 3300032002 Bacteria 726
279 Ga0307416_102038245 3300032002 Unclassified 676
280 Ga0307411_10234137 3300032005 Bacteria 1434
281 Ga0307411_10681605 3300032005 Unclassified 893
282 Ga0307411_11401994 3300032005 Bacteria 639
283 Ga0307415_100486268 3300032126 Bacteria 1076
284 Ga0316583_10031101 3300032133 Bacteria 1900
285 Ga0373940_0351396 3300035088 Bacteria 517
286 Ga0373944_0123315 3300035089 Bacteria 895
287 Ga0373949_0235076 3300035090 Bacteria 562
288 Ga0373923_0111424 3300035111 Bacteria 1215
289 Ga0373923_0265729 3300035111 Bacteria 806
290 Ga0373932_0093093 3300035112 Bacteria 970
291 Ga0373936_0028956 3300035113 Bacteria 2179
292 Ga0373939_0032057 3300035114 Bacteria 1524
293 Ga0373939_0307203 3300035114 Bacteria 634
294 Ga0373953_0043262 3300035117 Bacteria 1797
295 Ga0373954_0292469 3300035118 Bacteria 803
296 Ga0373956_0021188 3300035119 Bacteria 2771
297 Ga0373957_0068870 3300035120 Bacteria 1381
298 Ga0373960_0004628 3300035121 Bacteria 3159
299 Ga0373960_0098437 3300035121 Unclassified 945
300 Ga0373943_0406970 3300035170 Bacteria 786
301 Ga0373946_0385152 3300035171 Bacteria 706
302 Ga0373946_0487175 3300035171 Bacteria 631
303 Ga0373955_0038012 3300035172 Bacteria 2562
304 Ga0373955_0497039 3300035172 Bacteria 745
305 Ga0373942_0200443 3300035207 Bacteria 662
306 Ga0373961_0009548 3300035241 Bacteria 2376
307 Ga0373931_0231111 3300035691 Bacteria 1117
308 Ga0373935_0110772 3300035692 Bacteria 1822
309 Ga0373935_0139897 3300035692 Bacteria 1634
310 Ga0373935_0668325 3300035692 Bacteria 763
311 Ga0373927_0029148 3300035695 Bacteria 3597
312 Ga0373927_0178742 3300035695 Bacteria 1392
313 Ga0373933_0003736 3300035724 Bacteria 8414
314 Ga0373933_0256990 3300035724 Bacteria 1126
315 Ga0373937_0341588 3300036401 Bacteria 1418
316 Ga0373937_0517363 3300036401 Bacteria 1134
317 Ga0373937_0704908 3300036401 Bacteria 956
318 Ga0316582_0054521 3300036647 Bacteria 2545
319 Ga0373925_0174511 3300037068 Bacteria 1698
320 Ga0373925_0680302 3300037068 Bacteria 848
321 Ga0316581_0187346 3300037588 Unclassified 637
322 Ga0436363_0236621 3300039450 Bacteria 506
323 Ga0439453_0001914 3300041408 Bacteria 2777
324 Ga0439461_0158578 3300041410 Bacteria 588
325 Ga0451807_2537483 3300041486 Bacteria 857
326 Ga0451849_0645356 3300041505 Unclassified 656
327 Ga0451853_2606559 3300041512 Bacteria 629
328 Ga0439437_064122 3300042000 Bacteria 502
329 Ga0439441_002004 3300042001 Bacteria 2801
330 Ga0439443_000464 3300042003 Bacteria 3586
331 Ga0439443_012076 3300042003 Bacteria 1274
332 Ga0450923_141747 3300042125 Bacteria 578
333 Ga0450910_089885 3300042147 Unclassified 543
334 Ga0439435_0064218 3300042436 Unclassified 1075
335 Ga0439460_0004610 3300042461 Bacteria 3364
336 Ga0453683_0697213 3300044673 Bacteria 665
337 Ga0466964_0028934 3300044706 Bacteria 2185
338 Ga0466957_0540208 3300044842 Unclassified 811
339 Ga0451576_0069149 3300045051 Bacteria 3674
340 Ga0451576_0198376 3300045051 Bacteria 2096
341 Ga0451576_0288554 3300045051 Bacteria 1715
342 Ga0451576_0710808 3300045051 Unclassified 1056
343 Ga0451576_1197790 3300045051 Bacteria 793
344 Ga0451576_1833564 3300045051 Bacteria 627
345 Ga0466967_0003164 3300045976 Bacteria 10613
346 Ga0466967_2117239 3300045976 Bacteria 559
347 Ga0495592_0045943 3300046454 Bacteria 3256
348 Ga0495592_0405928 3300046454 Bacteria 862
349 Ga0495592_0565568 3300046454 Bacteria 697
350 Ga0495603_0336832 3300046455 Bacteria 866
351 Ga0495629_0110767 3300046459 Bacteria 1914
352 Ga0495653_0465610 3300046463 Bacteria 793
353 Ga0495662_0056406 3300046476 Bacteria 1897
354 Ga0495584_0315894 3300046491 Bacteria 793
355 Ga0495607_0169473 3300046501 Bacteria 1104
356 Ga0495608_0431697 3300046511 Bacteria 803
357 Ga0495628_0271234 3300046516 Bacteria 1262
358 Ga0495630_0016003 3300046517 Bacteria 5481
359 Ga0495630_0333778 3300046517 Bacteria 1160
360 Ga0495644_0121730 3300046523 Bacteria 993
361 Ga0495663_0109340 3300046525 Bacteria 917
362 Ga0495666_0101529 3300046526 Bacteria 1355
363 Ga0495642_0100784 3300046528 Bacteria 1229
364 Ga0495640_0062836 3300046533 Bacteria 2517
365 Ga0495586_0068324 3300046535 Bacteria 1938
366 Ga0495621_0017417 3300046539 Bacteria 2323
367 Ga0495621_0020190 3300046539 Bacteria 2184
368 Ga0495621_0162883 3300046539 Bacteria 883
369 Ga0495621_0187427 3300046539 Unclassified 828
370 Ga0495667_0195346 3300046559 Bacteria 1296
371 Ga0495656_0032257 3300046615 Bacteria 2130
372 Ga0495635_0443779 3300046663 Bacteria 858
373 Ga0495657_0349284 3300046675 Bacteria 875
374 Ga0495623_0194214 3300046679 Bacteria 1171
375 Ga0495646_0270206 3300046680 Bacteria 906
376 Ga0495658_0097494 3300046683 Bacteria 1750
377 Ga0495624_0174368 3300046690 Bacteria 1311
378 Ga0495670_0436240 3300046691 Bacteria 709
379 Ga0495600_0890069 3300046809 Bacteria 526
380 Ga0495581_0161604 3300047315 Bacteria 1309
381 Ga0495604_0122949 3300047317 Bacteria 1876
382 Ga0495604_0294116 3300047317 Bacteria 1093
383 Ga0495674_0054144 3300047319 Bacteria 3525
384 Ga0495680_0155061 3300047322 Bacteria 1667
385 Ga0495680_0470342 3300047322 Bacteria 857
386 Ga0495675_0479373 3300047444 Bacteria 717
387 Ga0495593_0079805 3300047673 Bacteria 1694
388 Ga0495593_0247608 3300047673 Bacteria 892
389 Ga0495615_0139030 3300048090 Bacteria 715
390 Ga0501291_119089 3300049514 Bacteria 571
391 Ga0501293_028275 3300049516 Bacteria 587
392 Ga0501297_063435 3300049520 Bacteria 569
393 Ga0501298_013254 3300049521 Bacteria 1457
394 Ga0501298_028844 3300049521 Bacteria 1079
395 Ga0501299_087803 3300049522 Bacteria 702
396 Ga0501031_0104863 3300049568 Bacteria 1845
397 Ga0501032_0269015 3300049569 Bacteria 1104
398 Ga0501032_1035357 3300049569 Bacteria 515
399 Ga0501033_0004124 3300049570 Bacteria 11709
400 Ga0501036_0037040 3300049572 Bacteria 4126
401 Ga0501037_0008169 3300049573 Bacteria 7674
402 Ga0501038_0016787 3300049574 Bacteria 6628
403 Ga0501038_0229248 3300049574 Bacteria 1479
404 Ga0501039_0007950 3300049575 Bacteria 8074
405 Ga0501040_0006426 3300049576 Bacteria 7633
406 Ga0501040_0008518 3300049576 Bacteria 6656
407 Ga0501041_0001221 3300049577 Bacteria 14077
408 Ga0501041_0023209 3300049577 Bacteria 3720
409 Ga0501042_0003637 3300049578 Bacteria 9722
410 Ga0501042_0247625 3300049578 Unclassified 1286
411 Ga0501042_0262070 3300049578 Unclassified 1248
412 Ga0501042_0834269 3300049578 Bacteria 671
413 Ga0501043_0012127 3300049579 Bacteria 6738
414 Ga0501043_0528270 3300049579 Bacteria 879
415 Ga0501046_0008102 3300049580 Bacteria 9181
416 Ga0501046_0140856 3300049580 Bacteria 1825
417 Ga0501047_0604017 3300049581 Bacteria 918
418 Ga0501048_0005660 3300049582 Bacteria 9507
419 Ga0501048_0223671 3300049582 Bacteria 1335
420 Ga0501048_0779660 3300049582 Unclassified 687
421 Ga0501067_0091959 3300049583 Bacteria 1684
422 Ga0501068_0020620 3300049584 Bacteria 3842
423 Ga0501068_0514597 3300049584 Bacteria 777
424 Ga0501069_0089420 3300049585 Bacteria 1741
425 Ga0501069_0121315 3300049585 Bacteria 1493
426 Ga0501070_0025511 3300049586 Bacteria 4958
427 Ga0501070_0450525 3300049586 Bacteria 1038
428 Ga0501071_0022643 3300049587 Bacteria 4381
429 Ga0501071_0979611 3300049587 Bacteria 653
430 Ga0501071_1327230 3300049587 Bacteria 556
431 Ga0501071_1542973 3300049587 Unclassified 513
432 Ga0501072_0015376 3300049588 Bacteria 5868
433 Ga0501072_0456091 3300049588 Bacteria 1012
434 Ga0501073_0027375 3300049589 Bacteria 4077
435 Ga0501073_0152758 3300049589 Bacteria 1600
436 Ga0501074_0013245 3300049590 Bacteria 5996
437 Ga0501075_0001827 3300049591 Bacteria 14031
438 Ga0501076_0045813 3300049592 Bacteria 3453
439 Ga0501077_0002508 3300049593 Bacteria 10992
440 Ga0501209_101549 3300049656 Bacteria 844
441 Ga0501217_044978 3300049661 Bacteria 1136
442 Ga0501227_145688 3300049665 Bacteria 652
443 Ga0501233_147944 3300049668 Bacteria 653
444 Ga0501257_180087 3300049686 Unclassified 598
445 Ga0501225_0085352 3300049705 Bacteria 910
446 Ga0501225_0113442 3300049705 Bacteria 801
447 Ga0501245_160734 3300049708 Bacteria 503
448 Ga0501079_0007085 3300049741 Bacteria 8460
449 Ga0501079_0695921 3300049741 Unclassified 800
450 Ga0501080_0009662 3300049742 Bacteria 8809
451 Ga0501080_0180053 3300049742 Bacteria 1946
452 Ga0501080_0382415 3300049742 Bacteria 1268
453 Ga0501080_0856014 3300049742 Bacteria 795
454 Ga0501080_1738491 3300049742 Bacteria 525
455 Ga0501080_1861890 3300049742 Bacteria 504
456 Ga0501081_0005318 3300049743 Bacteria 8303
457 Ga0501081_1565255 3300049743 Unclassified 501
458 Ga0501083_0276701 3300049744 Bacteria 1092
459 Ga0501272_027062 3300049769 Bacteria 714
460 Ga0501279_065785 3300049775 Unclassified 601
461 Ga0501035_0013223 3300049822 Bacteria 7617
462 Ga0501035_0270353 3300049822 Unclassified 1439
463 Ga0501044_0601777 3300049823 Bacteria 992
464 Ga0501045_0005346 3300049824 Bacteria 8896
465 Ga0501045_0548605 3300049824 Bacteria 857
466 nmdc:mga05p37_1069854_c1 3300050507 Bacteria 848
467 nmdc:mga05p37_1126124_c1 3300050507 Unclassified 819
468 nmdc:mga05p37_1306573_c1 3300050507 Unclassified 739
469 nmdc:mga05p37_1349975_c1 3300050507 Bacteria 722
470 nmdc:mga05p37_244181_c1 3300050507 Bacteria 2157
471 nmdc:mga05p37_531594_c1 3300050507 Unclassified 1343
472 nmdc:mga09592_266218_c1 3300050508 Unclassified 1487
473 nmdc:mga09592_397889_c1 3300050508 Unclassified 1191
474 nmdc:mga09592_458125_c1 3300050508 Bacteria 1100
475 nmdc:mga09592_77044_c1 3300050508 Bacteria 2836
476 nmdc:mga0qj67_120778_c1 3300050509 Bacteria 2120
477 nmdc:mga0qj67_227481_c1 3300050509 Bacteria 1514
478 nmdc:mga0qj67_2437_c1 3300050509 Bacteria 13248
479 nmdc:mga0qj67_474335_c1 3300050509 Bacteria 1007
480 nmdc:mga0qj67_49436_c1 3300050509 Bacteria 3324
481 nmdc:mga0qj67_572826_c1 3300050509 Bacteria 905
482 nmdc:mga0qj67_631251_c1 3300050509 Bacteria 855
483 nmdc:mga0qj67_8037_c1 3300050509 Bacteria 7804
484 nmdc:mga06r32_1277151_c1 3300050510 Bacteria 679
485 nmdc:mga06r32_139807_c1 3300050510 Bacteria 2397
486 nmdc:mga06r32_149123_c1 3300050510 Bacteria 2317
487 nmdc:mga06r32_302768_c1 3300050510 Unclassified 1585
488 nmdc:mga06r32_5201_c1 3300050510 Bacteria 11693
489 nmdc:mga06r32_573110_c1 3300050510 Bacteria 1101
490 nmdc:mga08y16_1106550_c1 3300050511 Bacteria 767
491 nmdc:mga08y16_124828_c1 3300050511 Bacteria 2678
492 nmdc:mga08y16_284335_c1 3300050511 Bacteria 1706
493 nmdc:mga08y16_35675_c1 3300050511 Bacteria 5223
494 nmdc:mga08y16_401065_c1 3300050511 Unclassified 1404
495 nmdc:mga0n895_469446_c1 3300050512 Bacteria 1269
496 nmdc:mga0n895_737432_c1 3300050512 Bacteria 979
497 nmdc:mga0rr50_144512_c1 3300050513 Bacteria 1916
498 nmdc:mga0rr50_156456_c1 3300050513 Bacteria 1847
499 nmdc:mga0rr50_22883_c1 3300050513 Bacteria 4298
500 nmdc:mga08x19_1254_c1 3300050514 Bacteria 15744
501 nmdc:mga08x19_266948_c1 3300050514 Bacteria 1184
502 nmdc:mga08x19_303_c1 3300050514 Bacteria 35609
503 nmdc:mga08x19_382989_c1 3300050514 Bacteria 985
504 nmdc:mga08x19_792203_c1 3300050514 Bacteria 673
505 nmdc:mga08x19_93085_c1 3300050514 Bacteria 1992
506 nmdc:mga0a205_258306_c1 3300050515 Bacteria 1620
507 nmdc:mga0a205_348727_c1 3300050515 Bacteria 1348
508 nmdc:mga0a205_53483_c1 3300050515 Bacteria 3897
509 Ga0495612_0518737 3300053078 Bacteria 547
510 Ga0501084_0009272 3300054114 Bacteria 8141
511 Ga0501084_0670384 3300054114 Bacteria 875
512 Ga0590071_068022 3300059421 Bacteria 876
513 Ga0590071_189067 3300059421 Bacteria 541
514 Ga0590074_063776 3300059423 Bacteria 688
515 Ga0590077_078470 3300059426 Bacteria 759
516 Ga0501082_0020538 3300060353 Bacteria 5692
517 Ga0530510_0001351 3300061734 Bacteria 16409
518 Ga0157380_11349156
519 rootH1_10269420
520 Ga0065707_10263762
521 Ga0070683_100202497
522 Ga0070690_100118807
523 Ga0070690_100309668
524 Ga0070690_100598087
525 Ga0068869_100033387
526 Ga0068869_101541437
527 Ga0070680_100099503
528 Ga0070680_100175894
529 Ga0070680_101096488
530 Ga0070689_100032819
531 Ga0070689_100067322
532 Ga0070689_100254454
533 Ga0070687_100095451
534 Ga0070687_100399386
535 Ga0070687_100480795
536 Ga0070687_100996108
537 Ga0070692_10029573
538 Ga0070692_10112770
539 Ga0070668_100123244
540 Ga0070669_100028912
541 Ga0070669_100343729
542 Ga0070675_100116969
543 Ga0070675_102056055
544 Ga0070674_100323866
545 Ga0070673_100212073
546 Ga0070673_100313191
547 Ga0070673_101270554
548 Ga0070688_100076589
549 Ga0070688_101206376
550 Ga0070667_101184776
551 Ga0070714_100057763
552 Ga0070701_10299040
553 Ga0070705_100004915
554 Ga0070705_100447045
555 Ga0070700_100047346
556 Ga0070700_100179923
557 Ga0070700_100211897
558 Ga0070700_100245015
559 Ga0070700_100408705
560 Ga0070694_100025193
561 Ga0070694_100032664
562 Ga0070694_100214283
563 Ga0070694_100239617
564 Ga0070694_100903298
565 Ga0070708_100319638
566 Ga0070708_101785226
567 Ga0070678_100621752
568 Ga0070662_101174850
569 Ga0068867_100000699
570 Ga0068867_100716910
571 Ga0068867_101056045
572 Ga0070685_10230002
573 Ga0070706_100040437
574 Ga0070706_100737123
575 Ga0070707_100123470
576 Ga0070707_100458873
577 Ga0070707_100524080
578 Ga0070699_100007598
579 Ga0070699_100027831
580 Ga0070679_101314318
581 Ga0070684_100059727
582 Ga0070697_100040929
583 Ga0070697_100822955
584 Ga0070697_101275773
585 Ga0070686_100293904
586 Ga0070686_100966125
587 Ga0070695_100001179
588 Ga0070695_100097537
589 Ga0070695_100157713
590 Ga0070695_100324105
591 Ga0070696_100001672
592 Ga0070696_100092111
593 Ga0070696_100196155
594 Ga0070696_100348720
595 Ga0070696_100453245
596 Ga0070696_100762459
597 Ga0070704_100115664
598 Ga0070704_100241040
599 Ga0070704_101291202
600 Ga0068856_100500578
601 Ga0070702_100017482
602 Ga0070702_101010123
603 Ga0068859_100782992
604 Ga0068866_10190943
605 Ga0068861_100003377
606 Ga0068861_100262391
607 Ga0068861_100442188
608 Ga0068861_101018379
609 Ga0068861_101729184
610 Ga0068870_10055763
611 Ga0068858_102021658
612 Ga0068860_102768028
613 Ga0068862_100006699
614 Ga0068862_100051284
615 Ga0068862_102386681
616 Ga0075364_10666451
617 Ga0070715_10026278
618 Ga0070715_10070851
619 Ga0070716_100024451
620 Ga0097621_100009592
621 Ga0097621_101907983
622 Ga0068871_100004668
623 Ga0068871_101297642
624 Ga0075428_100095349
625 Ga0075428_100277783
626 Ga0075430_100003294
627 Ga0075430_100018269
628 Ga0075430_100053434
629 Ga0075430_100282804
630 Ga0075430_100378400
631 Ga0075430_100899091
632 Ga0075431_100048739
633 Ga0075431_100082538
634 Ga0075431_100101937
635 Ga0075431_100316157
636 Ga0075431_100464614
637 Ga0075431_101511734
638 Ga0075431_101901581
639 Ga0075433_10132171
640 Ga0075433_10674471
641 Ga0075434_100068233
642 Ga0075434_100422254
643 Ga0075434_100543144
644 Ga0075434_101637795
645 Ga0075434_102285789
646 Ga0075429_100074538
647 Ga0075429_100094803
648 Ga0075429_100321466
649 Ga0075429_100365965
650 Ga0068865_100121718
651 Ga0068865_100553868
652 Ga0068865_100757961
653 Ga0075436_100004918
654 Ga0075436_100016711
655 Ga0075436_100079149
656 Ga0075436_100460904
657 Ga0075436_100938311
658 Ga0097620_100782868
659 Ga0075435_100028033
660 Ga0075435_100072703
661 Ga0075435_100290629
662 Ga0075435_100406814
663 Ga0099794_10024417
664 Ga0099794_10408446
665 Ga0111539_10042981
666 Ga0111539_10395447
667 Ga0111539_10458600
668 Ga0111539_10561630
669 Ga0111539_11898450
670 Ga0114129_10017705
671 Ga0114129_10052708
672 Ga0114129_11075634
673 Ga0114129_11133627
674 Ga0114129_12109652
675 Ga0114129_13173703
676 Ga0105243_10005794
677 Ga0105243_11501647
678 Ga0105242_10549677
679 Ga0105242_10746677
680 Ga0105242_11778217
681 Ga0105242_12204814
682 Ga0105248_11464920
683 Ga0105238_13030499
684 Ga0105249_10231279
685 Ga0157369_11690010
686 Ga0157372_12327007
687 Ga0157375_11279412
688 Ga0157375_12144782
689 Ga0157380_10017620
690 Ga0157380_10590212
691 Ga0157380_11512794
692 Ga0157377_10106085
693 Ga0157377_11449279
694 Ga0157376_10720780
695 Ga0157376_11171503
696 Ga0207653_10261317
697 Ga0207642_10497477
698 Ga0207699_10498938
699 Ga0207645_10288563
700 Ga0207643_10169770
701 Ga0207707_10033537
702 Ga0207707_10669037
703 Ga0207660_10085216
704 Ga0207660_10197887
705 Ga0207660_10873576
706 Ga0207662_10137642
707 Ga0207662_10410146
708 Ga0207662_10699439
709 Ga0207662_11000301
710 Ga0207652_11427989
711 Ga0207646_10155652
712 Ga0207646_11598301
713 Ga0207681_10017771
714 Ga0207681_10812174
715 Ga0207694_10968089
716 Ga0207659_10091676
717 Ga0207664_10844059
718 Ga0207706_10889549
719 Ga0207686_10810592
720 Ga0207686_11221817
721 Ga0207709_10000934
722 Ga0207709_10566173
723 Ga0207670_10043255
724 Ga0207670_10225028
725 Ga0207669_10519683
726 Ga0207704_10002850
727 Ga0207704_11145143
728 Ga0207704_11183659
729 Ga0207665_10010514
730 Ga0207691_10250997
731 Ga0207661_10141897
732 Ga0207651_10412277
733 Ga0207651_10503696
734 Ga0207651_11378320
735 Ga0207712_10002777
736 Ga0207668_10307610
737 Ga0207658_10656076
738 Ga0207708_10051968
739 Ga0207708_10176700
740 Ga0207708_10278010
741 Ga0207708_10920406
742 Ga0207708_11976088
743 Ga0207702_10555164
744 Ga0207648_10002925
745 Ga0207648_10729563
746 Ga0207674_10112611
747 Ga0207675_100022509
748 Ga0207675_100237872
749 Ga0207675_100503892
750 Ga0207675_100857277
751 Ga0209969_1046905
752 Ga0209967_1021663
753 Ga0209967_1065475
754 Ga0209981_1007358
755 Ga0209996_1010022
756 Ga0209996_1020765
757 Ga0210000_1001370
758 Ga0210000_1002070
759 Ga0209995_1008706
760 Ga0209995_1067217
761 Ga0209968_1002882
762 Ga0209968_1012932
763 Ga0209999_1003113
764 Ga0209999_1013190
765 Ga0209982_1069653
766 Ga0209970_1004988
767 Ga0209983_1102290
768 Ga0209971_1004213
769 Ga0209971_1027721
770 Ga0209966_1002908
771 Ga0209966_1057143
772 Ga0209974_10060112
773 Ga0207428_10042033
774 Ga0207428_10070549
775 Ga0207428_10209108
776 Ga0207428_10209264
777 Ga0268265_10004917
778 Ga0268265_10058562
779 Ga0268264_11904279
780 Ga0265331_10119717
781 Ga0307408_101055691
782 Ga0307408_101927759
783 Ga0316575_10131649
784 Ga0316579_10013700
785 Ga0316578_10236006
786 Ga0307405_10914164
787 Ga0307406_11800040
788 Ga0307412_10372719
789 Ga0307412_10592175
790 Ga0307412_11130009
791 Ga0307409_100124666
792 Ga0307416_100026297
793 Ga0307416_100744471
794 Ga0307416_100963048
795 Ga0307416_101750604
796 Ga0307416_102038245
797 Ga0307411_10234137
798 Ga0307411_10681605
799 Ga0307411_11401994
800 Ga0307415_100486268
801 Ga0316583_10031101
802 Ga0373940_0351396
803 Ga0373944_0123315
804 Ga0373949_0235076
805 Ga0373923_0111424
806 Ga0373923_0265729
807 Ga0373932_0093093
808 Ga0373936_0028956
809 Ga0373939_0032057
810 Ga0373939_0307203
811 Ga0373953_0043262
812 Ga0373954_0292469
813 Ga0373956_0021188
814 Ga0373957_0068870
815 Ga0373960_0004628
816 Ga0373960_0098437
817 Ga0373943_0406970
818 Ga0373946_0385152
819 Ga0373946_0487175
820 Ga0373955_0038012
821 Ga0373955_0497039
822 Ga0373942_0200443
823 Ga0373961_0009548
824 Ga0373931_0231111
825 Ga0373935_0110772
826 Ga0373935_0139897
827 Ga0373935_0668325
828 Ga0373927_0029148
829 Ga0373927_0178742
830 Ga0373933_0003736
831 Ga0373933_0256990
832 Ga0373937_0341588
833 Ga0373937_0517363
834 Ga0373937_0704908
835 Ga0316582_0054521
836 Ga0373925_0174511
837 Ga0373925_0680302
838 Ga0316581_0187346
839 Ga0436363_0236621
840 Ga0439453_0001914
841 Ga0439461_0158578
842 Ga0451807_2537483
843 Ga0451849_0645356
844 Ga0451853_2606559
845 Ga0439437_064122
846 Ga0439441_002004
847 Ga0439443_000464
848 Ga0439443_012076
849 Ga0450923_141747
850 Ga0450910_089885
851 Ga0439435_0064218
852 Ga0439460_0004610
853 Ga0453683_0697213
854 Ga0466964_0028934
855 Ga0466957_0540208
856 Ga0451576_0069149
857 Ga0451576_0198376
858 Ga0451576_0288554
859 Ga0451576_0710808
860 Ga0451576_1197790
861 Ga0451576_1833564
862 Ga0466967_0003164
863 Ga0466967_2117239
864 Ga0495592_0045943
865 Ga0495592_0405928
866 Ga0495592_0565568
867 Ga0495603_0336832
868 Ga0495629_0110767
869 Ga0495653_0465610
870 Ga0495662_0056406
871 Ga0495584_0315894
872 Ga0495607_0169473
873 Ga0495608_0431697
874 Ga0495628_0271234
875 Ga0495630_0016003
876 Ga0495630_0333778
877 Ga0495644_0121730
878 Ga0495663_0109340
879 Ga0495666_0101529
880 Ga0495642_0100784
881 Ga0495640_0062836
882 Ga0495586_0068324
883 Ga0495621_0017417
884 Ga0495621_0020190
885 Ga0495621_0162883
886 Ga0495621_0187427
887 Ga0495667_0195346
888 Ga0495656_0032257
889 Ga0495635_0443779
890 Ga0495657_0349284
891 Ga0495623_0194214
892 Ga0495646_0270206
893 Ga0495658_0097494
894 Ga0495624_0174368
895 Ga0495670_0436240
896 Ga0495600_0890069
897 Ga0495581_0161604
898 Ga0495604_0122949
899 Ga0495604_0294116
900 Ga0495674_0054144
901 Ga0495680_0155061
902 Ga0495680_0470342
903 Ga0495675_0479373
904 Ga0495593_0079805
905 Ga0495593_0247608
906 Ga0495615_0139030
907 Ga0501291_119089
908 Ga0501293_028275
909 Ga0501297_063435
910 Ga0501298_013254
911 Ga0501298_028844
912 Ga0501299_087803
913 Ga0501031_0104863
914 Ga0501032_0269015
915 Ga0501032_1035357
916 Ga0501033_0004124
917 Ga0501036_0037040
918 Ga0501037_0008169
919 Ga0501038_0016787
920 Ga0501038_0229248
921 Ga0501039_0007950
922 Ga0501040_0006426
923 Ga0501040_0008518
924 Ga0501041_0001221
925 Ga0501041_0023209
926 Ga0501042_0003637
927 Ga0501042_0247625
928 Ga0501042_0262070
929 Ga0501042_0834269
930 Ga0501043_0012127
931 Ga0501043_0528270
932 Ga0501046_0008102
933 Ga0501046_0140856
934 Ga0501047_0604017
935 Ga0501048_0005660
936 Ga0501048_0223671
937 Ga0501048_0779660
938 Ga0501067_0091959
939 Ga0501068_0020620
940 Ga0501068_0514597
941 Ga0501069_0089420
942 Ga0501069_0121315
943 Ga0501070_0025511
944 Ga0501070_0450525
945 Ga0501071_0022643
946 Ga0501071_0979611
947 Ga0501071_1327230
948 Ga0501071_1542973
949 Ga0501072_0015376
950 Ga0501072_0456091
951 Ga0501073_0027375
952 Ga0501073_0152758
953 Ga0501074_0013245
954 Ga0501075_0001827
955 Ga0501076_0045813
956 Ga0501077_0002508
957 Ga0501209_101549
958 Ga0501217_044978
959 Ga0501227_145688
960 Ga0501233_147944
961 Ga0501257_180087
962 Ga0501225_0085352
963 Ga0501225_0113442
964 Ga0501245_160734
965 Ga0501079_0007085
966 Ga0501079_0695921
967 Ga0501080_0009662
968 Ga0501080_0180053
969 Ga0501080_0382415
970 Ga0501080_0856014
971 Ga0501080_1738491
972 Ga0501080_1861890
973 Ga0501081_0005318
974 Ga0501081_1565255
975 Ga0501083_0276701
976 Ga0501272_027062
977 Ga0501279_065785
978 Ga0501035_0013223
979 Ga0501035_0270353
980 Ga0501044_0601777
981 Ga0501045_0005346
982 Ga0501045_0548605
983 nmdc:mga05p37_1069854_c1
984 nmdc:mga05p37_1126124_c1
985 nmdc:mga05p37_1306573_c1
986 nmdc:mga05p37_1349975_c1
987 nmdc:mga05p37_244181_c1
988 nmdc:mga05p37_531594_c1
989 nmdc:mga09592_266218_c1
990 nmdc:mga09592_397889_c1
991 nmdc:mga09592_458125_c1
992 nmdc:mga09592_77044_c1
993 nmdc:mga0qj67_120778_c1
994 nmdc:mga0qj67_227481_c1
995 nmdc:mga0qj67_2437_c1
996 nmdc:mga0qj67_474335_c1
997 nmdc:mga0qj67_49436_c1
998 nmdc:mga0qj67_572826_c1
999 nmdc:mga0qj67_631251_c1
1000 nmdc:mga0qj67_8037_c1
1001 nmdc:mga06r32_1277151_c1
1002 nmdc:mga06r32_139807_c1
1003 nmdc:mga06r32_149123_c1
1004 nmdc:mga06r32_302768_c1
1005 nmdc:mga06r32_5201_c1
1006 nmdc:mga06r32_573110_c1
1007 nmdc:mga08y16_1106550_c1
1008 nmdc:mga08y16_124828_c1
1009 nmdc:mga08y16_284335_c1
1010 nmdc:mga08y16_35675_c1
1011 nmdc:mga08y16_401065_c1
1012 nmdc:mga0n895_469446_c1
1013 nmdc:mga0n895_737432_c1
1014 nmdc:mga0rr50_144512_c1
1015 nmdc:mga0rr50_156456_c1
1016 nmdc:mga0rr50_22883_c1
1017 nmdc:mga08x19_1254_c1
1018 nmdc:mga08x19_266948_c1
1019 nmdc:mga08x19_303_c1
1020 nmdc:mga08x19_382989_c1
1021 nmdc:mga08x19_792203_c1
1022 nmdc:mga08x19_93085_c1
1023 nmdc:mga0a205_258306_c1
1024 nmdc:mga0a205_348727_c1
1025 nmdc:mga0a205_53483_c1
1026 Ga0495612_0518737
1027 Ga0501084_0009272
1028 Ga0501084_0670384
1029 Ga0590071_068022
1030 Ga0590071_189067
1031 Ga0590074_063776
1032 Ga0590077_078470
1033 Ga0501082_0020538
1034 Ga0530510_0001351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01627

Hpt

Hpt domain

31

114

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oxk-assembly1.cif.gz_A complex between ypd1 and sln1 response regulator domain in space group p3(2) 0.9225 15 76
1c02-assembly1.cif.gz_B crystal structure of yeast ypd1p 0.9202 15 76
1c03-assembly4.cif.gz_D crystal structure of ypd1p (triclinic form) 0.9192 15 76
1yvi-assembly1.cif.gz_A x-ray structure of putative histidine-containing phosphotransfer protein from rice, ak104879 0.9089 16 94
4g78-assembly1.cif.gz_A subatomic resolution crystal structure of histidine-containing phosphotransfer protein mthpt2 from medicago truncatula 0.8992 14 94
ID Description Score Start End Superfamily
af_I1MCF1_5_152_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.926 14 94 1.20.120.160
af_I1L801_1_152_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.9208 14 94 1.20.120.160
af_Q9ZNV8_1_156_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.916 14 94 1.20.120.160
af_K7MYI1_1_131_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.9133 14 94 1.20.120.160
2q4fA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.908 14 94 1.20.120.160
ID Description Score Start End GO Terms
AF-A0A537EEN1-F1-model_v4 Hpt domain-containing protein 0.9981 1 101 GO:0000160
GO:0004672
AF-A0A1F3U188-F1-model_v4 HPt domain-containing protein 0.998 10 94 GO:0000160
AF-A0A847QKF3-F1-model_v4 Hpt domain-containing protein 0.994 7 101 GO:0000160
AF-A0A521XQT9-F1-model_v4 Hpt domain-containing protein 0.9932 7 101 GO:0000160
GO:0004672
AF-A0A536WBB1-F1-model_v4 Hpt domain-containing protein 0.9929 7 101 GO:0000160
GO:0004672

Map