F458086

General Info

Members Datasets Scaffolds Average Seq Length
517 271 504 132

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10006960|JGI24737J22298_100069604
Length 154
Sequence MQLGKYIFIKIEVLSKLIMNKSNRRKFIATSASLAIGTATASAIPLVVTENKYPIVHHVFFWLKNPDSKEDRDKLVAGVKTLAKIETVRELRVGIVADTEKRDVVDKSWAVSELMFFSDLKGQAAYQNHPVHLEFIKNCSYLWEKVIVYDAVDA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2738541284 Pedobacter sp. YR016 Isolate Unclassified
4 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
5 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
6 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
7 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
8 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
9 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
10 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
11 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
12 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
13 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
14 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
118 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
188 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
189 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
198 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
225 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
226 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
227 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
228 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
229 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
238 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
239 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
240 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
248 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
249 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
254 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
258 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
259 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
260 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
261 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
262 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
263 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
264 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
267 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
268 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 0.39
Isolates 2.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.61
Nodule 0
Rhizoplane 1.16
Rhizosphere 86.27
Stem 0
Stem Tuber 0
Unclassified 6.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2741210 2162886007 Bacteria 17720
2 SwRhRL2b_contig_798958 2162886007 Bacteria 1734
3 JGI24740J21852_10003411 3300001979 Bacteria 6992
4 JGI24739J22299_10005079 3300001989 Bacteria 5012
5 JGI24737J22298_10006960 3300001990 Bacteria 3834
6 JGI25162J39368_1000213 3300002737 Bacteria 60963
7 JGI25162J39368_1006400 3300002737 Bacteria 2043
8 JGI25164J39214_1002448 3300002772 Bacteria 2840
9 JGI25165J46597_1000986 3300003214 Bacteria 19072
10 rootH1_10014099 3300003316 Bacteria 20359
11 rootH2_10001334 3300003320 Bacteria 238709
12 rootH2_10005669 3300003320 Bacteria 4952
13 rootH2_10043027 3300003320 Unclassified 1183
14 rootH1_10019846 3300003323 Bacteria 13232
15 rootH1_10034967 3300003323 Bacteria 11967
16 rootH1_10102515 3300003323 Bacteria 8322
17 rootH1_10151014 3300003323 Bacteria 1166
18 rootH1_10171706 3300003323 Bacteria 12863
19 rootH1_10212301 3300003323 Bacteria 2514
20 JGI25160J50197_1023237 3300003354 Bacteria 1795
21 Ga0065714_10004780 3300005288 Bacteria 13537
22 Ga0065714_10067106 3300005288 Bacteria 5881
23 Ga0065714_10067656 3300005288 Bacteria 5303
24 Ga0065704_10000206 3300005289 Bacteria 121672
25 Ga0065704_10082026 3300005289 Bacteria 3635
26 Ga0065704_10091660 3300005289 Bacteria 2702
27 Ga0070658_11130154 3300005327 Bacteria 681
28 Ga0070676_10000038 3300005328 Bacteria 39143
29 Ga0070676_10212667 3300005328 Bacteria 1273
30 Ga0070670_101110436 3300005331 Bacteria 721
31 Ga0070677_10007101 3300005333 Bacteria 3731
32 Ga0070677_10092885 3300005333 Bacteria 1316
33 Ga0070677_10157921 3300005333 Unclassified 1061
34 Ga0068869_100051735 3300005334 Bacteria 2980
35 Ga0068869_100175713 3300005334 Bacteria 1676
36 Ga0068869_100346440 3300005334 Bacteria 1210
37 Ga0068869_100464147 3300005334 Unclassified 1052
38 Ga0070680_101218890 3300005336 Bacteria 651
39 Ga0070682_100118083 3300005337 Bacteria 1777
40 Ga0070682_100198868 3300005337 Unclassified 1412
41 Ga0070682_100207926 3300005337 Bacteria 1385
42 Ga0068868_100022783 3300005338 Bacteria 4733
43 Ga0068868_100060510 3300005338 Unclassified 2999
44 Ga0068868_100870631 3300005338 Unclassified 817
45 Ga0068868_101386968 3300005338 Unclassified 655
46 Ga0070660_100716893 3300005339 Bacteria 839
47 Ga0070660_101208148 3300005339 Bacteria 641
48 Ga0070689_100001360 3300005340 Bacteria 15529
49 Ga0070689_100445702 3300005340 Bacteria 1101
50 Ga0070689_101694797 3300005340 Unclassified 575
51 Ga0070687_101521254 3300005343 Bacteria 504
52 Ga0070692_10579952 3300005345 Bacteria 739
53 Ga0070668_101086250 3300005347 Unclassified 722
54 Ga0070675_100033580 3300005354 Bacteria 4161
55 Ga0070675_100076729 3300005354 Bacteria 2780
56 Ga0070671_101448791 3300005355 Unclassified 607
57 Ga0070674_101391646 3300005356 Bacteria 628
58 Ga0070673_100005489 3300005364 Bacteria 8121
59 Ga0070673_100013174 3300005364 Bacteria 5707
60 Ga0070673_100107792 3300005364 Bacteria 2305
61 Ga0070673_100472041 3300005364 Bacteria 1131
62 Ga0070673_101203367 3300005364 Unclassified 710
63 Ga0070688_100170337 3300005365 Bacteria 1502
64 Ga0070659_100058210 3300005366 Bacteria 3049
65 Ga0070659_100225065 3300005366 Bacteria 1549
66 Ga0070659_100290725 3300005366 Bacteria 1361
67 Ga0070667_100285449 3300005367 Bacteria 1483
68 Ga0070667_100478753 3300005367 Bacteria 1139
69 Ga0070667_100644843 3300005367 Unclassified 977
70 Ga0070701_10072716 3300005438 Bacteria 1842
71 Ga0070701_10289518 3300005438 Unclassified 1003
72 Ga0070705_100119788 3300005440 Unclassified 1697
73 Ga0070700_100012357 3300005441 Bacteria 4761
74 Ga0070700_100114145 3300005441 Bacteria 1801
75 Ga0070700_100129349 3300005441 Bacteria 1702
76 Ga0070694_100020137 3300005444 Bacteria 4250
77 Ga0070708_101402290 3300005445 Bacteria 652
78 Ga0070663_100244012 3300005455 Bacteria 1419
79 Ga0070663_100800200 3300005455 Bacteria 808
80 Ga0070663_101461329 3300005455 Unclassified 607
81 Ga0070678_100010849 3300005456 Bacteria 5588
82 Ga0070678_100158748 3300005456 Bacteria 1830
83 Ga0070662_100001815 3300005457 Bacteria 13127
84 Ga0070662_100239675 3300005457 Bacteria 1454
85 Ga0068867_100001131 3300005459 Bacteria 18214
86 Ga0068867_100196363 3300005459 Bacteria 1613
87 Ga0068867_101546372 3300005459 Unclassified 619
88 Ga0070685_10119570 3300005466 Bacteria 1634
89 Ga0070706_100761445 3300005467 Bacteria 897
90 Ga0070679_100123436 3300005530 Bacteria 2573
91 Ga0068853_100005741 3300005539 Bacteria 9769
92 Ga0068853_100014308 3300005539 Bacteria 6493
93 Ga0070672_100008364 3300005543 Bacteria 7074
94 Ga0070672_100014133 3300005543 Bacteria 5650
95 Ga0070672_100024627 3300005543 Bacteria 4452
96 Ga0070672_100562098 3300005543 Bacteria 991
97 Ga0070686_100012880 3300005544 Bacteria 4774
98 Ga0070686_100070339 3300005544 Bacteria 2288
99 Ga0070696_100512923 3300005546 Bacteria 956
100 Ga0070665_100000003 3300005548 Bacteria 811857
101 Ga0070665_100004183 3300005548 Bacteria 15181
102 Ga0070665_100045780 3300005548 Bacteria 4394
103 Ga0070665_101789179 3300005548 Unclassified 621
104 Ga0070704_100055524 3300005549 Bacteria 2809
105 Ga0068855_100093279 3300005563 Bacteria 3472
106 Ga0068857_100100807 3300005577 Bacteria 2591
107 Ga0068857_100575848 3300005577 Bacteria 1062
108 Ga0068857_100739033 3300005577 Bacteria 937
109 Ga0068854_100007939 3300005578 Bacteria 6794
110 Ga0068854_100337845 3300005578 Bacteria 1229
111 Ga0070702_100002604 3300005615 Bacteria 7851
112 Ga0070702_100473245 3300005615 Unclassified 914
113 Ga0070702_101047303 3300005615 Unclassified 649
114 Ga0068852_100003080 3300005616 Bacteria 11608
115 Ga0068852_102725898 3300005616 Bacteria 513
116 Ga0068859_100415133 3300005617 Bacteria 1442
117 Ga0068859_100471362 3300005617 Bacteria 1351
118 Ga0068859_101378952 3300005617 Bacteria 777
119 Ga0068864_100066841 3300005618 Bacteria 3121
120 Ga0068864_100269084 3300005618 Bacteria 1587
121 Ga0068866_10194968 3300005718 Bacteria 1206
122 Ga0068866_10703256 3300005718 Bacteria 693
123 Ga0068861_100001702 3300005719 Bacteria 14124
124 Ga0068861_100489280 3300005719 Unclassified 1110
125 Ga0068861_100578262 3300005719 Bacteria 1028
126 Ga0068861_100911922 3300005719 Bacteria 833
127 Ga0068851_10076139 3300005834 Bacteria 1745
128 Ga0068870_10199152 3300005840 Bacteria 1213
129 Ga0068870_10694401 3300005840 Bacteria 701
130 Ga0068863_100030783 3300005841 Bacteria 5125
131 Ga0068863_100031893 3300005841 Bacteria 5026
132 Ga0068863_100100494 3300005841 Bacteria 2749
133 Ga0068863_100126608 3300005841 Bacteria 2437
134 Ga0068863_100318144 3300005841 Bacteria 1511
135 Ga0068858_100573424 3300005842 Bacteria 1093
136 Ga0068860_100016428 3300005843 Bacteria 7217
137 Ga0068862_100192033 3300005844 Bacteria 1838
138 Ga0068862_100788459 3300005844 Bacteria 927
139 Ga0068862_101555768 3300005844 Unclassified 667
140 Ga0081455_10008486 3300005937 Bacteria 10677
141 Ga0081539_10045722 3300005985 Bacteria 2515
142 Ga0075366_10039629 3300006195 Bacteria 2785
143 Ga0097621_100000241 3300006237 Bacteria 36577
144 Ga0097621_100007161 3300006237 Bacteria 7952
145 Ga0097621_100249875 3300006237 Unclassified 1553
146 Ga0097621_100306216 3300006237 Bacteria 1404
147 Ga0097621_100546284 3300006237 Bacteria 1054
148 Ga0075370_10105063 3300006353 Bacteria 1637
149 Ga0068871_100000139 3300006358 Bacteria 46889
150 Ga0068871_100005168 3300006358 Bacteria 9126
151 Ga0068871_100095215 3300006358 Bacteria 2486
152 Ga0068871_100214621 3300006358 Bacteria 1665
153 Ga0068871_100302717 3300006358 Bacteria 1404
154 Ga0068865_100000022 3300006881 Bacteria 102976
155 Ga0068865_100095989 3300006881 Bacteria 2161
156 Ga0068865_100188664 3300006881 Bacteria 1592
157 Ga0068865_100390922 3300006881 Bacteria 1137
158 Ga0068865_100415123 3300006881 Unclassified 1105
159 Ga0097620_100415137 3300006931 Bacteria 1442
160 Ga0097620_100471371 3300006931 Bacteria 1351
161 Ga0097620_101379020 3300006931 Bacteria 777
162 Ga0105240_10002937 3300009093 Bacteria 26886
163 Ga0105240_10191238 3300009093 Bacteria 2406
164 Ga0105240_10285700 3300009093 Unclassified 1893
165 Ga0105240_11011463 3300009093 Bacteria 888
166 Ga0111539_10151273 3300009094 Bacteria 2716
167 Ga0105243_10722464 3300009148 Bacteria 973
168 Ga0105243_10934707 3300009148 Bacteria 865
169 Ga0105243_11819434 3300009148 Bacteria 640
170 Ga0105241_10003917 3300009174 Bacteria 11029
171 Ga0105241_10023343 3300009174 Bacteria 4586
172 Ga0105241_10572900 3300009174 Bacteria 1017
173 Ga0105242_10630658 3300009176 Unclassified 1040
174 Ga0105248_10374852 3300009177 Bacteria 1602
175 Ga0105237_10001288 3300009545 Bacteria 33371
176 Ga0105237_10005068 3300009545 Bacteria 14965
177 Ga0105237_10009241 3300009545 Bacteria 10573
178 Ga0105237_10106320 3300009545 Bacteria 2798
179 Ga0105237_10386798 3300009545 Bacteria 1404
180 Ga0105237_10498398 3300009545 Bacteria 1224
181 Ga0105238_10151108 3300009551 Bacteria 2297
182 Ga0105249_11684210 3300009553 Bacteria 707
183 Ga0105029_120845 3300009984 Unclassified 548
184 Ga0105239_10000032 3300010375 Bacteria 225528
185 Ga0105239_10039114 3300010375 Bacteria 5197
186 Ga0105239_10174303 3300010375 Bacteria 2406
187 Ga0105239_10441269 3300010375 Bacteria 1476
188 Ga0105239_10880449 3300010375 Bacteria 1027
189 Ga0105246_10045963 3300011119 Bacteria 2976
190 Ga0157373_10010741 3300013100 Bacteria 6738
191 Ga0157373_10071102 3300013100 Bacteria 2458
192 Ga0157373_10127676 3300013100 Bacteria 1788
193 Ga0157371_10002786 3300013102 Bacteria 16402
194 Ga0157371_10043019 3300013102 Bacteria 3219
195 Ga0157371_10251402 3300013102 Bacteria 1273
196 Ga0157370_10007087 3300013104 Bacteria 12244
197 Ga0157370_10380107 3300013104 Bacteria 1301
198 Ga0157370_10552733 3300013104 Bacteria 1055
199 Ga0157370_10585017 3300013104 Bacteria 1022
200 Ga0157369_10019092 3300013105 Bacteria 7674
201 Ga0157369_10444731 3300013105 Bacteria 1342
202 Ga0157369_10665812 3300013105 Bacteria 1073
203 Ga0157369_11273724 3300013105 Bacteria 750
204 Ga0157374_10000130 3300013296 Bacteria 68718
205 Ga0157374_10060401 3300013296 Bacteria 3547
206 Ga0157378_10105405 3300013297 Bacteria 2578
207 Ga0157378_10689816 3300013297 Unclassified 1040
208 Ga0163162_10000064 3300013306 Bacteria 103542
209 Ga0163162_10003444 3300013306 Bacteria 15107
210 Ga0163162_10352434 3300013306 Bacteria 1604
211 Ga0157372_10061667 3300013307 Unclassified 4200
212 Ga0157372_10317984 3300013307 Bacteria 1812
213 Ga0157375_10101297 3300013308 Bacteria 2963
214 Ga0157375_10202985 3300013308 Bacteria 2139
215 Ga0157375_10431855 3300013308 Bacteria 1483
216 Ga0157375_10688769 3300013308 Bacteria 1176
217 Ga0163163_10870143 3300014325 Unclassified 964
218 Ga0157380_10017505 3300014326 Bacteria 5304
219 Ga0157380_10048612 3300014326 Bacteria 3341
220 Ga0157380_10081204 3300014326 Bacteria 2651
221 Ga0157380_10175881 3300014326 Bacteria 1875
222 Ga0157380_10246520 3300014326 Bacteria 1614
223 Ga0157380_10468604 3300014326 Unclassified 1215
224 Ga0157380_11606036 3300014326 Bacteria 706
225 Ga0182008_10000020 3300014497 Bacteria 228333
226 Ga0182008_10005357 3300014497 Bacteria 7324
227 Ga0182008_10020505 3300014497 Bacteria 3403
228 Ga0182008_10036058 3300014497 Bacteria 2475
229 Ga0182008_10039454 3300014497 Bacteria 2360
230 Ga0182008_10197340 3300014497 Bacteria 1023
231 Ga0157377_10140932 3300014745 Bacteria 1482
232 Ga0157376_10046409 3300014969 Bacteria 3582
233 Ga0182006_1000239 3300015261 Bacteria 51541
234 Ga0182006_1003612 3300015261 Bacteria 7857
235 Ga0182007_10305702 3300015262 Bacteria 585
236 Ga0163161_10003277 3300017792 Bacteria 11380
237 Ga0163161_10198995 3300017792 Bacteria 1543
238 Ga0163161_11699767 3300017792 Bacteria 559
239 Ga0209436_104698 3300025208 Bacteria 3315
240 Ga0207427_100090 3300025231 Bacteria 133759
241 Ga0209437_100034 3300025233 Bacteria 494007
242 Ga0209437_100134 3300025233 Bacteria 178305
243 Ga0209233_1000038 3300025261 Bacteria 548972
244 Ga0209130_1001120 3300025284 Bacteria 19696
245 Ga0207426_1000448 3300025302 Bacteria 65983
246 Ga0207656_10465616 3300025321 Bacteria 640
247 Ga0207682_10007435 3300025893 Bacteria 4365
248 Ga0207682_10125279 3300025893 Unclassified 1143
249 Ga0207642_10539840 3300025899 Bacteria 719
250 Ga0207647_10000093 3300025904 Bacteria 68094
251 Ga0207647_10052413 3300025904 Bacteria 2518
252 Ga0207647_10369005 3300025904 Bacteria 811
253 Ga0207645_10009130 3300025907 Bacteria 6876
254 Ga0207643_10013128 3300025908 Bacteria 4482
255 Ga0207654_10005865 3300025911 Bacteria 6192
256 Ga0207654_10063710 3300025911 Bacteria 2165
257 Ga0207695_10001318 3300025913 Bacteria 42076
258 Ga0207695_10002972 3300025913 Bacteria 24457
259 Ga0207695_10631165 3300025913 Bacteria 952
260 Ga0207695_11326607 3300025913 Bacteria 600
261 Ga0207671_10004213 3300025914 Bacteria 13860
262 Ga0207671_10009633 3300025914 Bacteria 8052
263 Ga0207671_10032837 3300025914 Bacteria 3863
264 Ga0207652_10254188 3300025921 Bacteria 1585
265 Ga0207681_10054233 3300025923 Bacteria 2725
266 Ga0207681_10387356 3300025923 Bacteria 1126
267 Ga0207694_10071222 3300025924 Bacteria 2716
268 Ga0207650_10833106 3300025925 Bacteria 782
269 Ga0207659_10019980 3300025926 Bacteria 4420
270 Ga0207659_10030229 3300025926 Bacteria 3699
271 Ga0207690_10040030 3300025932 Bacteria 3062
272 Ga0207706_10000725 3300025933 Bacteria 34447
273 Ga0207706_10308040 3300025933 Bacteria 1379
274 Ga0207686_10068652 3300025934 Bacteria 2271
275 Ga0207670_10012031 3300025936 Bacteria 5044
276 Ga0207670_10098731 3300025936 Bacteria 2082
277 Ga0207670_11486672 3300025936 Unclassified 576
278 Ga0207669_10007115 3300025937 Bacteria 5152
279 Ga0207669_10156778 3300025937 Bacteria 1602
280 Ga0207669_10226695 3300025937 Bacteria 1376
281 Ga0207669_11947634 3300025937 Bacteria 502
282 Ga0207704_10000011 3300025938 Bacteria 180140
283 Ga0207704_10105378 3300025938 Bacteria 1891
284 Ga0207704_10311858 3300025938 Bacteria 1210
285 Ga0207691_10002967 3300025940 Bacteria 16561
286 Ga0207691_10010518 3300025940 Bacteria 8879
287 Ga0207691_10606341 3300025940 Bacteria 927
288 Ga0207689_10084970 3300025942 Bacteria 2601
289 Ga0207689_10352913 3300025942 Unclassified 1223
290 Ga0207689_10605256 3300025942 Bacteria 922
291 Ga0207689_10835150 3300025942 Bacteria 778
292 Ga0207689_11189510 3300025942 Bacteria 642
293 Ga0207689_11563920 3300025942 Bacteria 549
294 Ga0207667_10012796 3300025949 Bacteria 9639
295 Ga0207651_10403635 3300025960 Bacteria 1163
296 Ga0207651_10695268 3300025960 Bacteria 895
297 Ga0207651_11375468 3300025960 Bacteria 635
298 Ga0207668_10070557 3300025972 Bacteria 2492
299 Ga0207640_10014994 3300025981 Bacteria 4475
300 Ga0207640_10315792 3300025981 Bacteria 1242
301 Ga0207640_11693400 3300025981 Bacteria 571
302 Ga0207658_10235434 3300025986 Bacteria 1548
303 Ga0207658_10996098 3300025986 Unclassified 764
304 Ga0207658_10997577 3300025986 Bacteria 764
305 Ga0207677_10013300 3300026023 Bacteria 4764
306 Ga0207677_10036451 3300026023 Bacteria 3206
307 Ga0207677_10800268 3300026023 Unclassified 844
308 Ga0207677_11104355 3300026023 Unclassified 723
309 Ga0207703_10446160 3300026035 Bacteria 1208
310 Ga0207639_10090833 3300026041 Bacteria 2443
311 Ga0207678_10290369 3300026067 Bacteria 1404
312 Ga0207678_10378791 3300026067 Bacteria 1223
313 Ga0207678_10931399 3300026067 Bacteria 768
314 Ga0207708_10050713 3300026075 Bacteria 3159
315 Ga0207708_10063373 3300026075 Bacteria 2824
316 Ga0207641_10022428 3300026088 Bacteria 5198
317 Ga0207641_10075139 3300026088 Bacteria 2917
318 Ga0207641_10265781 3300026088 Bacteria 1608
319 Ga0207641_10485534 3300026088 Bacteria 1198
320 Ga0207648_10003739 3300026089 Bacteria 15911
321 Ga0207648_10340265 3300026089 Bacteria 1351
322 Ga0207648_10916975 3300026089 Bacteria 819
323 Ga0207676_10026999 3300026095 Bacteria 4273
324 Ga0207674_10082021 3300026116 Bacteria 3226
325 Ga0207674_10586144 3300026116 Bacteria 1077
326 Ga0207675_100001965 3300026118 Bacteria 20496
327 Ga0207675_100019691 3300026118 Bacteria 6299
328 Ga0207675_100029359 3300026118 Bacteria 5124
329 Ga0207675_100089806 3300026118 Bacteria 2888
330 Ga0207675_100217974 3300026118 Bacteria 1838
331 Ga0207675_100687066 3300026118 Bacteria 1032
332 Ga0207675_101154541 3300026118 Bacteria 795
333 Ga0207683_10002906 3300026121 Bacteria 14939
334 Ga0207683_10022918 3300026121 Bacteria 5366
335 Ga0207698_10001661 3300026142 Bacteria 12974
336 Ga0207698_11615729 3300026142 Bacteria 664
337 Ga0268266_10000078 3300028379 Bacteria 213632
338 Ga0268266_10003252 3300028379 Bacteria 16373
339 Ga0268266_10054598 3300028379 Bacteria 3433
340 Ga0268266_11533004 3300028379 Bacteria 642
341 Ga0268265_10026859 3300028380 Bacteria 4100
342 Ga0268265_11446232 3300028380 Unclassified 690
343 Ga0268264_10160550 3300028381 Bacteria 2024
344 Ga0268264_12084851 3300028381 Bacteria 576
345 Ga0307517_10001632 3300028786 Bacteria 37097
346 Ga0307517_10004342 3300028786 Bacteria 21830
347 Ga0316182_1265555 3300030745 Bacteria 577
348 Ga0316182_1449594 3300030745 Bacteria 818
349 Ga0307513_10011365 3300031456 Bacteria 11071
350 Ga0307513_10014812 3300031456 Bacteria 9486
351 Ga0307513_10135946 3300031456 Bacteria 2394
352 Ga0307513_10142731 3300031456 Bacteria 2318
353 Ga0307513_10201759 3300031456 Unclassified 1829
354 Ga0307509_10087205 3300031507 Bacteria 3207
355 Ga0307408_100103850 3300031548 Unclassified 2170
356 Ga0307408_101234606 3300031548 Bacteria 698
357 Ga0307408_101788601 3300031548 Bacteria 587
358 Ga0307516_10003109 3300031730 Bacteria 21594
359 Ga0307405_10950629 3300031731 Bacteria 730
360 Ga0307410_10055797 3300031852 Bacteria 2683
361 Ga0307410_10141185 3300031852 Unclassified 1782
362 Ga0307406_10859331 3300031901 Unclassified 770
363 Ga0307406_11661289 3300031901 Bacteria 565
364 Ga0307412_10000001 3300031911 Bacteria 822691
365 Ga0307412_10466713 3300031911 Bacteria 1044
366 Ga0307412_10565317 3300031911 Bacteria 957
367 Ga0307412_10619596 3300031911 Bacteria 919
368 Ga0307412_10728340 3300031911 Bacteria 854
369 Ga0307409_100076510 3300031995 Bacteria 2684
370 Ga0307409_100475093 3300031995 Bacteria 1212
371 Ga0307409_100682154 3300031995 Bacteria 1025
372 Ga0307416_100024344 3300032002 Bacteria 4417
373 Ga0307416_100037488 3300032002 Bacteria 3731
374 Ga0307416_101606709 3300032002 Bacteria 755
375 Ga0307414_10040203 3300032004 Bacteria 3157
376 Ga0307414_10043970 3300032004 Bacteria 3046
377 Ga0307414_10133116 3300032004 Bacteria 1933
378 Ga0307414_10402531 3300032004 Bacteria 1189
379 Ga0307411_10027630 3300032005 Bacteria 3436
380 Ga0307411_10578508 3300032005 Bacteria 962
381 Ga0307415_100224934 3300032126 Bacteria 1507
382 Ga0307415_100689131 3300032126 Bacteria 921
383 Ga0307510_10008251 3300033180 Bacteria 12411
384 Ga0373941_0247168 3300035115 Bacteria 695
385 Ga0373937_0358395 3300036401 Bacteria 1382
386 Ga0395900_0000014 3300037418 Bacteria 386513
387 Ga0395898_0002626 3300037466 Bacteria 20893
388 Ga0395905_0000037 3300037471 Bacteria 261808
389 Ga0395901_0000117 3300038443 Bacteria 105071
390 Ga0439465_0001425 3300041413 Bacteria 7735
391 Ga0451793_0446017 3300041452 Bacteria 1376
392 Ga0451802_1890635 3300041460 Bacteria 859
393 Ga0451807_0204085 3300041486 Unclassified 584
394 Ga0451807_1195179 3300041486 Unclassified 1705
395 Ga0451807_1250729 3300041486 Bacteria 3666
396 Ga0451843_1108106 3300041509 Unclassified 1201
397 Ga0451853_3169696 3300041512 Bacteria 811
398 Ga0439445_0064864 3300042004 Bacteria 1003
399 Ga0439448_0001474 3300042005 Bacteria 6105
400 Ga0439432_091729 3300042006 Bacteria 914
401 Ga0439449_0000016 3300042007 Bacteria 49059
402 Ga0450917_011810 3300042120 Bacteria 705
403 Ga0439464_0188827 3300042439 Bacteria 654
404 Ga0451577_0060031 3300042876 Bacteria 3390
405 Ga0466972_0065633 3300044658 Bacteria 1736
406 Ga0453683_0258596 3300044673 Bacteria 1110
407 Ga0453684_0003109 3300044712 Bacteria 38229
408 Ga0466959_0025719 3300045049 Bacteria 4365
409 Ga0451576_0011029 3300045051 Bacteria 10320
410 Ga0495617_080551 3300046452 Bacteria 1067
411 Ga0495638_0043874 3300046460 Bacteria 2819
412 Ga0495650_0000081 3300046471 Bacteria 240957
413 Ga0495596_0208948 3300046500 Unclassified 758
414 Ga0495596_0385500 3300046500 Bacteria 546
415 Ga0495583_0116762 3300046506 Bacteria 1126
416 Ga0495606_0000034 3300046507 Bacteria 247705
417 Ga0495606_0036712 3300046507 Bacteria 3335
418 Ga0495606_0044211 3300046507 Bacteria 2964
419 Ga0495606_0361784 3300046507 Bacteria 767
420 Ga0495610_0001393 3300046512 Bacteria 21452
421 Ga0495610_0102831 3300046512 Bacteria 1277
422 Ga0495616_0007814 3300046513 Bacteria 6382
423 Ga0495616_0052646 3300046513 Bacteria 2026
424 Ga0495620_0231796 3300046515 Unclassified 706
425 Ga0495620_0248918 3300046515 Bacteria 678
426 Ga0495620_0425802 3300046515 Bacteria 502
427 Ga0495631_0040351 3300046518 Bacteria 2068
428 Ga0495648_0032109 3300046524 Bacteria 3450
429 Ga0495652_0222908 3300046529 Bacteria 1416
430 Ga0495609_0010061 3300046538 Bacteria 4552
431 Ga0495633_0004766 3300046558 Bacteria 8509
432 Ga0495668_0069228 3300046616 Bacteria 1941
433 Ga0495668_0611848 3300046616 Unclassified 602
434 Ga0495625_0000049 3300046660 Bacteria 197646
435 Ga0495625_0002768 3300046660 Bacteria 18517
436 Ga0495625_0008211 3300046660 Bacteria 8934
437 Ga0495625_0019211 3300046660 Bacteria 5308
438 Ga0495625_0037016 3300046660 Bacteria 3582
439 Ga0495625_0119759 3300046660 Bacteria 1792
440 Ga0495625_0144268 3300046660 Bacteria 1604
441 Ga0495625_0291084 3300046660 Bacteria 1048
442 Ga0495661_0003920 3300046665 Bacteria 10865
443 Ga0495661_0314394 3300046665 Bacteria 780
444 Ga0495671_0114641 3300046692 Bacteria 1316
445 Ga0495649_0000014 3300046694 Bacteria 287408
446 Ga0495649_0002042 3300046694 Bacteria 14568
447 Ga0495649_0174989 3300046694 Bacteria 1122
448 Ga0495660_0035685 3300046810 Bacteria 2777
449 Ga0495683_0087032 3300047323 Unclassified 1518
450 Ga0495687_000793 3300047443 Bacteria 33985
451 Ga0495687_005676 3300047443 Bacteria 7884
452 Ga0495687_031241 3300047443 Bacteria 2445
453 Ga0495677_0063255 3300047445 Unclassified 1374
454 Ga0495679_034182 3300047446 Bacteria 1620
455 Ga0495685_048426 3300047447 Unclassified 1445
456 Ga0495673_0021652 3300047469 Bacteria 3169
457 Ga0495686_0026682 3300047472 Bacteria 3779
458 Ga0495686_0064223 3300047472 Bacteria 2273
459 Ga0495686_0075395 3300047472 Bacteria 2068
460 Ga0496122_0002408 3300048925 Bacteria 26652
461 Ga0496122_0003882 3300048925 Bacteria 19164
462 Ga0496123_0002515 3300048926 Bacteria 22532
463 Ga0496123_0140654 3300048926 Bacteria 1320
464 Ga0496125_0086301 3300048928 Bacteria 2374
465 Ga0496126_0029181 3300048929 Bacteria 5242
466 Ga0501309_011617 3300049129 Bacteria 1150
467 Ga0495678_026771 3300049459 Bacteria 2455
468 Ga0495682_0031081 3300049460 Bacteria 1975
469 Ga0501298_032076 3300049521 Bacteria 1036
470 Ga0501323_006411 3300049539 Bacteria 1314
471 Ga0501068_0471434 3300049584 Unclassified 813
472 Ga0501070_0354308 3300049586 Unclassified 1191
473 Ga0501071_0131529 3300049587 Bacteria 1859
474 Ga0501073_0117059 3300049589 Bacteria 1847
475 Ga0501076_0022985 3300049592 Bacteria 4799
476 Ga0501077_0299494 3300049593 Unclassified 1024
477 Ga0501233_126182 3300049668 Unclassified 696
478 Ga0501236_001154 3300049670 Unclassified 3000
479 Ga0501257_001504 3300049686 Unclassified 4864
480 Ga0501079_0005024 3300049741 Bacteria 9816
481 Ga0501080_0007110 3300049742 Bacteria 10104
482 Ga0501083_0045694 3300049744 Bacteria 2962
483 Ga0501241_033108 3300049758 Bacteria 982
484 Ga0501264_000088 3300049761 Bacteria 13397
485 nmdc:mga0k408_25586_c1 3300050493 Bacteria 3343
486 nmdc:mga08y16_941631_c1 3300050511 Bacteria 847
487 Ga0495655_0244289 3300053083 Unclassified 602
488 Ga0500644_0004303 3300053088 Bacteria 3559
489 Ga0500644_0052211 3300053088 Bacteria 1407
490 Ga0500651_0000130 3300053093 Bacteria 46487
491 Ga0500650_0207432 3300053098 Bacteria 891
492 Ga0500650_0310761 3300053098 Bacteria 696
493 Ga0500608_003331 3300053122 Bacteria 6008
494 Ga0500618_000079 3300053125 Bacteria 79415
495 Ga0500628_011744 3300053129 Bacteria 1599
496 Ga0500564_190748 3300053138 Bacteria 848
497 Ga0500568_0039098 3300053139 Bacteria 1917
498 Ga0500568_0044209 3300053139 Bacteria 1778
499 Ga0500616_0214261 3300053153 Bacteria 844
500 Ga0500622_0019552 3300053156 Bacteria 3597
501 Ga0500611_064269 3300053727 Bacteria 878
502 Ga0501084_0546538 3300054114 Bacteria 979
503 Ga0590074_088376 3300059423 Bacteria 597
504 Ga0501082_0075842 3300060353 Bacteria 2897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030745 Ga0316182_1265555 Ga0316182_12655551 105
2 3300041413 Ga0439465_0001425 Ga0439465_0001425_839_1267 105
3 3300042004 Ga0439445_0064864 Ga0439445_0064864_415_843 105
4 3300042007 Ga0439449_0000016 Ga0439449_0000016_10063_10491 105
5 3300005985 Ga0081539_10045722 Ga0081539_100457223 107
6 3300005328 Ga0070676_10212667 Ga0070676_102126672 109
7 3300005354 Ga0070675_100033580 Ga0070675_1000335802 109
8 3300005364 Ga0070673_100107792 Ga0070673_1001077922 109
9 3300005366 Ga0070659_100225065 Ga0070659_1002250653 109
10 3300005367 Ga0070667_100285449 Ga0070667_1002854492 109
11 3300005441 Ga0070700_100129349 Ga0070700_1001293492 109
12 3300005455 Ga0070663_100244012 Ga0070663_1002440122 109
13 3300005457 Ga0070662_100239675 Ga0070662_1002396752 109
14 3300005459 Ga0068867_100196363 Ga0068867_1001963632 109
15 3300005543 Ga0070672_100014133 Ga0070672_1000141332 109
16 3300005616 Ga0068852_102725898 Ga0068852_1027258981 109
17 3300005719 Ga0068861_100578262 Ga0068861_1005782622 109
18 3300005841 Ga0068863_100030783 Ga0068863_1000307832 109
19 3300005844 Ga0068862_100192033 Ga0068862_1001920332 109
20 3300006881 Ga0068865_100390922 Ga0068865_1003909222 109
21 3300013308 Ga0157375_10202985 Ga0157375_102029852 109
22 3300014326 Ga0157380_10048612 Ga0157380_100486122 109
23 3300025926 Ga0207659_10019980 Ga0207659_100199803 109
24 3300025933 Ga0207706_10308040 Ga0207706_103080402 109
25 3300025937 Ga0207669_11947634 Ga0207669_119476341 109
26 3300025940 Ga0207691_10002967 Ga0207691_100029679 109
27 3300025960 Ga0207651_10695268 Ga0207651_106952681 109
28 3300026067 Ga0207678_10378791 Ga0207678_103787912 109
29 3300026075 Ga0207708_10063373 Ga0207708_100633733 109
30 3300026088 Ga0207641_10022428 Ga0207641_100224285 109
31 3300026118 Ga0207675_100687066 Ga0207675_1006870662 109
32 3300026142 Ga0207698_11615729 Ga0207698_116157292 109
33 3300041460 Ga0451802_1890635 Ga0451802_1890635_93_485 110
34 3300005336 Ga0070680_101218890 Ga0070680_1012188902 111
35 3300042120 Ga0450917_011810 Ga0450917_011810_213_605 111
36 3300042439 Ga0439464_0188827 Ga0439464_0188827_167_559 111
37 3300049586 Ga0501070_0354308 Ga0501070_0354308_251_649 112
38 3300049587 Ga0501071_0131529 Ga0501071_0131529_559_957 112
39 3300049593 Ga0501077_0299494 Ga0501077_0299494_573_971 112
40 3300049741 Ga0501079_0005024 Ga0501079_0005024_9333_9731 112
41 3300049742 Ga0501080_0007110 Ga0501080_0007110_40_438 112
42 3300049744 Ga0501083_0045694 Ga0501083_0045694_1007_1405 112
43 3300005548 Ga0070665_100045780 Ga0070665_1000457802 114
44 3300009094 Ga0111539_10151273 Ga0111539_101512732 114
45 3300028379 Ga0268266_10054598 Ga0268266_100545982 114
46 3300031911 Ga0307412_10466713 Ga0307412_104667132 114
47 3300050511 nmdc:mga08y16_941631_c1 nmdc:mga08y16_941631_c1_123_518 114
48 3300030745 Ga0316182_1449594 Ga0316182_14495942 115
49 3300041486 Ga0451807_1250729 Ga0451807_1250729_1222_1641 116
50 3300059423 Ga0590074_088376 Ga0590074_088376_75_473 117
51 3300005345 Ga0070692_10579952 Ga0070692_105799522 118
52 3300005366 Ga0070659_100290725 Ga0070659_1002907252 118
53 3300005543 Ga0070672_100562098 Ga0070672_1005620982 118
54 3300009148 Ga0105243_10934707 Ga0105243_109347072 118
55 3300025940 Ga0207691_10606341 Ga0207691_106063412 118
56 3300026118 Ga0207675_100019691 Ga0207675_1000196914 118
57 3300041452 Ga0451793_0446017 Ga0451793_0446017_821_1222 118
58 3300053139 Ga0500568_0039098 Ga0500568_0039098_718_1119 118
59 3300005356 Ga0070674_101391646 Ga0070674_1013916461 119
60 3300006353 Ga0075370_10105063 Ga0075370_101050632 119
61 3300025942 Ga0207689_11189510 Ga0207689_111895101 119
62 3300025981 Ga0207640_11693400 Ga0207640_116934002 119
63 3300031456 Ga0307513_10011365 Ga0307513_100113658 119
64 3300031911 Ga0307412_10619596 Ga0307412_106195962 119
65 3300032002 Ga0307416_100037488 Ga0307416_1000374882 119
66 3300036401 Ga0373937_0358395 Ga0373937_0358395_723_1118 119
67 3300053156 Ga0500622_0019552 Ga0500622_0019552_1722_2126 119
68 3300003323 rootH1_10151014 rootH1_101510142 120
69 3300005615 Ga0070702_100473245 Ga0070702_1004732452 120
70 3300031852 Ga0307410_10141185 Ga0307410_101411852 120
71 3300042006 Ga0439432_091729 Ga0439432_091729_340_768 120
72 3300005333 Ga0070677_10092885 Ga0070677_100928852 121
73 3300005441 Ga0070700_100114145 Ga0070700_1001141452 121
74 3300005719 Ga0068861_100911922 Ga0068861_1009119222 121
75 3300014326 Ga0157380_11606036 Ga0157380_116060362 121
76 3300025986 Ga0207658_10235434 Ga0207658_102354342 121
77 3300026118 Ga0207675_101154541 Ga0207675_1011545412 121
78 3300031852 Ga0307410_10055797 Ga0307410_100557972 121
79 3300031995 Ga0307409_100076510 Ga0307409_1000765102 121
80 3300032005 Ga0307411_10027630 Ga0307411_100276303 121
81 3300041512 Ga0451853_3169696 Ga0451853_3169696_404_775 121
82 3300046500 Ga0495596_0385500 Ga0495596_0385500_108_479 121
83 3300046515 Ga0495620_0425802 Ga0495620_0425802_45_416 121
84 3300046660 Ga0495625_0019211 Ga0495625_0019211_266_637 121
85 3300054114 Ga0501084_0546538 Ga0501084_0546538_191_595 121
86 3300005327 Ga0070658_11130154 Ga0070658_111301542 122
87 3300009984 Ga0105029_120845 Ga0105029_1208452 122
88 3300053138 Ga0500564_190748 Ga0500564_190748_79_492 122
89 3300032126 Ga0307415_100689131 Ga0307415_1006891312 123
90 3300003320 rootH2_10005669 rootH2_100056694 125
91 3300003323 rootH1_10034967 rootH1_1003496712 125
92 3300005577 Ga0068857_100100807 Ga0068857_1001008072 125
93 3300005578 Ga0068854_100337845 Ga0068854_1003378452 125
94 3300014497 Ga0182008_10039454 Ga0182008_100394541 125
95 3300025981 Ga0207640_10315792 Ga0207640_103157922 125
96 3300031548 Ga0307408_101234606 Ga0307408_1012346062 126
97 3300031995 Ga0307409_100475093 Ga0307409_1004750932 126
98 3300031995 Ga0307409_100682154 Ga0307409_1006821542 126
99 3300032002 Ga0307416_100024344 Ga0307416_1000243442 126
100 3300032005 Ga0307411_10578508 Ga0307411_105785082 126
101 3300042876 Ga0451577_0060031 Ga0451577_0060031_2940_3350 126
102 3300044673 Ga0453683_0258596 Ga0453683_0258596_255_665 126
103 3300044712 Ga0453684_0003109 Ga0453684_0003109_3267_3677 126
104 3300045051 Ga0451576_0011029 Ga0451576_0011029_2988_3398 126
105 3300031548 Ga0307408_101788601 Ga0307408_1017886012 127
106 3300031901 Ga0307406_11661289 Ga0307406_116612892 127
107 3300049592 Ga0501076_0022985 Ga0501076_0022985_4096_4485 127
108 3300060353 Ga0501082_0075842 Ga0501082_0075842_1675_2064 127
109 3300003354 JGI25160J50197_1023237 JGI25160J50197_10232371 128
110 3300005333 Ga0070677_10157921 Ga0070677_101579212 128
111 3300005334 Ga0068869_100346440 Ga0068869_1003464401 128
112 3300005337 Ga0070682_100207926 Ga0070682_1002079262 128
113 3300005365 Ga0070688_100170337 Ga0070688_1001703372 128
114 3300005438 Ga0070701_10072716 Ga0070701_100727162 128
115 3300005544 Ga0070686_100070339 Ga0070686_1000703392 128
116 3300005548 Ga0070665_100004183 Ga0070665_1000041839 128
117 3300006881 Ga0068865_100415123 Ga0068865_1004151232 128
118 3300009553 Ga0105249_11684210 Ga0105249_116842102 128
119 3300025208 Ga0209436_104698 Ga0209436_1046982 128
120 3300025284 Ga0209130_1001120 Ga0209130_100112017 128
121 3300025302 Ga0207426_1000448 Ga0207426_100044815 128
122 3300025893 Ga0207682_10125279 Ga0207682_101252792 128
123 3300025936 Ga0207670_10098731 Ga0207670_100987313 128
124 3300025937 Ga0207669_10226695 Ga0207669_102266952 128
125 3300025938 Ga0207704_10311858 Ga0207704_103118582 128
126 3300025942 Ga0207689_10084970 Ga0207689_100849703 128
127 3300026118 Ga0207675_100089806 Ga0207675_1000898062 128
128 3300028379 Ga0268266_10003252 Ga0268266_100032528 128
129 3300028380 Ga0268265_11446232 Ga0268265_114462322 128
130 3300031731 Ga0307405_10950629 Ga0307405_109506292 128
131 3300041509 Ga0451843_1108106 Ga0451843_1108106_698_1132 128
132 3300044658 Ga0466972_0065633 Ga0466972_0065633_49_459 128
133 3300045049 Ga0466959_0025719 Ga0466959_0025719_2110_2520 128
134 3300046694 Ga0495649_0002042 Ga0495649_0002042_9035_9427 128
135 3300047472 Ga0495686_0026682 Ga0495686_0026682_598_990 128
136 iso_pu_bacteria 2929195423 2929195486 128
137 3300005331 Ga0070670_101110436 Ga0070670_1011104361 129
138 3300005333 Ga0070677_10007101 Ga0070677_100071012 129
139 3300005334 Ga0068869_100051735 Ga0068869_1000517353 129
140 3300005334 Ga0068869_100175713 Ga0068869_1001757132 129
141 3300005334 Ga0068869_100464147 Ga0068869_1004641471 129
142 3300005337 Ga0070682_100118083 Ga0070682_1001180832 129
143 3300005337 Ga0070682_100198868 Ga0070682_1001988682 129
144 3300005338 Ga0068868_100870631 Ga0068868_1008706312 129
145 3300005338 Ga0068868_101386968 Ga0068868_1013869682 129
146 3300005339 Ga0070660_101208148 Ga0070660_1012081481 129
147 3300005340 Ga0070689_100001360 Ga0070689_1000013603 129
148 3300005340 Ga0070689_100445702 Ga0070689_1004457022 129
149 3300005340 Ga0070689_101694797 Ga0070689_1016947972 129
150 3300005343 Ga0070687_101521254 Ga0070687_1015212541 129
151 3300005347 Ga0070668_101086250 Ga0070668_1010862502 129
152 3300005354 Ga0070675_100076729 Ga0070675_1000767292 129
153 3300005355 Ga0070671_101448791 Ga0070671_1014487911 129
154 3300005364 Ga0070673_100013174 Ga0070673_1000131743 129
155 3300005364 Ga0070673_101203367 Ga0070673_1012033671 129
156 3300005367 Ga0070667_100478753 Ga0070667_1004787531 129
157 3300005367 Ga0070667_100644843 Ga0070667_1006448431 129
158 3300005438 Ga0070701_10289518 Ga0070701_102895182 129
159 3300005440 Ga0070705_100119788 Ga0070705_1001197882 129
160 3300005441 Ga0070700_100012357 Ga0070700_1000123573 129
161 3300005444 Ga0070694_100020137 Ga0070694_1000201373 129
162 3300005445 Ga0070708_101402290 Ga0070708_1014022902 129
163 3300005455 Ga0070663_100800200 Ga0070663_1008002002 129
164 3300005455 Ga0070663_101461329 Ga0070663_1014613291 129
165 3300005456 Ga0070678_100158748 Ga0070678_1001587482 129
166 3300005459 Ga0068867_101546372 Ga0068867_1015463722 129
167 3300005466 Ga0070685_10119570 Ga0070685_101195702 129
168 3300005467 Ga0070706_100761445 Ga0070706_1007614452 129
169 3300005543 Ga0070672_100008364 Ga0070672_1000083643 129
170 3300005544 Ga0070686_100012880 Ga0070686_1000128803 129
171 3300005546 Ga0070696_100512923 Ga0070696_1005129232 129
172 3300005548 Ga0070665_101789179 Ga0070665_1017891792 129
173 3300005549 Ga0070704_100055524 Ga0070704_1000555242 129
174 3300005577 Ga0068857_100739033 Ga0068857_1007390332 129
175 3300005615 Ga0070702_100002604 Ga0070702_1000026043 129
176 3300005615 Ga0070702_101047303 Ga0070702_1010473032 129
177 3300005617 Ga0068859_100415133 Ga0068859_1004151332 129
178 3300005618 Ga0068864_100066841 Ga0068864_1000668413 129
179 3300005718 Ga0068866_10194968 Ga0068866_101949682 129
180 3300005719 Ga0068861_100001702 Ga0068861_1000017026 129
181 3300005719 Ga0068861_100489280 Ga0068861_1004892802 129
182 3300005840 Ga0068870_10694401 Ga0068870_106944012 129
183 3300005841 Ga0068863_100031893 Ga0068863_1000318932 129
184 3300005841 Ga0068863_100100494 Ga0068863_1001004942 129
185 3300005841 Ga0068863_100126608 Ga0068863_1001266082 129
186 3300005841 Ga0068863_100318144 Ga0068863_1003181442 129
187 3300005843 Ga0068860_100016428 Ga0068860_1000164283 129
188 3300005844 Ga0068862_101555768 Ga0068862_1015557682 129
189 3300005937 Ga0081455_10008486 Ga0081455_100084862 129
190 3300006237 Ga0097621_100007161 Ga0097621_1000071614 129
191 3300006237 Ga0097621_100249875 Ga0097621_1002498752 129
192 3300006237 Ga0097621_100306216 Ga0097621_1003062162 129
193 3300006237 Ga0097621_100546284 Ga0097621_1005462842 129
194 3300006358 Ga0068871_100005168 Ga0068871_1000051683 129
195 3300006358 Ga0068871_100095215 Ga0068871_1000952153 129
196 3300006358 Ga0068871_100214621 Ga0068871_1002146213 129
197 3300006358 Ga0068871_100302717 Ga0068871_1003027172 129
198 3300006881 Ga0068865_100095989 Ga0068865_1000959892 129
199 3300006881 Ga0068865_100188664 Ga0068865_1001886642 129
200 3300006931 Ga0097620_100415137 Ga0097620_1004151372 129
201 3300009148 Ga0105243_10722464 Ga0105243_107224642 129
202 3300009176 Ga0105242_10630658 Ga0105242_106306582 129
203 3300009177 Ga0105248_10374852 Ga0105248_103748522 129
204 3300013105 Ga0157369_11273724 Ga0157369_112737241 129
205 3300013297 Ga0157378_10689816 Ga0157378_106898161 129
206 3300013306 Ga0163162_10352434 Ga0163162_103524342 129
207 3300013308 Ga0157375_10431855 Ga0157375_104318552 129
208 3300014325 Ga0163163_10870143 Ga0163163_108701432 129
209 3300014326 Ga0157380_10017505 Ga0157380_100175052 129
210 3300014326 Ga0157380_10081204 Ga0157380_100812042 129
211 3300014326 Ga0157380_10175881 Ga0157380_101758812 129
212 3300014326 Ga0157380_10246520 Ga0157380_102465202 129
213 3300014326 Ga0157380_10468604 Ga0157380_104686042 129
214 3300014969 Ga0157376_10046409 Ga0157376_100464092 129
215 3300017792 Ga0163161_10198995 Ga0163161_101989953 129
216 3300025321 Ga0207656_10465616 Ga0207656_104656162 129
217 3300025893 Ga0207682_10007435 Ga0207682_100074353 129
218 3300025908 Ga0207643_10013128 Ga0207643_100131283 129
219 3300025923 Ga0207681_10054233 Ga0207681_100542333 129
220 3300025923 Ga0207681_10387356 Ga0207681_103873562 129
221 3300025925 Ga0207650_10833106 Ga0207650_108331062 129
222 3300025926 Ga0207659_10030229 Ga0207659_100302293 129
223 3300025934 Ga0207686_10068652 Ga0207686_100686522 129
224 3300025936 Ga0207670_10012031 Ga0207670_100120313 129
225 3300025936 Ga0207670_11486672 Ga0207670_114866722 129
226 3300025937 Ga0207669_10007115 Ga0207669_100071153 129
227 3300025937 Ga0207669_10156778 Ga0207669_101567782 129
228 3300025938 Ga0207704_10105378 Ga0207704_101053782 129
229 3300025940 Ga0207691_10010518 Ga0207691_100105185 129
230 3300025942 Ga0207689_10352913 Ga0207689_103529132 129
231 3300025942 Ga0207689_10835150 Ga0207689_108351502 129
232 3300025960 Ga0207651_11375468 Ga0207651_113754681 129
233 3300025972 Ga0207668_10070557 Ga0207668_100705572 129
234 3300025986 Ga0207658_10996098 Ga0207658_109960982 129
235 3300026023 Ga0207677_10800268 Ga0207677_108002682 129
236 3300026023 Ga0207677_11104355 Ga0207677_111043552 129
237 3300026035 Ga0207703_10446160 Ga0207703_104461602 129
238 3300026067 Ga0207678_10290369 Ga0207678_102903691 129
239 3300026067 Ga0207678_10931399 Ga0207678_109313991 129
240 3300026075 Ga0207708_10050713 Ga0207708_100507132 129
241 3300026088 Ga0207641_10075139 Ga0207641_100751392 129
242 3300026088 Ga0207641_10265781 Ga0207641_102657812 129
243 3300026089 Ga0207648_10340265 Ga0207648_103402652 129
244 3300026095 Ga0207676_10026999 Ga0207676_100269993 129
245 3300026118 Ga0207675_100001965 Ga0207675_10000196510 129
246 3300026118 Ga0207675_100029359 Ga0207675_1000293593 129
247 3300026118 Ga0207675_100217974 Ga0207675_1002179742 129
248 3300026121 Ga0207683_10022918 Ga0207683_100229183 129
249 3300028379 Ga0268266_11533004 Ga0268266_115330041 129
250 3300028380 Ga0268265_10026859 Ga0268265_100268593 129
251 3300028381 Ga0268264_10160550 Ga0268264_101605503 129
252 3300028381 Ga0268264_12084851 Ga0268264_120848511 129
253 3300031456 Ga0307513_10014812 Ga0307513_100148127 129
254 3300031456 Ga0307513_10135946 Ga0307513_101359461 129
255 3300031456 Ga0307513_10142731 Ga0307513_101427313 129
256 3300031507 Ga0307509_10087205 Ga0307509_100872053 129
257 3300031548 Ga0307408_100103850 Ga0307408_1001038501 129
258 3300031901 Ga0307406_10859331 Ga0307406_108593312 129
259 3300031911 Ga0307412_10565317 Ga0307412_105653172 129
260 3300032002 Ga0307416_101606709 Ga0307416_1016067092 129
261 3300032126 Ga0307415_100224934 Ga0307415_1002249342 129
262 3300041486 Ga0451807_0204085 Ga0451807_0204085_89_484 129
263 3300041486 Ga0451807_1195179 Ga0451807_1195179_641_1039 129
264 3300046452 Ga0495617_080551 Ga0495617_080551_127_522 129
265 3300046460 Ga0495638_0043874 Ga0495638_0043874_431_829 129
266 3300046515 Ga0495620_0248918 Ga0495620_0248918_211_606 129
267 3300046660 Ga0495625_0008211 Ga0495625_0008211_2217_2615 129
268 3300046660 Ga0495625_0144268 Ga0495625_0144268_417_812 129
269 3300046694 Ga0495649_0174989 Ga0495649_0174989_324_719 129
270 3300047472 Ga0495686_0064223 Ga0495686_0064223_1527_1937 129
271 3300049129 Ga0501309_011617 Ga0501309_011617_14_421 129
272 3300049521 Ga0501298_032076 Ga0501298_032076_113_520 129
273 3300049539 Ga0501323_006411 Ga0501323_006411_174_581 129
274 3300049668 Ga0501233_126182 Ga0501233_126182_207_614 129
275 3300049670 Ga0501236_001154 Ga0501236_001154_1754_2161 129
276 3300049686 Ga0501257_001504 Ga0501257_001504_50_457 129
277 3300049761 Ga0501264_000088 Ga0501264_000088_11493_11900 129
278 3300053083 Ga0495655_0244289 Ga0495655_0244289_153_548 129
279 3300053088 Ga0500644_0052211 Ga0500644_0052211_788_1183 129
280 3300053129 Ga0500628_011744 Ga0500628_011744_1171_1566 129
281 3300053727 Ga0500611_064269 Ga0500611_064269_36_434 129
282 3300005617 Ga0068859_100471362 Ga0068859_1004713622 130
283 3300005834 Ga0068851_10076139 Ga0068851_100761393 130
284 3300005844 Ga0068862_100788459 Ga0068862_1007884592 130
285 3300006931 Ga0097620_100471371 Ga0097620_1004713712 130
286 3300026116 Ga0207674_10082021 Ga0207674_100820212 130
287 3300046507 Ga0495606_0361784 Ga0495606_0361784_334_747 130
288 3300046660 Ga0495625_0002768 Ga0495625_0002768_13297_13698 130
289 3300048925 Ga0496122_0003882 Ga0496122_0003882_7246_7668 130
290 3300048926 Ga0496123_0140654 Ga0496123_0140654_175_597 130
291 3300048929 Ga0496126_0029181 Ga0496126_0029181_293_715 130
292 3300049584 Ga0501068_0471434 Ga0501068_0471434_77_487 130
293 3300049589 Ga0501073_0117059 Ga0501073_0117059_450_860 130
294 iso_pu_bacteria 2599185184 2599481602 130
295 iso_pu_bacteria 2928078545 2928083166 130
296 iso_pu_bacteria 2928147474 2928152990 130
297 iso_pu_bacteria 2932082852 2932086633 130
298 3300031456 Ga0307513_10201759 Ga0307513_102017593 131
299 3300032004 Ga0307414_10402531 Ga0307414_104025312 131
300 iso_pu_bacteria 2738541284 2738761405 131
301 iso_pu_bacteria 2775506987 2776615985 131
302 iso_pu_bacteria 2818991460 2819680378 131
303 iso_pu_bacteria 2896085136 2896089838 131
304 iso_pu_bacteria 2929177148 2929182665 131
305 iso_pu_bacteria 2945977869 2945978591 131
306 iso_pu_bacteria 2946013367 2946015546 131
307 3300003320 rootH2_10043027 rootH2_100430271 132
308 3300014497 Ga0182008_10020505 Ga0182008_100205051 132
309 3300053088 Ga0500644_0004303 Ga0500644_0004303_2600_3010 132
310 iso_pu_bacteria 2852684882 2852688696 132
311 3300009545 Ga0105237_10009241 Ga0105237_100092413 133
312 3300013104 Ga0157370_10007087 Ga0157370_100070877 133
313 3300014497 Ga0182008_10005357 Ga0182008_100053576 133
314 3300015261 Ga0182006_1000239 Ga0182006_100023940 133
315 3300017792 Ga0163161_10003277 Ga0163161_100032778 133
316 3300017792 Ga0163161_11699767 Ga0163161_116997671 133
317 3300025914 Ga0207671_10032837 Ga0207671_100328373 133
318 3300048925 Ga0496122_0002408 Ga0496122_0002408_21533_21958 133
319 3300048926 Ga0496123_0002515 Ga0496123_0002515_18624_19049 133
320 3300048928 Ga0496125_0086301 Ga0496125_0086301_659_1084 133
321 3300001979 JGI24740J21852_10003411 JGI24740J21852_100034114 134
322 3300001989 JGI24739J22299_10005079 JGI24739J22299_100050795 134
323 3300002737 JGI25162J39368_1000213 JGI25162J39368_100021350 134
324 3300003316 rootH1_10014099 rootH1_100140994 134
325 3300003323 rootH1_10212301 rootH1_102123011 134
326 3300005339 Ga0070660_100716893 Ga0070660_1007168932 134
327 3300005530 Ga0070679_100123436 Ga0070679_1001234362 134
328 3300005539 Ga0068853_100014308 Ga0068853_1000143084 134
329 3300005548 Ga0070665_100000003 Ga0070665_100000003294 134
330 3300005563 Ga0068855_100093279 Ga0068855_1000932792 134
331 3300005577 Ga0068857_100575848 Ga0068857_1005758481 134
332 3300005578 Ga0068854_100007939 Ga0068854_1000079395 134
333 3300006195 Ga0075366_10039629 Ga0075366_100396293 134
334 3300009545 Ga0105237_10106320 Ga0105237_101063203 134
335 3300009545 Ga0105237_10498398 Ga0105237_104983982 134
336 3300010375 Ga0105239_10000032 Ga0105239_100000327 134
337 3300010375 Ga0105239_10441269 Ga0105239_104412691 134
338 3300013102 Ga0157371_10043019 Ga0157371_100430194 134
339 3300013104 Ga0157370_10552733 Ga0157370_105527332 134
340 3300013105 Ga0157369_10019092 Ga0157369_100190922 134
341 3300013306 Ga0163162_10000064 Ga0163162_1000006457 134
342 3300013306 Ga0163162_10003444 Ga0163162_100034447 134
343 3300025233 Ga0209437_100134 Ga0209437_10013449 134
344 3300025904 Ga0207647_10052413 Ga0207647_100524132 134
345 3300025904 Ga0207647_10369005 Ga0207647_103690051 134
346 3300025914 Ga0207671_10009633 Ga0207671_100096334 134
347 3300025921 Ga0207652_10254188 Ga0207652_102541882 134
348 3300025949 Ga0207667_10012796 Ga0207667_100127966 134
349 3300025981 Ga0207640_10014994 Ga0207640_100149943 134
350 3300026116 Ga0207674_10586144 Ga0207674_105861442 134
351 3300028379 Ga0268266_10000078 Ga0268266_1000007884 134
352 3300046471 Ga0495650_0000081 Ga0495650_0000081_66894_67301 134
353 3300046506 Ga0495583_0116762 Ga0495583_0116762_454_861 134
354 3300046507 Ga0495606_0000034 Ga0495606_0000034_76131_76538 134
355 3300046507 Ga0495606_0044211 Ga0495606_0044211_2005_2412 134
356 3300046512 Ga0495610_0001393 Ga0495610_0001393_14029_14436 134
357 3300046512 Ga0495610_0102831 Ga0495610_0102831_786_1193 134
358 3300046513 Ga0495616_0007814 Ga0495616_0007814_5763_6170 134
359 3300046529 Ga0495652_0222908 Ga0495652_0222908_397_804 134
360 3300046538 Ga0495609_0010061 Ga0495609_0010061_2459_2866 134
361 3300046558 Ga0495633_0004766 Ga0495633_0004766_3265_3672 134
362 3300046616 Ga0495668_0069228 Ga0495668_0069228_1207_1614 134
363 3300046660 Ga0495625_0000049 Ga0495625_0000049_11470_11877 134
364 3300046665 Ga0495661_0003920 Ga0495661_0003920_4008_4415 134
365 3300046665 Ga0495661_0314394 Ga0495661_0314394_58_465 134
366 3300046694 Ga0495649_0000014 Ga0495649_0000014_183922_184329 134
367 3300046810 Ga0495660_0035685 Ga0495660_0035685_1596_2003 134
368 3300047443 Ga0495687_000793 Ga0495687_000793_13007_13414 134
369 3300047446 Ga0495679_034182 Ga0495679_034182_128_535 134
370 3300047469 Ga0495673_0021652 Ga0495673_0021652_1255_1662 134
371 3300047472 Ga0495686_0075395 Ga0495686_0075395_188_595 134
372 3300050493 nmdc:mga0k408_25586_c1 nmdc:mga0k408_25586_c1_1990_2397 134
373 3300053125 Ga0500618_000079 Ga0500618_000079_46763_47170 134
374 3300053153 Ga0500616_0214261 Ga0500616_0214261_356_766 134
375 2162886007 SwRhRL2b_contig_2741210 SwRhRL2b_0006.00003790 135
376 2162886007 SwRhRL2b_contig_798958 SwRhRL2b_0292.00000560 135
377 3300001990 JGI24737J22298_10006960 JGI24737J22298_100069604 135
378 3300002737 JGI25162J39368_1006400 JGI25162J39368_10064002 135
379 3300002772 JGI25164J39214_1002448 JGI25164J39214_10024482 135
380 3300003214 JGI25165J46597_1000986 JGI25165J46597_10009862 135
381 3300003320 rootH2_10001334 rootH2_10001334150 135
382 3300003323 rootH1_10019846 rootH1_100198462 135
383 3300003323 rootH1_10102515 rootH1_101025151 135
384 3300003323 rootH1_10171706 rootH1_1017170610 135
385 3300005288 Ga0065714_10004780 Ga0065714_1000478015 135
386 3300005288 Ga0065714_10067106 Ga0065714_100671066 135
387 3300005288 Ga0065714_10067656 Ga0065714_100676562 135
388 3300005289 Ga0065704_10000206 Ga0065704_1000020648 135
389 3300005289 Ga0065704_10082026 Ga0065704_100820265 135
390 3300005289 Ga0065704_10091660 Ga0065704_100916603 135
391 3300005328 Ga0070676_10000038 Ga0070676_1000003831 135
392 3300005338 Ga0068868_100022783 Ga0068868_1000227832 135
393 3300005338 Ga0068868_100060510 Ga0068868_1000605103 135
394 3300005364 Ga0070673_100005489 Ga0070673_1000054898 135
395 3300005364 Ga0070673_100472041 Ga0070673_1004720411 135
396 3300005366 Ga0070659_100058210 Ga0070659_1000582103 135
397 3300005456 Ga0070678_100010849 Ga0070678_1000108492 135
398 3300005457 Ga0070662_100001815 Ga0070662_10000181510 135
399 3300005459 Ga0068867_100001131 Ga0068867_10000113111 135
400 3300005539 Ga0068853_100005741 Ga0068853_1000057416 135
401 3300005543 Ga0070672_100024627 Ga0070672_1000246271 135
402 3300005616 Ga0068852_100003080 Ga0068852_1000030806 135
403 3300005617 Ga0068859_101378952 Ga0068859_1013789521 135
404 3300005618 Ga0068864_100269084 Ga0068864_1002690842 135
405 3300005718 Ga0068866_10703256 Ga0068866_107032562 135
406 3300005840 Ga0068870_10199152 Ga0068870_101991522 135
407 3300005842 Ga0068858_100573424 Ga0068858_1005734242 135
408 3300006237 Ga0097621_100000241 Ga0097621_10000024124 135
409 3300006358 Ga0068871_100000139 Ga0068871_10000013942 135
410 3300006881 Ga0068865_100000022 Ga0068865_10000002223 135
411 3300006931 Ga0097620_101379020 Ga0097620_1013790201 135
412 3300009093 Ga0105240_10002937 Ga0105240_1000293720 135
413 3300009093 Ga0105240_10191238 Ga0105240_101912382 135
414 3300009093 Ga0105240_10285700 Ga0105240_102857002 135
415 3300009093 Ga0105240_11011463 Ga0105240_110114632 135
416 3300009148 Ga0105243_11819434 Ga0105243_118194341 135
417 3300009174 Ga0105241_10003917 Ga0105241_100039178 135
418 3300009174 Ga0105241_10023343 Ga0105241_100233437 135
419 3300009174 Ga0105241_10572900 Ga0105241_105729001 135
420 3300009545 Ga0105237_10001288 Ga0105237_1000128824 135
421 3300009545 Ga0105237_10005068 Ga0105237_100050687 135
422 3300009545 Ga0105237_10386798 Ga0105237_103867982 135
423 3300009551 Ga0105238_10151108 Ga0105238_101511083 135
424 3300010375 Ga0105239_10039114 Ga0105239_100391142 135
425 3300010375 Ga0105239_10174303 Ga0105239_101743032 135
426 3300010375 Ga0105239_10880449 Ga0105239_108804492 135
427 3300011119 Ga0105246_10045963 Ga0105246_100459632 135
428 3300013100 Ga0157373_10010741 Ga0157373_100107416 135
429 3300013100 Ga0157373_10071102 Ga0157373_100711022 135
430 3300013100 Ga0157373_10127676 Ga0157373_101276763 135
431 3300013102 Ga0157371_10002786 Ga0157371_100027862 135
432 3300013102 Ga0157371_10251402 Ga0157371_102514022 135
433 3300013104 Ga0157370_10380107 Ga0157370_103801072 135
434 3300013104 Ga0157370_10585017 Ga0157370_105850172 135
435 3300013105 Ga0157369_10444731 Ga0157369_104447312 135
436 3300013105 Ga0157369_10665812 Ga0157369_106658121 135
437 3300013296 Ga0157374_10000130 Ga0157374_1000013033 135
438 3300013296 Ga0157374_10060401 Ga0157374_100604013 135
439 3300013297 Ga0157378_10105405 Ga0157378_101054053 135
440 3300013307 Ga0157372_10061667 Ga0157372_100616674 135
441 3300013307 Ga0157372_10317984 Ga0157372_103179842 135
442 3300013308 Ga0157375_10101297 Ga0157375_101012973 135
443 3300013308 Ga0157375_10688769 Ga0157375_106887692 135
444 3300014497 Ga0182008_10000020 Ga0182008_1000002019 135
445 3300014497 Ga0182008_10036058 Ga0182008_100360582 135
446 3300014497 Ga0182008_10197340 Ga0182008_101973402 135
447 3300014745 Ga0157377_10140932 Ga0157377_101409322 135
448 3300015261 Ga0182006_1003612 Ga0182006_10036122 135
449 3300015262 Ga0182007_10305702 Ga0182007_103057021 135
450 3300025231 Ga0207427_100090 Ga0207427_100090129 135
451 3300025233 Ga0209437_100034 Ga0209437_100034338 135
452 3300025261 Ga0209233_1000038 Ga0209233_1000038338 135
453 3300025899 Ga0207642_10539840 Ga0207642_105398402 135
454 3300025904 Ga0207647_10000093 Ga0207647_1000009361 135
455 3300025907 Ga0207645_10009130 Ga0207645_100091305 135
456 3300025911 Ga0207654_10005865 Ga0207654_100058655 135
457 3300025911 Ga0207654_10063710 Ga0207654_100637102 135
458 3300025913 Ga0207695_10001318 Ga0207695_1000131817 135
459 3300025913 Ga0207695_10002972 Ga0207695_100029725 135
460 3300025913 Ga0207695_10631165 Ga0207695_106311652 135
461 3300025913 Ga0207695_11326607 Ga0207695_113266072 135
462 3300025914 Ga0207671_10004213 Ga0207671_100042137 135
463 3300025924 Ga0207694_10071222 Ga0207694_100712223 135
464 3300025932 Ga0207690_10040030 Ga0207690_100400302 135
465 3300025933 Ga0207706_10000725 Ga0207706_100007252 135
466 3300025938 Ga0207704_10000011 Ga0207704_1000001123 135
467 3300025942 Ga0207689_10605256 Ga0207689_106052562 135
468 3300025942 Ga0207689_11563920 Ga0207689_115639201 135
469 3300025960 Ga0207651_10403635 Ga0207651_104036352 135
470 3300025986 Ga0207658_10997577 Ga0207658_109975772 135
471 3300026023 Ga0207677_10013300 Ga0207677_100133006 135
472 3300026023 Ga0207677_10036451 Ga0207677_100364513 135
473 3300026041 Ga0207639_10090833 Ga0207639_100908332 135
474 3300026088 Ga0207641_10485534 Ga0207641_104855341 135
475 3300026089 Ga0207648_10003739 Ga0207648_100037399 135
476 3300026089 Ga0207648_10916975 Ga0207648_109169752 135
477 3300026121 Ga0207683_10002906 Ga0207683_1000290610 135
478 3300026142 Ga0207698_10001661 Ga0207698_100016617 135
479 3300028786 Ga0307517_10001632 Ga0307517_1000163240 135
480 3300028786 Ga0307517_10004342 Ga0307517_1000434213 135
481 3300031730 Ga0307516_10003109 Ga0307516_1000310916 135
482 3300031911 Ga0307412_10000001 Ga0307412_10000001382 135
483 3300031911 Ga0307412_10728340 Ga0307412_107283402 135
484 3300032004 Ga0307414_10040203 Ga0307414_100402036 135
485 3300032004 Ga0307414_10043970 Ga0307414_100439703 135
486 3300032004 Ga0307414_10133116 Ga0307414_101331163 135
487 3300033180 Ga0307510_10008251 Ga0307510_1000825110 135
488 3300035115 Ga0373941_0247168 Ga0373941_0247168_245_655 135
489 3300037418 Ga0395900_0000014 Ga0395900_0000014_179027_179437 135
490 3300037466 Ga0395898_0002626 Ga0395898_0002626_10625_11035 135
491 3300037471 Ga0395905_0000037 Ga0395905_0000037_179017_179427 135
492 3300038443 Ga0395901_0000117 Ga0395901_0000117_92674_93084 135
493 3300042005 Ga0439448_0001474 Ga0439448_0001474_45_455 135
494 3300046500 Ga0495596_0208948 Ga0495596_0208948_108_518 135
495 3300046507 Ga0495606_0036712 Ga0495606_0036712_1878_2285 135
496 3300046513 Ga0495616_0052646 Ga0495616_0052646_1275_1688 135
497 3300046515 Ga0495620_0231796 Ga0495620_0231796_230_637 135
498 3300046518 Ga0495631_0040351 Ga0495631_0040351_1319_1729 135
499 3300046524 Ga0495648_0032109 Ga0495648_0032109_1882_2295 135
500 3300046616 Ga0495668_0611848 Ga0495668_0611848_132_542 135
501 3300046660 Ga0495625_0037016 Ga0495625_0037016_2272_2685 135
502 3300046660 Ga0495625_0119759 Ga0495625_0119759_162_575 135
503 3300046660 Ga0495625_0291084 Ga0495625_0291084_386_796 135
504 3300046692 Ga0495671_0114641 Ga0495671_0114641_649_1062 135
505 3300047323 Ga0495683_0087032 Ga0495683_0087032_679_1089 135
506 3300047443 Ga0495687_005676 Ga0495687_005676_5701_6111 135
507 3300047443 Ga0495687_031241 Ga0495687_031241_462_875 135
508 3300047445 Ga0495677_0063255 Ga0495677_0063255_584_991 135
509 3300047447 Ga0495685_048426 Ga0495685_048426_440_847 135
510 3300049459 Ga0495678_026771 Ga0495678_026771_1060_1473 135
511 3300049460 Ga0495682_0031081 Ga0495682_0031081_339_749 135
512 3300049758 Ga0501241_033108 Ga0501241_033108_486_893 135
513 3300053093 Ga0500651_0000130 Ga0500651_0000130_27568_27975 135
514 3300053098 Ga0500650_0207432 Ga0500650_0207432_307_720 135
515 3300053098 Ga0500650_0310761 Ga0500650_0310761_244_654 135
516 3300053122 Ga0500608_003331 Ga0500608_003331_2983_3393 135
517 3300053139 Ga0500568_0044209 Ga0500568_0044209_555_962 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07876

Dabb

Stress responsive A/B Barrel Domain

55

153

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bn7-assembly1.cif.gz_A-2 crystal structure of a dimeric ferredoxin-like protein (cc_2267) from caulobacter crescentus cb15 at 1.64 a resolution 0.9562 36 135
3bn7-assembly1.cif.gz_A-2 crystal structure of a dimeric ferredoxin-like protein (cc_2267) from caulobacter crescentus cb15 at 1.64 a resolution 0.9292 36 135
5b0b-assembly2.cif.gz_B polyketide cyclase oac from cannabis sativa, i7f mutant 0.863 36 135
5b0b-assembly2.cif.gz_D polyketide cyclase oac from cannabis sativa, i7f mutant 0.8437 36 135
5b0b-assembly2.cif.gz_B polyketide cyclase oac from cannabis sativa, i7f mutant 0.8374 36 135
ID Description Score Start End Superfamily
3bn7A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9583 36 132 3.30.70.100
3bn7A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9211 36 132 3.30.70.100
af_I1LY42_1_101_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8449 36 132 3.30.70.100
5b0bD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8437 36 135 3.30.70.100
af_Q9SYD8_1_102_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8254 36 133 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A3M9NEI3-F1-model_v4 Dabb family protein 0.962 36 134
AF-A0A4Q5YUW8-F1-model_v4 Dabb family protein 0.9619 36 134
AF-A0A2W6T1F3-F1-model_v4 Stress responsive alpha-beta barrel domain-containing protein 0.9569 37 135
AF-A0A258D1E3-F1-model_v4 Stress responsive alpha-beta barrel domain-containing protein 0.9561 36 135
AF-A0A0D3LL30-F1-model_v4 Stress responsive alpha-beta barrel domain-containing protein 0.9497 36 134

Feature Viewer

pLDDT pTM Quality
84.21 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map