F457967

General Info

Members Datasets Scaffolds Average Seq Length
516 212 516 320

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100201526|Ga0070708_1002015262
Length 382
Sequence MQYCLGKRISSGGCRSQLLVVNRLLNSLPRMFTRERRVSEVGQAFLPVTRFKEEDRQECLSYFMKALRVEKKKLAVREIEKPVRGEEALVRVLLSGICNTDLEIARGYAGFKGTIGHEFVGVVEEASERSMVGQRVVGEINAGCGACELCTAGDPRHCQSRTVLGIVGRDGAHAEFLRLPLRNLTAVPDKVVDEHAVFTEPLAAAWGVLECVTIRSTDRIAVIGDGKLGLLCAQVLALSGAAVLLIGKHADKLRIAERRGIETATVKSVAKRTRDFDVVVEASGSPSGFTGALELLRPRGVLVLKSTLQGAGPAEFDRTRLVVDEITILGSRCGRFQPALDLLKKGAIDIDSLISEEYPLARGVYAMERAGRKGVMKVFLRP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
188 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
193 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
194 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
195 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
196 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
197 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
198 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
199 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
202 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 2.13
Rhizosphere 97.09
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1244686 2162886007 Unclassified 1687
2 MBSR1b_contig_3301288 2162886012 Bacteria 1762
3 MBSR1b_contig_6004661 2162886012 Bacteria 1067
4 rootH1_10022019 3300003323 Bacteria 2063
5 Ga0065704_10001172 3300005289 Bacteria 19999
6 Ga0065704_10005075 3300005289 Unclassified 4976
7 Ga0065704_10080862 3300005289 Unclassified 3865
8 Ga0065704_10088859 3300005289 Unclassified 2904
9 Ga0065712_10000113 3300005290 Bacteria 191931
10 Ga0065715_10001857 3300005293 Bacteria 6337
11 Ga0065715_10090791 3300005293 Bacteria 6455
12 Ga0065715_10091179 3300005293 Bacteria 6033
13 Ga0065715_10207950 3300005293 Bacteria 1328
14 Ga0065715_10209568 3300005293 Bacteria 1321
15 Ga0065715_10218360 3300005293 Unclassified 1283
16 Ga0065707_10000618 3300005295 Bacteria 18697
17 Ga0065707_10002738 3300005295 Bacteria 8925
18 Ga0065707_10128044 3300005295 Bacteria 1972
19 Ga0065707_10240432 3300005295 Bacteria 1157
20 Ga0070690_100047136 3300005330 Unclassified 2741
21 Ga0070690_100119598 3300005330 Bacteria 1767
22 Ga0070690_100229610 3300005330 Bacteria 1304
23 Ga0070670_100001205 3300005331 Bacteria 20532
24 Ga0070670_100442728 3300005331 Unclassified 1151
25 Ga0068869_100012238 3300005334 Bacteria 5662
26 Ga0068869_100017229 3300005334 Bacteria 4892
27 Ga0068869_100022585 3300005334 Bacteria 4337
28 Ga0068869_100029900 3300005334 Bacteria 3820
29 Ga0068869_100085343 3300005334 Bacteria 2365
30 Ga0070680_100000139 3300005336 Bacteria 44398
31 Ga0070680_100059028 3300005336 Bacteria 3138
32 Ga0070680_100194367 3300005336 Bacteria 1710
33 Ga0070682_100000051 3300005337 Bacteria 123476
34 Ga0070682_100007777 3300005337 Bacteria 6038
35 Ga0068868_100018825 3300005338 Bacteria 5167
36 Ga0068868_100073096 3300005338 Bacteria 2737
37 Ga0070660_100249885 3300005339 Bacteria 1446
38 Ga0070689_100000520 3300005340 Bacteria 22774
39 Ga0070689_100068761 3300005340 Bacteria 2762
40 Ga0070687_100126646 3300005343 Bacteria 1469
41 Ga0070692_10001914 3300005345 Bacteria 7859
42 Ga0070692_10036942 3300005345 Bacteria 2481
43 Ga0070692_10074714 3300005345 Bacteria 1814
44 Ga0070675_100041509 3300005354 Bacteria 3758
45 Ga0070675_100116928 3300005354 Unclassified 2262
46 Ga0070671_100002973 3300005355 Bacteria 13188
47 Ga0070671_100031196 3300005355 Unclassified 4402
48 Ga0070673_100013543 3300005364 Bacteria 5648
49 Ga0070673_100137978 3300005364 Bacteria 2055
50 Ga0070688_100133781 3300005365 Bacteria 1676
51 Ga0070688_100215154 3300005365 Unclassified 1351
52 Ga0070659_100000997 3300005366 Bacteria 20800
53 Ga0070667_100063879 3300005367 Bacteria 3122
54 Ga0070667_100066755 3300005367 Bacteria 3057
55 Ga0070703_10051880 3300005406 Bacteria 1314
56 Ga0070701_10039966 3300005438 Bacteria 2382
57 Ga0070701_10044685 3300005438 Bacteria 2270
58 Ga0070701_10086495 3300005438 Bacteria 1708
59 Ga0070701_10098483 3300005438 Unclassified 1615
60 Ga0070705_100010487 3300005440 Bacteria 4640
61 Ga0070705_100061538 3300005440 Bacteria 2231
62 Ga0070705_100083776 3300005440 Bacteria 1966
63 Ga0070700_100000070 3300005441 Bacteria 72718
64 Ga0070700_100011545 3300005441 Unclassified 4896
65 Ga0070700_100019262 3300005441 Bacteria 3936
66 Ga0070700_100121209 3300005441 Bacteria 1753
67 Ga0070700_100249245 3300005441 Bacteria 1273
68 Ga0070694_100007993 3300005444 Bacteria 6463
69 Ga0070694_100010270 3300005444 Bacteria 5769
70 Ga0070694_100039347 3300005444 Bacteria 3147
71 Ga0070694_100084228 3300005444 Bacteria 2218
72 Ga0070694_100113077 3300005444 Bacteria 1937
73 Ga0070694_100154274 3300005444 Bacteria 1680
74 Ga0070694_100272810 3300005444 Bacteria 1287
75 Ga0070708_100000712 3300005445 Bacteria 25260
76 Ga0070708_100120462 3300005445 Bacteria 2420
77 Ga0070708_100201526 3300005445 Bacteria 1863
78 Ga0070681_10000652 3300005458 Bacteria 28661
79 Ga0070681_10007377 3300005458 Bacteria 10746
80 Ga0070681_10017148 3300005458 Bacteria 7240
81 Ga0070681_10025235 3300005458 Bacteria 5978
82 Ga0068867_100055514 3300005459 Bacteria 2929
83 Ga0068867_100221565 3300005459 Bacteria 1525
84 Ga0068867_100370004 3300005459 Bacteria 1201
85 Ga0070685_10008200 3300005466 Bacteria 5356
86 Ga0070706_100000019 3300005467 Bacteria 166483
87 Ga0070706_100019218 3300005467 Bacteria 6303
88 Ga0070706_100071143 3300005467 Bacteria 3216
89 Ga0070706_100209630 3300005467 Bacteria 1820
90 Ga0070706_100228410 3300005467 Bacteria 1737
91 Ga0070706_100296151 3300005467 Bacteria 1510
92 Ga0070707_100074187 3300005468 Bacteria 3281
93 Ga0070707_100347907 3300005468 Unclassified 1440
94 Ga0070698_100001795 3300005471 Bacteria 23876
95 Ga0070698_100010300 3300005471 Bacteria 9980
96 Ga0070698_100011347 3300005471 Bacteria 9462
97 Ga0070698_100015979 3300005471 Bacteria 7928
98 Ga0070698_100027198 3300005471 Bacteria 5950
99 Ga0070698_100100096 3300005471 Bacteria 2871
100 Ga0070698_100122266 3300005471 Bacteria 2562
101 Ga0070698_100512394 3300005471 Unclassified 1138
102 Ga0070699_100000762 3300005518 Bacteria 29755
103 Ga0070699_100009442 3300005518 Bacteria 8453
104 Ga0070699_100028441 3300005518 Unclassified 4821
105 Ga0070699_100037327 3300005518 Unclassified 4203
106 Ga0070699_100445537 3300005518 Bacteria 1174
107 Ga0070679_100000059 3300005530 Bacteria 81792
108 Ga0070679_100010562 3300005530 Bacteria 8759
109 Ga0070697_100000042 3300005536 Bacteria 94533
110 Ga0070697_100003739 3300005536 Bacteria 11687
111 Ga0070697_100024734 3300005536 Bacteria 4782
112 Ga0070697_100043534 3300005536 Unclassified 3636
113 Ga0070697_100122860 3300005536 Bacteria 2173
114 Ga0070697_100268934 3300005536 Bacteria 1461
115 Ga0070697_100282925 3300005536 Bacteria 1423
116 Ga0068853_100001826 3300005539 Bacteria 15651
117 Ga0068853_100004548 3300005539 Bacteria 10765
118 Ga0068853_100045901 3300005539 Unclassified 3744
119 Ga0068853_100090772 3300005539 Bacteria 2685
120 Ga0068853_100598090 3300005539 Bacteria 1047
121 Ga0070672_100027332 3300005543 Unclassified 4254
122 Ga0070686_100007489 3300005544 Bacteria 6092
123 Ga0070686_100014669 3300005544 Bacteria 4520
124 Ga0070686_100071852 3300005544 Bacteria 2267
125 Ga0070695_100134619 3300005545 Unclassified 1707
126 Ga0070695_100229709 3300005545 Unclassified 1341
127 Ga0070695_100285215 3300005545 Unclassified 1215
128 Ga0070695_100288040 3300005545 Unclassified 1209
129 Ga0070695_100372115 3300005545 Bacteria 1076
130 Ga0070696_100013272 3300005546 Bacteria 5527
131 Ga0070696_100095392 3300005546 Bacteria 2124
132 Ga0070696_100123152 3300005546 Unclassified 1879
133 Ga0070696_100123346 3300005546 Bacteria 1877
134 Ga0070696_100239671 3300005546 Unclassified 1367
135 Ga0070693_100047820 3300005547 Bacteria 2435
136 Ga0070693_100152884 3300005547 Bacteria 1463
137 Ga0070665_100143185 3300005548 Bacteria 2394
138 Ga0070704_100106072 3300005549 Unclassified 2128
139 Ga0070704_100123251 3300005549 Bacteria 1995
140 Ga0070704_100254165 3300005549 Unclassified 1445
141 Ga0070704_100537424 3300005549 Bacteria 1020
142 Ga0070664_100002145 3300005564 Bacteria 15812
143 Ga0070664_100102256 3300005564 Bacteria 2493
144 Ga0068857_100027600 3300005577 Bacteria 5008
145 Ga0068857_100113682 3300005577 Bacteria 2434
146 Ga0068854_100140401 3300005578 Bacteria 1853
147 Ga0068856_100008069 3300005614 Bacteria 10276
148 Ga0068856_100261964 3300005614 Unclassified 1744
149 Ga0070702_100034128 3300005615 Unclassified 2803
150 Ga0070702_100060805 3300005615 Unclassified 2197
151 Ga0070702_100140205 3300005615 Bacteria 1539
152 Ga0068852_100116876 3300005616 Bacteria 2434
153 Ga0068852_100147223 3300005616 Unclassified 2186
154 Ga0068859_100008267 3300005617 Bacteria 10551
155 Ga0068859_100032356 3300005617 Bacteria 5254
156 Ga0068859_100050998 3300005617 Bacteria 4158
157 Ga0068859_100061392 3300005617 Unclassified 3787
158 Ga0068859_100092564 3300005617 Bacteria 3075
159 Ga0068859_100150640 3300005617 Bacteria 2401
160 Ga0068859_100283359 3300005617 Bacteria 1750
161 Ga0068864_100045057 3300005618 Bacteria 3783
162 Ga0068864_100119744 3300005618 Bacteria 2352
163 Ga0068866_10006288 3300005718 Bacteria 4944
164 Ga0068861_100028204 3300005719 Bacteria 4096
165 Ga0068861_100052147 3300005719 Unclassified 3108
166 Ga0068861_100121128 3300005719 Unclassified 2111
167 Ga0068861_100155255 3300005719 Bacteria 1882
168 Ga0068870_10082529 3300005840 Bacteria 1780
169 Ga0068863_100007143 3300005841 Bacteria 10955
170 Ga0068863_100050260 3300005841 Bacteria 3952
171 Ga0068863_100168029 3300005841 Bacteria 2104
172 Ga0068863_100169635 3300005841 Bacteria 2093
173 Ga0068858_100021547 3300005842 Bacteria 6023
174 Ga0068858_100050959 3300005842 Bacteria 3831
175 Ga0068860_100035364 3300005843 Bacteria 4791
176 Ga0068860_100051684 3300005843 Bacteria 3909
177 Ga0068860_100082106 3300005843 Unclassified 3066
178 Ga0068862_100003110 3300005844 Bacteria 14465
179 Ga0068862_100012756 3300005844 Bacteria 6955
180 Ga0068862_100036359 3300005844 Bacteria 4174
181 Ga0081455_10004961 3300005937 Bacteria 14715
182 Ga0081539_10001629 3300005985 Bacteria 36707
183 Ga0070716_100000003 3300006173 Bacteria 312721
184 Ga0070716_100066083 3300006173 Unclassified 2108
185 Ga0097621_100055478 3300006237 Bacteria 3235
186 Ga0097621_100151118 3300006237 Unclassified 1991
187 Ga0097621_100159992 3300006237 Unclassified 1935
188 Ga0068871_100087187 3300006358 Bacteria 2594
189 Ga0068871_100145501 3300006358 Unclassified 2017
190 Ga0075428_100038593 3300006844 Bacteria 5256
191 Ga0075428_100082227 3300006844 Bacteria 3514
192 Ga0075428_100199331 3300006844 Bacteria 2164
193 Ga0075430_100052936 3300006846 Bacteria 3418
194 Ga0075431_100057757 3300006847 Bacteria 4002
195 Ga0075431_100196345 3300006847 Bacteria 2066
196 Ga0075431_100236852 3300006847 Bacteria 1858
197 Ga0075433_10000077 3300006852 Bacteria 44120
198 Ga0075433_10019790 3300006852 Bacteria 5617
199 Ga0075433_10032906 3300006852 Bacteria 4443
200 Ga0075433_10043355 3300006852 Bacteria 3904
201 Ga0075433_10076608 3300006852 Bacteria 2945
202 Ga0075433_10104959 3300006852 Bacteria 2504
203 Ga0075433_10127699 3300006852 Bacteria 2258
204 Ga0075433_10154970 3300006852 Bacteria 2038
205 Ga0075433_10319457 3300006852 Unclassified 1374
206 Ga0075434_100025117 3300006871 Bacteria 5829
207 Ga0075434_100077273 3300006871 Bacteria 3324
208 Ga0075434_100450137 3300006871 Unclassified 1309
209 Ga0075429_100010583 3300006880 Bacteria 7979
210 Ga0075429_100067081 3300006880 Bacteria 3123
211 Ga0068865_100006970 3300006881 Bacteria 6930
212 Ga0068865_100221713 3300006881 Bacteria 1479
213 Ga0075436_100000430 3300006914 Bacteria 26922
214 Ga0075436_100005320 3300006914 Bacteria 8850
215 Ga0097620_100008267 3300006931 Bacteria 10551
216 Ga0097620_100032360 3300006931 Bacteria 5254
217 Ga0097620_100050999 3300006931 Bacteria 4158
218 Ga0097620_100061392 3300006931 Unclassified 3787
219 Ga0097620_100092566 3300006931 Bacteria 3075
220 Ga0097620_100150640 3300006931 Bacteria 2401
221 Ga0097620_100283359 3300006931 Bacteria 1750
222 Ga0105240_10032438 3300009093 Bacteria 6762
223 Ga0105240_10052115 3300009093 Bacteria 5145
224 Ga0111539_10000931 3300009094 Bacteria 38341
225 Ga0111539_10021046 3300009094 Bacteria 8032
226 Ga0111539_10033381 3300009094 Bacteria 6248
227 Ga0111539_10060692 3300009094 Bacteria 4481
228 Ga0111539_10081967 3300009094 Bacteria 3794
229 Ga0105245_10025941 3300009098 Bacteria 5155
230 Ga0105247_10079679 3300009101 Bacteria 2061
231 Ga0114129_10007505 3300009147 Bacteria 15532
232 Ga0114129_10009464 3300009147 Bacteria 13885
233 Ga0114129_10053293 3300009147 Bacteria 5674
234 Ga0114129_10059719 3300009147 Bacteria 5331
235 Ga0114129_10086283 3300009147 Bacteria 4354
236 Ga0114129_10776519 3300009147 Bacteria 1224
237 Ga0105243_10000364 3300009148 Bacteria 48410
238 Ga0105243_10010652 3300009148 Bacteria 6973
239 Ga0105243_10039358 3300009148 Unclassified 3685
240 Ga0105243_10070485 3300009148 Unclassified 2823
241 Ga0105243_10103913 3300009148 Bacteria 2363
242 Ga0105243_10178954 3300009148 Bacteria 1843
243 Ga0105243_10263664 3300009148 Bacteria 1544
244 Ga0105243_10443689 3300009148 Bacteria 1216
245 Ga0105241_10037464 3300009174 Bacteria 3654
246 Ga0105241_10056946 3300009174 Bacteria 2997
247 Ga0105241_10076283 3300009174 Unclassified 2613
248 Ga0105242_10000270 3300009176 Bacteria 41208
249 Ga0105242_10055842 3300009176 Unclassified 3231
250 Ga0105242_10322279 3300009176 Bacteria 1418
251 Ga0105248_10006116 3300009177 Bacteria 13205
252 Ga0105248_10013612 3300009177 Bacteria 8955
253 Ga0105248_10027885 3300009177 Bacteria 6287
254 Ga0105248_10082984 3300009177 Bacteria 3605
255 Ga0105248_10088171 3300009177 Bacteria 3492
256 Ga0105248_10102545 3300009177 Unclassified 3225
257 Ga0105248_10113874 3300009177 Bacteria 3050
258 Ga0105237_10002452 3300009545 Bacteria 23028
259 Ga0105238_10005750 3300009551 Bacteria 12267
260 Ga0105239_10023464 3300010375 Bacteria 6794
261 Ga0105239_10246922 3300010375 Bacteria 2004
262 Ga0105246_10077510 3300011119 Unclassified 2358
263 Ga0105246_10106984 3300011119 Unclassified 2047
264 Ga0157373_10001793 3300013100 Bacteria 16329
265 Ga0157369_10062528 3300013105 Unclassified 4011
266 Ga0157374_10051995 3300013296 Bacteria 3814
267 Ga0157378_10051258 3300013297 Bacteria 3672
268 Ga0157378_10064569 3300013297 Bacteria 3275
269 Ga0157378_10069987 3300013297 Bacteria 3149
270 Ga0157378_10073860 3300013297 Bacteria 3067
271 Ga0157378_10078110 3300013297 Bacteria 2985
272 Ga0157378_10092539 3300013297 Bacteria 2751
273 Ga0163162_10000506 3300013306 Bacteria 36273
274 Ga0163162_10028650 3300013306 Bacteria 5512
275 Ga0163162_10037254 3300013306 Unclassified 4852
276 Ga0163162_10047474 3300013306 Bacteria 4303
277 Ga0163162_10056297 3300013306 Bacteria 3961
278 Ga0163162_10096655 3300013306 Bacteria 3042
279 Ga0157372_10003813 3300013307 Bacteria 16192
280 Ga0157372_10102117 3300013307 Unclassified 3275
281 Ga0157372_10105276 3300013307 Bacteria 3227
282 Ga0157375_10020001 3300013308 Bacteria 6105
283 Ga0157375_10060945 3300013308 Bacteria 3744
284 Ga0157375_10222652 3300013308 Bacteria 2045
285 Ga0157375_10390474 3300013308 Bacteria 1558
286 Ga0163163_10003818 3300014325 Bacteria 12834
287 Ga0163163_10003828 3300014325 Bacteria 12813
288 Ga0163163_10055145 3300014325 Bacteria 3928
289 Ga0163163_10068061 3300014325 Bacteria 3542
290 Ga0163163_10078283 3300014325 Bacteria 3303
291 Ga0163163_10083312 3300014325 Bacteria 3203
292 Ga0163163_10286952 3300014325 Bacteria 1698
293 Ga0157380_10002797 3300014326 Bacteria 11862
294 Ga0157380_10042001 3300014326 Bacteria 3572
295 Ga0157380_10043600 3300014326 Bacteria 3512
296 Ga0157380_10066004 3300014326 Bacteria 2910
297 Ga0157380_10092640 3300014326 Unclassified 2497
298 Ga0157380_10093930 3300014326 Bacteria 2481
299 Ga0157377_10180279 3300014745 Unclassified 1328
300 Ga0157376_10008505 3300014969 Bacteria 7410
301 Ga0157376_10025139 3300014969 Bacteria 4688
302 Ga0157376_10454756 3300014969 Unclassified 1250
303 Ga0163161_10016077 3300017792 Bacteria 5224
304 Ga0163161_10017409 3300017792 Bacteria 5029
305 Ga0163161_10091613 3300017792 Bacteria 2250
306 Ga0207697_10007114 3300025315 Bacteria 5008
307 Ga0207653_10009486 3300025885 Bacteria 3034
308 Ga0207643_10018228 3300025908 Bacteria 3844
309 Ga0207643_10038185 3300025908 Bacteria 2697
310 Ga0207643_10040350 3300025908 Bacteria 2628
311 Ga0207643_10180533 3300025908 Unclassified 1277
312 Ga0207684_10000079 3300025910 Bacteria 179842
313 Ga0207684_10001129 3300025910 Bacteria 29818
314 Ga0207684_10038188 3300025910 Bacteria 4075
315 Ga0207684_10216813 3300025910 Bacteria 1651
316 Ga0207654_10043026 3300025911 Unclassified 2558
317 Ga0207654_10133429 3300025911 Bacteria 1574
318 Ga0207654_10147894 3300025911 Bacteria 1505
319 Ga0207654_10235679 3300025911 Unclassified 1221
320 Ga0207707_10000008 3300025912 Bacteria 330313
321 Ga0207707_10049229 3300025912 Bacteria 3671
322 Ga0207707_10096179 3300025912 Bacteria 2588
323 Ga0207671_10002542 3300025914 Bacteria 19413
324 Ga0207671_10181156 3300025914 Bacteria 1640
325 Ga0207660_10000437 3300025917 Bacteria 27518
326 Ga0207660_10043834 3300025917 Bacteria 3145
327 Ga0207660_10046994 3300025917 Unclassified 3049
328 Ga0207662_10131348 3300025918 Unclassified 1579
329 Ga0207649_10076995 3300025920 Bacteria 2148
330 Ga0207652_10000085 3300025921 Bacteria 101176
331 Ga0207652_10015613 3300025921 Bacteria 6181
332 Ga0207652_10026033 3300025921 Unclassified 4869
333 Ga0207652_10370554 3300025921 Bacteria 1293
334 Ga0207646_10040132 3300025922 Bacteria 4210
335 Ga0207646_10305877 3300025922 Unclassified 1436
336 Ga0207681_10025813 3300025923 Bacteria 3783
337 Ga0207694_10024149 3300025924 Bacteria 4617
338 Ga0207650_10000675 3300025925 Bacteria 26793
339 Ga0207650_10246162 3300025925 Unclassified 1446
340 Ga0207659_10401591 3300025926 Bacteria 1146
341 Ga0207706_10207515 3300025933 Bacteria 1718
342 Ga0207686_10000039 3300025934 Bacteria 126792
343 Ga0207709_10000192 3300025935 Bacteria 81277
344 Ga0207709_10047006 3300025935 Bacteria 2622
345 Ga0207709_10065908 3300025935 Bacteria 2279
346 Ga0207709_10332697 3300025935 Bacteria 1140
347 Ga0207670_10019054 3300025936 Bacteria 4183
348 Ga0207704_10175567 3300025938 Bacteria 1542
349 Ga0207691_10000845 3300025940 Bacteria 30493
350 Ga0207691_10029652 3300025940 Bacteria 5118
351 Ga0207711_10002073 3300025941 Bacteria 18109
352 Ga0207711_10017312 3300025941 Bacteria 5988
353 Ga0207711_10044446 3300025941 Unclassified 3792
354 Ga0207711_10073559 3300025941 Bacteria 2970
355 Ga0207711_10089815 3300025941 Bacteria 2700
356 Ga0207689_10001578 3300025942 Bacteria 21602
357 Ga0207689_10005172 3300025942 Bacteria 11719
358 Ga0207689_10012682 3300025942 Bacteria 7201
359 Ga0207689_10021423 3300025942 Bacteria 5433
360 Ga0207689_10037623 3300025942 Bacteria 4013
361 Ga0207689_10116476 3300025942 Unclassified 2196
362 Ga0207651_10084175 3300025960 Bacteria 2303
363 Ga0207651_10400778 3300025960 Unclassified 1167
364 Ga0207712_10061028 3300025961 Bacteria 2675
365 Ga0207668_10357318 3300025972 Bacteria 1223
366 Ga0207640_10132510 3300025981 Bacteria 1804
367 Ga0207677_10041972 3300026023 Bacteria 3029
368 Ga0207677_10092923 3300026023 Bacteria 2198
369 Ga0207703_10045150 3300026035 Bacteria 3543
370 Ga0207703_10085256 3300026035 Bacteria 2643
371 Ga0207703_10287287 3300026035 Unclassified 1496
372 Ga0207639_10001389 3300026041 Bacteria 16345
373 Ga0207639_10111247 3300026041 Bacteria 2232
374 Ga0207639_10499378 3300026041 Bacteria 1111
375 Ga0207708_10000094 3300026075 Bacteria 67925
376 Ga0207708_10005226 3300026075 Bacteria 9567
377 Ga0207708_10052463 3300026075 Bacteria 3106
378 Ga0207708_10101164 3300026075 Bacteria 2231
379 Ga0207708_10163001 3300026075 Bacteria 1761
380 Ga0207708_10217873 3300026075 Bacteria 1528
381 Ga0207702_10007133 3300026078 Bacteria 9562
382 Ga0207702_10226166 3300026078 Unclassified 1746
383 Ga0207641_10045239 3300026088 Bacteria 3706
384 Ga0207641_10047514 3300026088 Bacteria 3619
385 Ga0207641_10245324 3300026088 Unclassified 1671
386 Ga0207648_10009944 3300026089 Bacteria 9064
387 Ga0207648_10143314 3300026089 Unclassified 2107
388 Ga0207648_10294766 3300026089 Bacteria 1453
389 Ga0207648_10384162 3300026089 Bacteria 1270
390 Ga0207676_10017608 3300026095 Bacteria 5180
391 Ga0207676_10070435 3300026095 Bacteria 2804
392 Ga0207676_10104941 3300026095 Bacteria 2351
393 Ga0207676_10140707 3300026095 Bacteria 2065
394 Ga0207676_10215729 3300026095 Unclassified 1706
395 Ga0207674_10002177 3300026116 Bacteria 24786
396 Ga0207674_10120512 3300026116 Bacteria 2591
397 Ga0207674_10180392 3300026116 Bacteria 2063
398 Ga0207675_100008853 3300026118 Bacteria 9444
399 Ga0207675_100052030 3300026118 Bacteria 3822
400 Ga0207675_100133362 3300026118 Bacteria 2355
401 Ga0207675_100352086 3300026118 Bacteria 1443
402 Ga0207683_10369349 3300026121 Unclassified 1318
403 Ga0207698_10175242 3300026142 Bacteria 1893
404 Ga0207698_10191126 3300026142 Bacteria 1824
405 Ga0207698_10248917 3300026142 Bacteria 1625
406 Ga0207428_10000547 3300027907 Bacteria 44826
407 Ga0207428_10022018 3300027907 Bacteria 5384
408 Ga0207428_10024065 3300027907 Bacteria 5113
409 Ga0268266_10107286 3300028379 Bacteria 2469
410 Ga0268266_10286091 3300028379 Unclassified 1534
411 Ga0268265_10063476 3300028380 Bacteria 2842
412 Ga0268264_10100442 3300028381 Bacteria 2513
413 Ga0268264_10153247 3300028381 Bacteria 2069
414 Ga0268264_10159320 3300028381 Bacteria 2031
415 Ga0265323_10014428 3300028653 Unclassified 3131
416 Ga0307515_10003491 3300028794 Bacteria 33042
417 Ga0265332_10008807 3300031238 Bacteria 4518
418 Ga0307405_10125344 3300031731 Unclassified 1765
419 Ga0307405_10156630 3300031731 Bacteria 1608
420 Ga0316577_10009237 3300031733 Bacteria 5302
421 Ga0307413_10050646 3300031824 Bacteria 2497
422 Ga0307410_10085158 3300031852 Bacteria 2230
423 Ga0307406_10107008 3300031901 Bacteria 1917
424 Ga0307412_10136054 3300031911 Bacteria 1793
425 Ga0307416_100411930 3300032002 Unclassified 1393
426 Ga0307416_100430747 3300032002 Bacteria 1366
427 Ga0307414_10002794 3300032004 Bacteria 9192
428 Ga0307414_10088976 3300032004 Unclassified 2287
429 Ga0307411_10004628 3300032005 Bacteria 6625
430 Ga0307415_100017580 3300032126 Bacteria 4292
431 Ga0307415_100063379 3300032126 Bacteria 2568
432 Ga0307415_100185262 3300032126 Bacteria 1637
433 Ga0373949_0000002 3300035090 Bacteria 102187
434 Ga0373954_0137673 3300035118 Bacteria 1190
435 Ga0373961_0000007 3300035241 Bacteria 145618
436 Ga0316574_0068959 3300035398 Bacteria 2231
437 Ga0316582_0059239 3300036647 Bacteria 2451
438 Ga0316584_0004208 3300036712 Bacteria 9500
439 Ga0316584_0021012 3300036712 Bacteria 4741
440 Ga0395900_0104225 3300037418 Bacteria 2914
441 Ga0395898_0015621 3300037466 Bacteria 7783
442 Ga0395898_0041835 3300037466 Bacteria 4524
443 Ga0316581_0001779 3300037588 Bacteria 4983
444 Ga0395901_0228634 3300038443 Bacteria 1943
445 Ga0395901_0597298 3300038443 Bacteria 1113
446 Ga0439448_0014612 3300042005 Unclassified 2371
447 Ga0439458_0001329 3300042157 Bacteria 6241
448 Ga0466961_0108762 3300044693 Unclassified 1745
449 Ga0466959_0032900 3300045049 Unclassified 3838
450 Ga0466958_0048800 3300045836 Unclassified 2560
451 Ga0495582_0206352 3300046473 Bacteria 1123
452 Ga0495663_0000205 3300046525 Bacteria 23523
453 Ga0495598_0000026 3300046537 Bacteria 23756
454 Ga0495621_0000017 3300046539 Bacteria 32151
455 Ga0495634_0147998 3300046642 Unclassified 1487
456 Ga0495613_0118706 3300046689 Bacteria 1901
457 Ga0495672_0006640 3300047320 Bacteria 8889
458 Ga0496102_0009856 3300048905 Bacteria 8213
459 Ga0496102_0371516 3300048905 Unclassified 1346
460 Ga0496106_0016826 3300048909 Bacteria 5410
461 Ga0496106_0099674 3300048909 Bacteria 2252
462 Ga0496107_0014787 3300048910 Bacteria 5463
463 Ga0496108_0405714 3300048911 Bacteria 1190
464 Ga0496110_0547639 3300048913 Unclassified 1052
465 Ga0496111_0133108 3300048914 Bacteria 1841
466 Ga0496112_0179328 3300048915 Bacteria 2082
467 Ga0496112_0182205 3300048915 Bacteria 2064
468 Ga0496112_0191386 3300048915 Bacteria 2008
469 Ga0501291_001239 3300049514 Bacteria 2945
470 Ga0501299_005123 3300049522 Bacteria 1998
471 Ga0501038_0016873 3300049574 Bacteria 6610
472 Ga0501069_0107064 3300049585 Unclassified 1590
473 Ga0501074_0147183 3300049590 Bacteria 1684
474 Ga0501207_000932 3300049654 Bacteria 3522
475 Ga0501216_003201 3300049660 Bacteria 2377
476 Ga0501217_008628 3300049661 Bacteria 2205
477 Ga0501223_006284 3300049663 Bacteria 2464
478 Ga0501224_000630 3300049664 Bacteria 4341
479 Ga0501227_002526 3300049665 Bacteria 4042
480 Ga0501230_008936 3300049667 Bacteria 1529
481 Ga0501259_014066 3300049688 Unclassified 1352
482 Ga0501259_016877 3300049688 Bacteria 1260
483 Ga0501225_0000657 3300049705 Bacteria 10764
484 Ga0501234_001847 3300049707 Bacteria 3344
485 Ga0501283_007718 3300049779 Bacteria 1539
486 Ga0501283_016116 3300049779 Bacteria 1156
487 nmdc:mga05p37_134431_c1 3300050507 Bacteria 3034
488 nmdc:mga05p37_15372_c1 3300050507 Bacteria 9195
489 nmdc:mga05p37_17262_c1 3300050507 Bacteria 8706
490 nmdc:mga05p37_208510_c1 3300050507 Unclassified 2363
491 nmdc:mga05p37_26698_c1 3300050507 Bacteria 7023
492 nmdc:mga05p37_49287_c1 3300050507 Bacteria 5180
493 nmdc:mga05p37_50790_c1 3300050507 Bacteria 5100
494 nmdc:mga09592_187007_c1 3300050508 Bacteria 1792
495 nmdc:mga09592_26460_c1 3300050508 Bacteria 4806
496 nmdc:mga09592_63824_c1 3300050508 Bacteria 3118
497 nmdc:mga09592_66917_c1 3300050508 Bacteria 3046
498 nmdc:mga0qj67_52941_c1 3300050509 Unclassified 3213
499 nmdc:mga06r32_102485_c1 3300050510 Bacteria 2810
500 nmdc:mga08y16_37241_c1 3300050511 Bacteria 5110
501 nmdc:mga08y16_8785_c1 3300050511 Bacteria 10605
502 nmdc:mga0n895_246416_c1 3300050512 Bacteria 1813
503 nmdc:mga0n895_27684_c1 3300050512 Bacteria 5387
504 nmdc:mga0n895_326904_c1 3300050512 Bacteria 1554
505 nmdc:mga0n895_80823_c1 3300050512 Bacteria 3239
506 nmdc:mga08x19_11_c1 3300050514 Bacteria 403007
507 nmdc:mga08x19_1646_c2 3300050514 Bacteria 4644
508 nmdc:mga0a205_103911_c1 3300050515 Bacteria 2740
509 nmdc:mga0a205_152845_c1 3300050515 Unclassified 2207
510 nmdc:mga0a205_300533_c1 3300050515 Bacteria 1478
511 nmdc:mga0a205_34073_c2 3300050515 Bacteria 4529
512 nmdc:mga0a205_72441_c1 3300050515 Bacteria 3328
513 nmdc:mga0a205_75622_c1 3300050515 Bacteria 3254
514 nmdc:mga0a205_94478_c1 3300050515 Bacteria 2889
515 Ga0500566_0057126 3300053094 Bacteria 2217
516 Ga0500637_0035399 3300053178 Bacteria 2799

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0021012 Ga0316584_0021012_1631_2488 284
2 3300005295 Ga0065707_10002738 Ga0065707_100027386 290
3 3300003323 rootH1_10022019 rootH1_100220193 291
4 3300005471 Ga0070698_100001795 Ga0070698_1000017955 302
5 3300005444 Ga0070694_100084228 Ga0070694_1000842282 303
6 3300005547 Ga0070693_100152884 Ga0070693_1001528841 310
7 3300005549 Ga0070704_100106072 Ga0070704_1001060723 310
8 3300025910 Ga0207684_10216813 Ga0207684_102168131 310
9 3300025911 Ga0207654_10133429 Ga0207654_101334292 310
10 3300049590 Ga0501074_0147183 Ga0501074_0147183_210_1148 310
11 3300005536 Ga0070697_100043534 Ga0070697_1000435342 312
12 3300005340 Ga0070689_100068761 Ga0070689_1000687612 313
13 3300009148 Ga0105243_10178954 Ga0105243_101789542 313
14 3300025935 Ga0207709_10332697 Ga0207709_103326971 313
15 3300025936 Ga0207670_10019054 Ga0207670_100190542 313
16 3300025972 Ga0207668_10357318 Ga0207668_103573182 313
17 3300035118 Ga0373954_0137673 Ga0373954_0137673_70_1014 313
18 3300035241 Ga0373961_0000007 Ga0373961_0000007_109738_110682 313
19 3300044693 Ga0466961_0108762 Ga0466961_0108762_457_1467 313
20 3300045049 Ga0466959_0032900 Ga0466959_0032900_2148_3158 313
21 3300045836 Ga0466958_0048800 Ga0466958_0048800_712_1722 313
22 3300053094 Ga0500566_0057126 Ga0500566_0057126_799_1755 313
23 3300005334 Ga0068869_100085343 Ga0068869_1000853431 314
24 3300006844 Ga0075428_100199331 Ga0075428_1001993313 314
25 3300006880 Ga0075429_100010583 Ga0075429_1000105833 314
26 3300009177 Ga0105248_10027885 Ga0105248_100278852 314
27 3300014325 Ga0163163_10083312 Ga0163163_100833121 314
28 3300025941 Ga0207711_10017312 Ga0207711_100173125 314
29 3300025942 Ga0207689_10012682 Ga0207689_100126822 314
30 3300028653 Ga0265323_10014428 Ga0265323_100144283 314
31 3300031733 Ga0316577_10009237 Ga0316577_100092375 314
32 3300035398 Ga0316574_0068959 Ga0316574_0068959_112_1080 314
33 3300036647 Ga0316582_0059239 Ga0316582_0059239_127_1095 314
34 3300036712 Ga0316584_0004208 Ga0316584_0004208_5575_6543 314
35 3300037588 Ga0316581_0001779 Ga0316581_0001779_1622_2590 314
36 3300046642 Ga0495634_0147998 Ga0495634_0147998_432_1403 314
37 3300046689 Ga0495613_0118706 Ga0495613_0118706_849_1820 314
38 3300050508 nmdc:mga09592_63824_c1 nmdc:mga09592_63824_c1_949_1896 314
39 3300005937 Ga0081455_10004961 Ga0081455_1000496110 315
40 2162886012 MBSR1b_contig_3301288 MBSR1b_0093.00001840 316
41 3300005293 Ga0065715_10207950 Ga0065715_102079501 316
42 3300005365 Ga0070688_100215154 Ga0070688_1002151541 316
43 3300005367 Ga0070667_100066755 Ga0070667_1000667553 316
44 3300005564 Ga0070664_100102256 Ga0070664_1001022563 316
45 3300005578 Ga0068854_100140401 Ga0068854_1001404012 316
46 3300005617 Ga0068859_100050998 Ga0068859_1000509982 316
47 3300005844 Ga0068862_100036359 Ga0068862_1000363591 316
48 3300006173 Ga0070716_100000003 Ga0070716_10000000344 316
49 3300006844 Ga0075428_100038593 Ga0075428_1000385932 316
50 3300006844 Ga0075428_100082227 Ga0075428_1000822274 316
51 3300006847 Ga0075431_100057757 Ga0075431_1000577572 316
52 3300006852 Ga0075433_10000077 Ga0075433_1000007718 316
53 3300006852 Ga0075433_10076608 Ga0075433_100766082 316
54 3300006871 Ga0075434_100025117 Ga0075434_1000251173 316
55 3300006880 Ga0075429_100067081 Ga0075429_1000670812 316
56 3300006914 Ga0075436_100000430 Ga0075436_10000043016 316
57 3300006931 Ga0097620_100050999 Ga0097620_1000509992 316
58 3300009094 Ga0111539_10021046 Ga0111539_100210467 316
59 3300009094 Ga0111539_10060692 Ga0111539_100606923 316
60 3300009147 Ga0114129_10009464 Ga0114129_100094649 316
61 3300009148 Ga0105243_10000364 Ga0105243_1000036426 316
62 3300009176 Ga0105242_10000270 Ga0105242_1000027022 316
63 3300013297 Ga0157378_10064569 Ga0157378_100645693 316
64 3300014326 Ga0157380_10093930 Ga0157380_100939302 316
65 3300014745 Ga0157377_10180279 Ga0157377_101802792 316
66 3300025922 Ga0207646_10040132 Ga0207646_100401324 316
67 3300025925 Ga0207650_10246162 Ga0207650_102461622 316
68 3300025934 Ga0207686_10000039 Ga0207686_1000003953 316
69 3300025935 Ga0207709_10000192 Ga0207709_1000019253 316
70 3300025942 Ga0207689_10037623 Ga0207689_100376234 316
71 3300025961 Ga0207712_10061028 Ga0207712_100610282 316
72 3300025981 Ga0207640_10132510 Ga0207640_101325102 316
73 3300026089 Ga0207648_10384162 Ga0207648_103841621 316
74 3300026142 Ga0207698_10175242 Ga0207698_101752422 316
75 3300027907 Ga0207428_10022018 Ga0207428_100220182 316
76 3300027907 Ga0207428_10024065 Ga0207428_100240654 316
77 3300031731 Ga0307405_10125344 Ga0307405_101253441 316
78 3300031852 Ga0307410_10085158 Ga0307410_100851581 316
79 3300032004 Ga0307414_10088976 Ga0307414_100889762 316
80 3300032126 Ga0307415_100017580 Ga0307415_1000175803 316
81 3300049667 Ga0501230_008936 Ga0501230_008936_296_1246 316
82 3300050507 nmdc:mga05p37_17262_c1 nmdc:mga05p37_17262_c1_6026_7030 316
83 3300050507 nmdc:mga05p37_26698_c1 nmdc:mga05p37_26698_c1_54_1007 316
84 3300050508 nmdc:mga09592_187007_c1 nmdc:mga09592_187007_c1_336_1289 316
85 3300050508 nmdc:mga09592_66917_c1 nmdc:mga09592_66917_c1_656_1642 316
86 3300050510 nmdc:mga06r32_102485_c1 nmdc:mga06r32_102485_c1_365_1318 316
87 3300050511 nmdc:mga08y16_37241_c1 nmdc:mga08y16_37241_c1_3164_4117 316
88 3300050512 nmdc:mga0n895_27684_c1 nmdc:mga0n895_27684_c1_3574_4527 316
89 3300050514 nmdc:mga08x19_11_c1 nmdc:mga08x19_11_c1_155890_156855 316
90 3300050515 nmdc:mga0a205_72441_c1 nmdc:mga0a205_72441_c1_1413_2366 316
91 2162886012 MBSR1b_contig_6004661 MBSR1b_0496.00005250 317
92 3300005289 Ga0065704_10001172 Ga0065704_100011721 317
93 3300005289 Ga0065704_10005075 Ga0065704_100050751 317
94 3300005289 Ga0065704_10088859 Ga0065704_100888594 317
95 3300005290 Ga0065712_10000113 Ga0065712_1000011388 317
96 3300005293 Ga0065715_10001857 Ga0065715_100018571 317
97 3300005293 Ga0065715_10090791 Ga0065715_100907914 317
98 3300005293 Ga0065715_10218360 Ga0065715_102183601 317
99 3300005295 Ga0065707_10000618 Ga0065707_100006186 317
100 3300005295 Ga0065707_10128044 Ga0065707_101280443 317
101 3300005330 Ga0070690_100047136 Ga0070690_1000471362 317
102 3300005330 Ga0070690_100119598 Ga0070690_1001195982 317
103 3300005330 Ga0070690_100229610 Ga0070690_1002296101 317
104 3300005331 Ga0070670_100442728 Ga0070670_1004427281 317
105 3300005334 Ga0068869_100012238 Ga0068869_1000122383 317
106 3300005334 Ga0068869_100017229 Ga0068869_1000172293 317
107 3300005334 Ga0068869_100022585 Ga0068869_1000225854 317
108 3300005336 Ga0070680_100000139 Ga0070680_1000001398 317
109 3300005336 Ga0070680_100059028 Ga0070680_1000590285 317
110 3300005336 Ga0070680_100194367 Ga0070680_1001943672 317
111 3300005337 Ga0070682_100007777 Ga0070682_1000077775 317
112 3300005338 Ga0068868_100018825 Ga0068868_1000188253 317
113 3300005338 Ga0068868_100073096 Ga0068868_1000730964 317
114 3300005339 Ga0070660_100249885 Ga0070660_1002498851 317
115 3300005340 Ga0070689_100000520 Ga0070689_1000005206 317
116 3300005343 Ga0070687_100126646 Ga0070687_1001266461 317
117 3300005345 Ga0070692_10001914 Ga0070692_100019147 317
118 3300005345 Ga0070692_10036942 Ga0070692_100369423 317
119 3300005345 Ga0070692_10074714 Ga0070692_100747142 317
120 3300005354 Ga0070675_100041509 Ga0070675_1000415093 317
121 3300005354 Ga0070675_100116928 Ga0070675_1001169282 317
122 3300005355 Ga0070671_100002973 Ga0070671_1000029734 317
123 3300005355 Ga0070671_100031196 Ga0070671_1000311964 317
124 3300005364 Ga0070673_100013543 Ga0070673_1000135434 317
125 3300005364 Ga0070673_100137978 Ga0070673_1001379781 317
126 3300005365 Ga0070688_100133781 Ga0070688_1001337812 317
127 3300005366 Ga0070659_100000997 Ga0070659_10000099711 317
128 3300005367 Ga0070667_100063879 Ga0070667_1000638793 317
129 3300005406 Ga0070703_10051880 Ga0070703_100518801 317
130 3300005438 Ga0070701_10039966 Ga0070701_100399664 317
131 3300005438 Ga0070701_10044685 Ga0070701_100446852 317
132 3300005438 Ga0070701_10098483 Ga0070701_100984831 317
133 3300005440 Ga0070705_100010487 Ga0070705_1000104872 317
134 3300005441 Ga0070700_100000070 Ga0070700_10000007014 317
135 3300005441 Ga0070700_100011545 Ga0070700_1000115456 317
136 3300005441 Ga0070700_100019262 Ga0070700_1000192622 317
137 3300005441 Ga0070700_100121209 Ga0070700_1001212091 317
138 3300005441 Ga0070700_100249245 Ga0070700_1002492451 317
139 3300005444 Ga0070694_100007993 Ga0070694_1000079933 317
140 3300005444 Ga0070694_100010270 Ga0070694_1000102702 317
141 3300005444 Ga0070694_100039347 Ga0070694_1000393474 317
142 3300005444 Ga0070694_100113077 Ga0070694_1001130772 317
143 3300005445 Ga0070708_100000712 Ga0070708_10000071210 317
144 3300005445 Ga0070708_100120462 Ga0070708_1001204622 317
145 3300005458 Ga0070681_10000652 Ga0070681_1000065217 317
146 3300005458 Ga0070681_10007377 Ga0070681_100073775 317
147 3300005458 Ga0070681_10017148 Ga0070681_100171486 317
148 3300005458 Ga0070681_10025235 Ga0070681_100252353 317
149 3300005459 Ga0068867_100055514 Ga0068867_1000555142 317
150 3300005459 Ga0068867_100221565 Ga0068867_1002215651 317
151 3300005459 Ga0068867_100370004 Ga0068867_1003700041 317
152 3300005466 Ga0070685_10008200 Ga0070685_100082001 317
153 3300005467 Ga0070706_100000019 Ga0070706_10000001987 317
154 3300005467 Ga0070706_100071143 Ga0070706_1000711431 317
155 3300005467 Ga0070706_100209630 Ga0070706_1002096301 317
156 3300005467 Ga0070706_100228410 Ga0070706_1002284102 317
157 3300005467 Ga0070706_100296151 Ga0070706_1002961511 317
158 3300005468 Ga0070707_100074187 Ga0070707_1000741872 317
159 3300005468 Ga0070707_100347907 Ga0070707_1003479071 317
160 3300005471 Ga0070698_100011347 Ga0070698_1000113474 317
161 3300005471 Ga0070698_100027198 Ga0070698_1000271981 317
162 3300005471 Ga0070698_100100096 Ga0070698_1001000962 317
163 3300005471 Ga0070698_100512394 Ga0070698_1005123941 317
164 3300005518 Ga0070699_100000762 Ga0070699_10000076213 317
165 3300005518 Ga0070699_100009442 Ga0070699_1000094424 317
166 3300005518 Ga0070699_100037327 Ga0070699_1000373272 317
167 3300005518 Ga0070699_100445537 Ga0070699_1004455371 317
168 3300005530 Ga0070679_100000059 Ga0070679_1000000596 317
169 3300005530 Ga0070679_100010562 Ga0070679_1000105626 317
170 3300005536 Ga0070697_100024734 Ga0070697_1000247341 317
171 3300005536 Ga0070697_100122860 Ga0070697_1001228603 317
172 3300005536 Ga0070697_100268934 Ga0070697_1002689341 317
173 3300005536 Ga0070697_100282925 Ga0070697_1002829252 317
174 3300005539 Ga0068853_100001826 Ga0068853_10000182619 317
175 3300005539 Ga0068853_100004548 Ga0068853_1000045486 317
176 3300005539 Ga0068853_100045901 Ga0068853_1000459013 317
177 3300005539 Ga0068853_100090772 Ga0068853_1000907722 317
178 3300005539 Ga0068853_100598090 Ga0068853_1005980901 317
179 3300005543 Ga0070672_100027332 Ga0070672_1000273322 317
180 3300005544 Ga0070686_100007489 Ga0070686_1000074894 317
181 3300005544 Ga0070686_100071852 Ga0070686_1000718522 317
182 3300005545 Ga0070695_100134619 Ga0070695_1001346192 317
183 3300005545 Ga0070695_100285215 Ga0070695_1002852151 317
184 3300005545 Ga0070695_100288040 Ga0070695_1002880401 317
185 3300005545 Ga0070695_100372115 Ga0070695_1003721151 317
186 3300005546 Ga0070696_100013272 Ga0070696_1000132721 317
187 3300005546 Ga0070696_100095392 Ga0070696_1000953922 317
188 3300005546 Ga0070696_100123152 Ga0070696_1001231523 317
189 3300005546 Ga0070696_100123346 Ga0070696_1001233462 317
190 3300005547 Ga0070693_100047820 Ga0070693_1000478202 317
191 3300005548 Ga0070665_100143185 Ga0070665_1001431852 317
192 3300005549 Ga0070704_100254165 Ga0070704_1002541651 317
193 3300005564 Ga0070664_100002145 Ga0070664_1000021457 317
194 3300005577 Ga0068857_100027600 Ga0068857_1000276006 317
195 3300005577 Ga0068857_100113682 Ga0068857_1001136824 317
196 3300005614 Ga0068856_100008069 Ga0068856_1000080698 317
197 3300005614 Ga0068856_100261964 Ga0068856_1002619642 317
198 3300005615 Ga0070702_100034128 Ga0070702_1000341282 317
199 3300005615 Ga0070702_100060805 Ga0070702_1000608054 317
200 3300005615 Ga0070702_100140205 Ga0070702_1001402052 317
201 3300005616 Ga0068852_100116876 Ga0068852_1001168762 317
202 3300005616 Ga0068852_100147223 Ga0068852_1001472232 317
203 3300005617 Ga0068859_100008267 Ga0068859_1000082679 317
204 3300005617 Ga0068859_100032356 Ga0068859_1000323562 317
205 3300005617 Ga0068859_100061392 Ga0068859_1000613923 317
206 3300005617 Ga0068859_100092564 Ga0068859_1000925642 317
207 3300005617 Ga0068859_100150640 Ga0068859_1001506402 317
208 3300005617 Ga0068859_100283359 Ga0068859_1002833592 317
209 3300005618 Ga0068864_100045057 Ga0068864_1000450574 317
210 3300005618 Ga0068864_100119744 Ga0068864_1001197442 317
211 3300005718 Ga0068866_10006288 Ga0068866_100062884 317
212 3300005719 Ga0068861_100028204 Ga0068861_1000282044 317
213 3300005719 Ga0068861_100052147 Ga0068861_1000521474 317
214 3300005719 Ga0068861_100121128 Ga0068861_1001211282 317
215 3300005719 Ga0068861_100155255 Ga0068861_1001552551 317
216 3300005840 Ga0068870_10082529 Ga0068870_100825291 317
217 3300005841 Ga0068863_100007143 Ga0068863_1000071439 317
218 3300005841 Ga0068863_100050260 Ga0068863_1000502604 317
219 3300005841 Ga0068863_100168029 Ga0068863_1001680292 317
220 3300005841 Ga0068863_100169635 Ga0068863_1001696353 317
221 3300005842 Ga0068858_100021547 Ga0068858_1000215473 317
222 3300005842 Ga0068858_100050959 Ga0068858_1000509593 317
223 3300005843 Ga0068860_100035364 Ga0068860_1000353644 317
224 3300005843 Ga0068860_100051684 Ga0068860_1000516845 317
225 3300005843 Ga0068860_100082106 Ga0068860_1000821062 317
226 3300005844 Ga0068862_100003110 Ga0068862_10000311010 317
227 3300005844 Ga0068862_100012756 Ga0068862_1000127563 317
228 3300005985 Ga0081539_10001629 Ga0081539_100016296 317
229 3300006173 Ga0070716_100066083 Ga0070716_1000660832 317
230 3300006237 Ga0097621_100055478 Ga0097621_1000554783 317
231 3300006237 Ga0097621_100151118 Ga0097621_1001511181 317
232 3300006237 Ga0097621_100159992 Ga0097621_1001599921 317
233 3300006358 Ga0068871_100087187 Ga0068871_1000871874 317
234 3300006358 Ga0068871_100145501 Ga0068871_1001455012 317
235 3300006846 Ga0075430_100052936 Ga0075430_1000529361 317
236 3300006847 Ga0075431_100196345 Ga0075431_1001963452 317
237 3300006847 Ga0075431_100236852 Ga0075431_1002368521 317
238 3300006852 Ga0075433_10019790 Ga0075433_100197901 317
239 3300006852 Ga0075433_10032906 Ga0075433_100329064 317
240 3300006852 Ga0075433_10043355 Ga0075433_100433554 317
241 3300006852 Ga0075433_10104959 Ga0075433_101049595 317
242 3300006852 Ga0075433_10127699 Ga0075433_101276992 317
243 3300006852 Ga0075433_10154970 Ga0075433_101549702 317
244 3300006852 Ga0075433_10319457 Ga0075433_103194572 317
245 3300006871 Ga0075434_100077273 Ga0075434_1000772732 317
246 3300006871 Ga0075434_100450137 Ga0075434_1004501372 317
247 3300006881 Ga0068865_100006970 Ga0068865_1000069703 317
248 3300006881 Ga0068865_100221713 Ga0068865_1002217132 317
249 3300006914 Ga0075436_100005320 Ga0075436_1000053205 317
250 3300006931 Ga0097620_100008267 Ga0097620_1000082679 317
251 3300006931 Ga0097620_100032360 Ga0097620_1000323602 317
252 3300006931 Ga0097620_100061392 Ga0097620_1000613923 317
253 3300006931 Ga0097620_100092566 Ga0097620_1000925662 317
254 3300006931 Ga0097620_100150640 Ga0097620_1001506402 317
255 3300006931 Ga0097620_100283359 Ga0097620_1002833592 317
256 3300009093 Ga0105240_10032438 Ga0105240_100324383 317
257 3300009093 Ga0105240_10052115 Ga0105240_100521156 317
258 3300009094 Ga0111539_10000931 Ga0111539_100009316 317
259 3300009094 Ga0111539_10033381 Ga0111539_100333817 317
260 3300009094 Ga0111539_10081967 Ga0111539_100819672 317
261 3300009098 Ga0105245_10025941 Ga0105245_100259412 317
262 3300009101 Ga0105247_10079679 Ga0105247_100796792 317
263 3300009147 Ga0114129_10007505 Ga0114129_100075058 317
264 3300009147 Ga0114129_10053293 Ga0114129_100532933 317
265 3300009147 Ga0114129_10059719 Ga0114129_100597194 317
266 3300009147 Ga0114129_10086283 Ga0114129_100862833 317
267 3300009147 Ga0114129_10776519 Ga0114129_107765191 317
268 3300009148 Ga0105243_10010652 Ga0105243_100106521 317
269 3300009148 Ga0105243_10039358 Ga0105243_100393582 317
270 3300009148 Ga0105243_10263664 Ga0105243_102636641 317
271 3300009148 Ga0105243_10443689 Ga0105243_104436892 317
272 3300009174 Ga0105241_10037464 Ga0105241_100374642 317
273 3300009174 Ga0105241_10056946 Ga0105241_100569464 317
274 3300009174 Ga0105241_10076283 Ga0105241_100762831 317
275 3300009176 Ga0105242_10055842 Ga0105242_100558421 317
276 3300009176 Ga0105242_10322279 Ga0105242_103222792 317
277 3300009177 Ga0105248_10006116 Ga0105248_100061167 317
278 3300009177 Ga0105248_10013612 Ga0105248_100136129 317
279 3300009177 Ga0105248_10082984 Ga0105248_100829842 317
280 3300009177 Ga0105248_10088171 Ga0105248_100881713 317
281 3300009177 Ga0105248_10102545 Ga0105248_101025452 317
282 3300009177 Ga0105248_10113874 Ga0105248_101138742 317
283 3300009545 Ga0105237_10002452 Ga0105237_1000245212 317
284 3300009551 Ga0105238_10005750 Ga0105238_100057509 317
285 3300010375 Ga0105239_10023464 Ga0105239_100234645 317
286 3300010375 Ga0105239_10246922 Ga0105239_102469223 317
287 3300011119 Ga0105246_10077510 Ga0105246_100775102 317
288 3300011119 Ga0105246_10106984 Ga0105246_101069842 317
289 3300013100 Ga0157373_10001793 Ga0157373_100017939 317
290 3300013105 Ga0157369_10062528 Ga0157369_100625283 317
291 3300013296 Ga0157374_10051995 Ga0157374_100519953 317
292 3300013297 Ga0157378_10051258 Ga0157378_100512583 317
293 3300013297 Ga0157378_10073860 Ga0157378_100738602 317
294 3300013297 Ga0157378_10078110 Ga0157378_100781102 317
295 3300013297 Ga0157378_10092539 Ga0157378_100925392 317
296 3300013306 Ga0163162_10000506 Ga0163162_100005062 317
297 3300013306 Ga0163162_10028650 Ga0163162_100286501 317
298 3300013306 Ga0163162_10037254 Ga0163162_100372544 317
299 3300013306 Ga0163162_10047474 Ga0163162_100474742 317
300 3300013306 Ga0163162_10056297 Ga0163162_100562973 317
301 3300013306 Ga0163162_10096655 Ga0163162_100966554 317
302 3300013307 Ga0157372_10003813 Ga0157372_1000381311 317
303 3300013307 Ga0157372_10102117 Ga0157372_101021172 317
304 3300013307 Ga0157372_10105276 Ga0157372_101052762 317
305 3300013308 Ga0157375_10020001 Ga0157375_100200013 317
306 3300013308 Ga0157375_10060945 Ga0157375_100609454 317
307 3300013308 Ga0157375_10222652 Ga0157375_102226522 317
308 3300013308 Ga0157375_10390474 Ga0157375_103904742 317
309 3300014325 Ga0163163_10003818 Ga0163163_100038186 317
310 3300014325 Ga0163163_10003828 Ga0163163_1000382813 317
311 3300014325 Ga0163163_10055145 Ga0163163_100551454 317
312 3300014325 Ga0163163_10068061 Ga0163163_100680613 317
313 3300014325 Ga0163163_10078283 Ga0163163_100782833 317
314 3300014325 Ga0163163_10286952 Ga0163163_102869523 317
315 3300014326 Ga0157380_10002797 Ga0157380_100027973 317
316 3300014326 Ga0157380_10043600 Ga0157380_100436002 317
317 3300014326 Ga0157380_10066004 Ga0157380_100660042 317
318 3300014326 Ga0157380_10092640 Ga0157380_100926404 317
319 3300014969 Ga0157376_10008505 Ga0157376_100085058 317
320 3300014969 Ga0157376_10025139 Ga0157376_100251392 317
321 3300014969 Ga0157376_10454756 Ga0157376_104547561 317
322 3300017792 Ga0163161_10016077 Ga0163161_100160773 317
323 3300017792 Ga0163161_10017409 Ga0163161_100174094 317
324 3300017792 Ga0163161_10091613 Ga0163161_100916132 317
325 3300025315 Ga0207697_10007114 Ga0207697_100071143 317
326 3300025885 Ga0207653_10009486 Ga0207653_100094863 317
327 3300025908 Ga0207643_10018228 Ga0207643_100182282 317
328 3300025908 Ga0207643_10038185 Ga0207643_100381851 317
329 3300025908 Ga0207643_10040350 Ga0207643_100403504 317
330 3300025908 Ga0207643_10180533 Ga0207643_101805332 317
331 3300025910 Ga0207684_10000079 Ga0207684_10000079143 317
332 3300025910 Ga0207684_10038188 Ga0207684_100381883 317
333 3300025911 Ga0207654_10043026 Ga0207654_100430264 317
334 3300025911 Ga0207654_10147894 Ga0207654_101478942 317
335 3300025911 Ga0207654_10235679 Ga0207654_102356791 317
336 3300025912 Ga0207707_10000008 Ga0207707_1000000817 317
337 3300025912 Ga0207707_10049229 Ga0207707_100492291 317
338 3300025912 Ga0207707_10096179 Ga0207707_100961792 317
339 3300025914 Ga0207671_10002542 Ga0207671_100025426 317
340 3300025914 Ga0207671_10181156 Ga0207671_101811562 317
341 3300025917 Ga0207660_10000437 Ga0207660_1000043715 317
342 3300025917 Ga0207660_10043834 Ga0207660_100438345 317
343 3300025917 Ga0207660_10046994 Ga0207660_100469943 317
344 3300025918 Ga0207662_10131348 Ga0207662_101313481 317
345 3300025920 Ga0207649_10076995 Ga0207649_100769952 317
346 3300025921 Ga0207652_10000085 Ga0207652_1000008571 317
347 3300025921 Ga0207652_10015613 Ga0207652_100156132 317
348 3300025921 Ga0207652_10026033 Ga0207652_100260335 317
349 3300025921 Ga0207652_10370554 Ga0207652_103705542 317
350 3300025922 Ga0207646_10305877 Ga0207646_103058771 317
351 3300025923 Ga0207681_10025813 Ga0207681_100258134 317
352 3300025924 Ga0207694_10024149 Ga0207694_100241492 317
353 3300025926 Ga0207659_10401591 Ga0207659_104015911 317
354 3300025933 Ga0207706_10207515 Ga0207706_102075151 317
355 3300025935 Ga0207709_10065908 Ga0207709_100659082 317
356 3300025938 Ga0207704_10175567 Ga0207704_101755672 317
357 3300025940 Ga0207691_10000845 Ga0207691_100008458 317
358 3300025940 Ga0207691_10029652 Ga0207691_100296522 317
359 3300025941 Ga0207711_10002073 Ga0207711_100020734 317
360 3300025941 Ga0207711_10044446 Ga0207711_100444462 317
361 3300025941 Ga0207711_10073559 Ga0207711_100735592 317
362 3300025941 Ga0207711_10089815 Ga0207711_100898152 317
363 3300025942 Ga0207689_10001578 Ga0207689_1000157815 317
364 3300025942 Ga0207689_10021423 Ga0207689_100214232 317
365 3300025942 Ga0207689_10116476 Ga0207689_101164763 317
366 3300025960 Ga0207651_10400778 Ga0207651_104007781 317
367 3300026023 Ga0207677_10041972 Ga0207677_100419724 317
368 3300026023 Ga0207677_10092923 Ga0207677_100929233 317
369 3300026035 Ga0207703_10045150 Ga0207703_100451503 317
370 3300026035 Ga0207703_10085256 Ga0207703_100852562 317
371 3300026035 Ga0207703_10287287 Ga0207703_102872871 317
372 3300026041 Ga0207639_10001389 Ga0207639_100013894 317
373 3300026041 Ga0207639_10111247 Ga0207639_101112472 317
374 3300026041 Ga0207639_10499378 Ga0207639_104993781 317
375 3300026075 Ga0207708_10000094 Ga0207708_100000946 317
376 3300026075 Ga0207708_10005226 Ga0207708_1000522610 317
377 3300026075 Ga0207708_10052463 Ga0207708_100524632 317
378 3300026075 Ga0207708_10101164 Ga0207708_101011642 317
379 3300026075 Ga0207708_10163001 Ga0207708_101630012 317
380 3300026075 Ga0207708_10217873 Ga0207708_102178731 317
381 3300026078 Ga0207702_10007133 Ga0207702_100071335 317
382 3300026078 Ga0207702_10226166 Ga0207702_102261662 317
383 3300026088 Ga0207641_10045239 Ga0207641_100452392 317
384 3300026088 Ga0207641_10047514 Ga0207641_100475142 317
385 3300026088 Ga0207641_10245324 Ga0207641_102453242 317
386 3300026089 Ga0207648_10009944 Ga0207648_100099443 317
387 3300026089 Ga0207648_10143314 Ga0207648_101433142 317
388 3300026089 Ga0207648_10294766 Ga0207648_102947662 317
389 3300026095 Ga0207676_10017608 Ga0207676_100176084 317
390 3300026095 Ga0207676_10070435 Ga0207676_100704354 317
391 3300026095 Ga0207676_10104941 Ga0207676_101049412 317
392 3300026095 Ga0207676_10140707 Ga0207676_101407073 317
393 3300026095 Ga0207676_10215729 Ga0207676_102157292 317
394 3300026116 Ga0207674_10002177 Ga0207674_1000217713 317
395 3300026116 Ga0207674_10120512 Ga0207674_101205124 317
396 3300026116 Ga0207674_10180392 Ga0207674_101803922 317
397 3300026118 Ga0207675_100008853 Ga0207675_1000088534 317
398 3300026118 Ga0207675_100052030 Ga0207675_1000520302 317
399 3300026118 Ga0207675_100133362 Ga0207675_1001333621 317
400 3300026118 Ga0207675_100352086 Ga0207675_1003520861 317
401 3300026121 Ga0207683_10369349 Ga0207683_103693491 317
402 3300026142 Ga0207698_10191126 Ga0207698_101911262 317
403 3300026142 Ga0207698_10248917 Ga0207698_102489172 317
404 3300027907 Ga0207428_10000547 Ga0207428_1000054726 317
405 3300028379 Ga0268266_10107286 Ga0268266_101072862 317
406 3300028379 Ga0268266_10286091 Ga0268266_102860912 317
407 3300028380 Ga0268265_10063476 Ga0268265_100634762 317
408 3300028381 Ga0268264_10100442 Ga0268264_101004424 317
409 3300028381 Ga0268264_10153247 Ga0268264_101532471 317
410 3300028381 Ga0268264_10159320 Ga0268264_101593202 317
411 3300028794 Ga0307515_10003491 Ga0307515_1000349110 317
412 3300031238 Ga0265332_10008807 Ga0265332_100088077 317
413 3300031731 Ga0307405_10156630 Ga0307405_101566301 317
414 3300031824 Ga0307413_10050646 Ga0307413_100506462 317
415 3300031901 Ga0307406_10107008 Ga0307406_101070081 317
416 3300031911 Ga0307412_10136054 Ga0307412_101360542 317
417 3300032002 Ga0307416_100411930 Ga0307416_1004119302 317
418 3300032002 Ga0307416_100430747 Ga0307416_1004307471 317
419 3300032004 Ga0307414_10002794 Ga0307414_100027944 317
420 3300032005 Ga0307411_10004628 Ga0307411_100046284 317
421 3300032126 Ga0307415_100063379 Ga0307415_1000633792 317
422 3300032126 Ga0307415_100185262 Ga0307415_1001852622 317
423 3300035090 Ga0373949_0000002 Ga0373949_0000002_95481_96575 317
424 3300037418 Ga0395900_0104225 Ga0395900_0104225_1927_2880 317
425 3300037466 Ga0395898_0015621 Ga0395898_0015621_3621_4574 317
426 3300037466 Ga0395898_0041835 Ga0395898_0041835_954_1910 317
427 3300038443 Ga0395901_0228634 Ga0395901_0228634_662_1615 317
428 3300038443 Ga0395901_0597298 Ga0395901_0597298_106_1059 317
429 3300042005 Ga0439448_0014612 Ga0439448_0014612_1113_2066 317
430 3300042157 Ga0439458_0001329 Ga0439458_0001329_395_1348 317
431 3300046473 Ga0495582_0206352 Ga0495582_0206352_104_1057 317
432 3300048905 Ga0496102_0009856 Ga0496102_0009856_3618_4577 317
433 3300048905 Ga0496102_0371516 Ga0496102_0371516_75_1028 317
434 3300048909 Ga0496106_0016826 Ga0496106_0016826_2681_3634 317
435 3300048909 Ga0496106_0099674 Ga0496106_0099674_100_1059 317
436 3300048910 Ga0496107_0014787 Ga0496107_0014787_1978_2931 317
437 3300048911 Ga0496108_0405714 Ga0496108_0405714_31_990 317
438 3300048913 Ga0496110_0547639 Ga0496110_0547639_20_973 317
439 3300048914 Ga0496111_0133108 Ga0496111_0133108_42_1001 317
440 3300048915 Ga0496112_0179328 Ga0496112_0179328_325_1281 317
441 3300048915 Ga0496112_0182205 Ga0496112_0182205_817_1770 317
442 3300048915 Ga0496112_0191386 Ga0496112_0191386_978_1931 317
443 3300049514 Ga0501291_001239 Ga0501291_001239_1939_2925 317
444 3300049522 Ga0501299_005123 Ga0501299_005123_992_1978 317
445 3300049574 Ga0501038_0016873 Ga0501038_0016873_5074_6027 317
446 3300049585 Ga0501069_0107064 Ga0501069_0107064_187_1140 317
447 3300049654 Ga0501207_000932 Ga0501207_000932_2156_3109 317
448 3300049660 Ga0501216_003201 Ga0501216_003201_23_991 317
449 3300049661 Ga0501217_008628 Ga0501217_008628_357_1310 317
450 3300049663 Ga0501223_006284 Ga0501223_006284_646_1614 317
451 3300049664 Ga0501224_000630 Ga0501224_000630_1961_2914 317
452 3300049665 Ga0501227_002526 Ga0501227_002526_954_1907 317
453 3300049688 Ga0501259_014066 Ga0501259_014066_41_1009 317
454 3300049688 Ga0501259_016877 Ga0501259_016877_275_1228 317
455 3300049705 Ga0501225_0000657 Ga0501225_0000657_2220_3173 317
456 3300049707 Ga0501234_001847 Ga0501234_001847_1775_2728 317
457 3300049779 Ga0501283_007718 Ga0501283_007718_244_1212 317
458 3300049779 Ga0501283_016116 Ga0501283_016116_46_999 317
459 3300050507 nmdc:mga05p37_134431_c1 nmdc:mga05p37_134431_c1_2001_2960 317
460 3300050507 nmdc:mga05p37_15372_c1 nmdc:mga05p37_15372_c1_5659_6612 317
461 3300050507 nmdc:mga05p37_208510_c1 nmdc:mga05p37_208510_c1_500_1453 317
462 3300050507 nmdc:mga05p37_49287_c1 nmdc:mga05p37_49287_c1_1588_2541 317
463 3300050507 nmdc:mga05p37_50790_c1 nmdc:mga05p37_50790_c1_2463_3416 317
464 3300050508 nmdc:mga09592_26460_c1 nmdc:mga09592_26460_c1_1234_2187 317
465 3300050509 nmdc:mga0qj67_52941_c1 nmdc:mga0qj67_52941_c1_1500_2453 317
466 3300050511 nmdc:mga08y16_8785_c1 nmdc:mga08y16_8785_c1_8711_9664 317
467 3300050512 nmdc:mga0n895_246416_c1 nmdc:mga0n895_246416_c1_176_1135 317
468 3300050512 nmdc:mga0n895_326904_c1 nmdc:mga0n895_326904_c1_87_1040 317
469 3300050512 nmdc:mga0n895_80823_c1 nmdc:mga0n895_80823_c1_336_1298 317
470 3300050514 nmdc:mga08x19_1646_c2 nmdc:mga08x19_1646_c2_236_1189 317
471 3300050515 nmdc:mga0a205_103911_c1 nmdc:mga0a205_103911_c1_1109_2071 317
472 3300050515 nmdc:mga0a205_152845_c1 nmdc:mga0a205_152845_c1_264_1217 317
473 3300050515 nmdc:mga0a205_300533_c1 nmdc:mga0a205_300533_c1_129_1088 317
474 3300050515 nmdc:mga0a205_34073_c2 nmdc:mga0a205_34073_c2_884_1837 317
475 3300050515 nmdc:mga0a205_75622_c1 nmdc:mga0a205_75622_c1_1708_2661 317
476 3300050515 nmdc:mga0a205_94478_c1 nmdc:mga0a205_94478_c1_1558_2511 317
477 3300053178 Ga0500637_0035399 Ga0500637_0035399_800_1780 317
478 3300005445 Ga0070708_100201526 Ga0070708_1002015262 319
479 3300005471 Ga0070698_100122266 Ga0070698_1001222662 319
480 3300005518 Ga0070699_100028441 Ga0070699_1000284415 319
481 3300005536 Ga0070697_100000042 Ga0070697_10000004235 319
482 2162886007 SwRhRL2b_contig_1244686 SwRhRL2b_0092.00001370 320
483 3300005289 Ga0065704_10080862 Ga0065704_100808624 320
484 3300005293 Ga0065715_10091179 Ga0065715_100911794 320
485 3300005293 Ga0065715_10209568 Ga0065715_102095681 320
486 3300005295 Ga0065707_10240432 Ga0065707_102404321 320
487 3300005331 Ga0070670_100001205 Ga0070670_10000120513 320
488 3300005334 Ga0068869_100029900 Ga0068869_1000299005 320
489 3300005337 Ga0070682_100000051 Ga0070682_10000005190 320
490 3300005438 Ga0070701_10086495 Ga0070701_100864952 320
491 3300005440 Ga0070705_100061538 Ga0070705_1000615383 320
492 3300005440 Ga0070705_100083776 Ga0070705_1000837762 320
493 3300005444 Ga0070694_100154274 Ga0070694_1001542741 320
494 3300005444 Ga0070694_100272810 Ga0070694_1002728101 320
495 3300005467 Ga0070706_100019218 Ga0070706_1000192182 320
496 3300005471 Ga0070698_100010300 Ga0070698_1000103007 320
497 3300005471 Ga0070698_100015979 Ga0070698_1000159793 320
498 3300005536 Ga0070697_100003739 Ga0070697_1000037396 320
499 3300005544 Ga0070686_100014669 Ga0070686_1000146692 320
500 3300005545 Ga0070695_100229709 Ga0070695_1002297091 320
501 3300005546 Ga0070696_100239671 Ga0070696_1002396711 320
502 3300005549 Ga0070704_100123251 Ga0070704_1001232512 320
503 3300005549 Ga0070704_100537424 Ga0070704_1005374241 320
504 3300009148 Ga0105243_10070485 Ga0105243_100704851 320
505 3300009148 Ga0105243_10103913 Ga0105243_101039132 320
506 3300013297 Ga0157378_10069987 Ga0157378_100699871 320
507 3300014326 Ga0157380_10042001 Ga0157380_100420013 320
508 3300025910 Ga0207684_10001129 Ga0207684_100011295 320
509 3300025925 Ga0207650_10000675 Ga0207650_1000067519 320
510 3300025935 Ga0207709_10047006 Ga0207709_100470063 320
511 3300025942 Ga0207689_10005172 Ga0207689_100051721 320
512 3300025960 Ga0207651_10084175 Ga0207651_100841752 320
513 3300046525 Ga0495663_0000205 Ga0495663_0000205_2861_3823 320
514 3300046537 Ga0495598_0000026 Ga0495598_0000026_5023_5985 320
515 3300046539 Ga0495621_0000017 Ga0495621_0000017_24903_25865 320
516 3300047320 Ga0495672_0006640 Ga0495672_0006640_4702_5664 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

84

189

0.92

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

228

345

0.91

PF16912

Glu_dehyd_C

Glucose dehydrogenase C-terminus

193

380

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qe3-assembly1.cif.gz_A sheep liver sorbitol dehydrogenase 0.9178 2 320
4ejm-assembly1.cif.gz_A crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to nadp 0.9152 2 320
4ilk-assembly1.cif.gz_A crystal structure of short chain alcohol dehydrogenase (rspb) from e. coli cft073 (efi target efi-506413) complexed with cofactor nadh 0.915 1 320
1pl6-assembly1.cif.gz_A human sdh/nadh/inhibitor complex 0.9149 2 320
4uej-assembly1.cif.gz_A closed state of galactitol-1-phosphate 5-dehydrogenase from e. coli in complex with glycerol. 0.9135 1 320
ID Description Score Start End Superfamily
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9488 154 183 3.50.50.60
af_I1JQG5_3_382_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9285 155 186 3.50.50.60
af_A0A1D6E3F3_39_301_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9206 155 187 3.50.50.60
af_Q54H99_9_164_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9156 154 186 3.50.50.60
af_F1Q713_10_342_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9152 6 313 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A353CC17-F1-model_v4 Dehydrogenase 0.9867 1 133
AF-A0A1X4G6N6-F1-model_v4 Alcohol dehydrogenase 0.9741 1 320
AF-A0A447G1P2-F1-model_v4 deleted 0.9725 1 320
AF-A0A496TK90-F1-model_v4 Alcohol dehydrogenase 0.9713 1 320
AF-A0A447G1P2-F1-model_v4 deleted 0.9694 1 320

Feature Viewer

pLDDT pTM Quality
94.34 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map