F457967
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 516 | 212 | 516 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100201526|Ga0070708_1002015262 |
| Length | 382 |
| Sequence | MQYCLGKRISSGGCRSQLLVVNRLLNSLPRMFTRERRVSEVGQAFLPVTRFKEEDRQECLSYFMKALRVEKKKLAVREIEKPVRGEEALVRVLLSGICNTDLEIARGYAGFKGTIGHEFVGVVEEASERSMVGQRVVGEINAGCGACELCTAGDPRHCQSRTVLGIVGRDGAHAEFLRLPLRNLTAVPDKVVDEHAVFTEPLAAAWGVLECVTIRSTDRIAVIGDGKLGLLCAQVLALSGAAVLLIGKHADKLRIAERRGIETATVKSVAKRTRDFDVVVEASGSPSGFTGALELLRPRGVLVLKSTLQGAGPAEFDRTRLVVDEITILGSRCGRFQPALDLLKKGAIDIDSLISEEYPLARGVYAMERAGRKGVMKVFLRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 146 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 147 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 149 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 150 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 151 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 152 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 155 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 156 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 157 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 158 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 162 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 163 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 169 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 170 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 171 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 172 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 173 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 182 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 183 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 185 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 186 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 187 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 188 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 189 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 193 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 194 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 195 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 196 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 197 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 198 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 199 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 200 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 201 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 202 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 203 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 212 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.39 |
| Nodule | 0 |
| Rhizoplane | 2.13 |
| Rhizosphere | 97.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1244686 | 2162886007 | Unclassified | 1687 |
| 2 | MBSR1b_contig_3301288 | 2162886012 | Bacteria | 1762 |
| 3 | MBSR1b_contig_6004661 | 2162886012 | Bacteria | 1067 |
| 4 | rootH1_10022019 | 3300003323 | Bacteria | 2063 |
| 5 | Ga0065704_10001172 | 3300005289 | Bacteria | 19999 |
| 6 | Ga0065704_10005075 | 3300005289 | Unclassified | 4976 |
| 7 | Ga0065704_10080862 | 3300005289 | Unclassified | 3865 |
| 8 | Ga0065704_10088859 | 3300005289 | Unclassified | 2904 |
| 9 | Ga0065712_10000113 | 3300005290 | Bacteria | 191931 |
| 10 | Ga0065715_10001857 | 3300005293 | Bacteria | 6337 |
| 11 | Ga0065715_10090791 | 3300005293 | Bacteria | 6455 |
| 12 | Ga0065715_10091179 | 3300005293 | Bacteria | 6033 |
| 13 | Ga0065715_10207950 | 3300005293 | Bacteria | 1328 |
| 14 | Ga0065715_10209568 | 3300005293 | Bacteria | 1321 |
| 15 | Ga0065715_10218360 | 3300005293 | Unclassified | 1283 |
| 16 | Ga0065707_10000618 | 3300005295 | Bacteria | 18697 |
| 17 | Ga0065707_10002738 | 3300005295 | Bacteria | 8925 |
| 18 | Ga0065707_10128044 | 3300005295 | Bacteria | 1972 |
| 19 | Ga0065707_10240432 | 3300005295 | Bacteria | 1157 |
| 20 | Ga0070690_100047136 | 3300005330 | Unclassified | 2741 |
| 21 | Ga0070690_100119598 | 3300005330 | Bacteria | 1767 |
| 22 | Ga0070690_100229610 | 3300005330 | Bacteria | 1304 |
| 23 | Ga0070670_100001205 | 3300005331 | Bacteria | 20532 |
| 24 | Ga0070670_100442728 | 3300005331 | Unclassified | 1151 |
| 25 | Ga0068869_100012238 | 3300005334 | Bacteria | 5662 |
| 26 | Ga0068869_100017229 | 3300005334 | Bacteria | 4892 |
| 27 | Ga0068869_100022585 | 3300005334 | Bacteria | 4337 |
| 28 | Ga0068869_100029900 | 3300005334 | Bacteria | 3820 |
| 29 | Ga0068869_100085343 | 3300005334 | Bacteria | 2365 |
| 30 | Ga0070680_100000139 | 3300005336 | Bacteria | 44398 |
| 31 | Ga0070680_100059028 | 3300005336 | Bacteria | 3138 |
| 32 | Ga0070680_100194367 | 3300005336 | Bacteria | 1710 |
| 33 | Ga0070682_100000051 | 3300005337 | Bacteria | 123476 |
| 34 | Ga0070682_100007777 | 3300005337 | Bacteria | 6038 |
| 35 | Ga0068868_100018825 | 3300005338 | Bacteria | 5167 |
| 36 | Ga0068868_100073096 | 3300005338 | Bacteria | 2737 |
| 37 | Ga0070660_100249885 | 3300005339 | Bacteria | 1446 |
| 38 | Ga0070689_100000520 | 3300005340 | Bacteria | 22774 |
| 39 | Ga0070689_100068761 | 3300005340 | Bacteria | 2762 |
| 40 | Ga0070687_100126646 | 3300005343 | Bacteria | 1469 |
| 41 | Ga0070692_10001914 | 3300005345 | Bacteria | 7859 |
| 42 | Ga0070692_10036942 | 3300005345 | Bacteria | 2481 |
| 43 | Ga0070692_10074714 | 3300005345 | Bacteria | 1814 |
| 44 | Ga0070675_100041509 | 3300005354 | Bacteria | 3758 |
| 45 | Ga0070675_100116928 | 3300005354 | Unclassified | 2262 |
| 46 | Ga0070671_100002973 | 3300005355 | Bacteria | 13188 |
| 47 | Ga0070671_100031196 | 3300005355 | Unclassified | 4402 |
| 48 | Ga0070673_100013543 | 3300005364 | Bacteria | 5648 |
| 49 | Ga0070673_100137978 | 3300005364 | Bacteria | 2055 |
| 50 | Ga0070688_100133781 | 3300005365 | Bacteria | 1676 |
| 51 | Ga0070688_100215154 | 3300005365 | Unclassified | 1351 |
| 52 | Ga0070659_100000997 | 3300005366 | Bacteria | 20800 |
| 53 | Ga0070667_100063879 | 3300005367 | Bacteria | 3122 |
| 54 | Ga0070667_100066755 | 3300005367 | Bacteria | 3057 |
| 55 | Ga0070703_10051880 | 3300005406 | Bacteria | 1314 |
| 56 | Ga0070701_10039966 | 3300005438 | Bacteria | 2382 |
| 57 | Ga0070701_10044685 | 3300005438 | Bacteria | 2270 |
| 58 | Ga0070701_10086495 | 3300005438 | Bacteria | 1708 |
| 59 | Ga0070701_10098483 | 3300005438 | Unclassified | 1615 |
| 60 | Ga0070705_100010487 | 3300005440 | Bacteria | 4640 |
| 61 | Ga0070705_100061538 | 3300005440 | Bacteria | 2231 |
| 62 | Ga0070705_100083776 | 3300005440 | Bacteria | 1966 |
| 63 | Ga0070700_100000070 | 3300005441 | Bacteria | 72718 |
| 64 | Ga0070700_100011545 | 3300005441 | Unclassified | 4896 |
| 65 | Ga0070700_100019262 | 3300005441 | Bacteria | 3936 |
| 66 | Ga0070700_100121209 | 3300005441 | Bacteria | 1753 |
| 67 | Ga0070700_100249245 | 3300005441 | Bacteria | 1273 |
| 68 | Ga0070694_100007993 | 3300005444 | Bacteria | 6463 |
| 69 | Ga0070694_100010270 | 3300005444 | Bacteria | 5769 |
| 70 | Ga0070694_100039347 | 3300005444 | Bacteria | 3147 |
| 71 | Ga0070694_100084228 | 3300005444 | Bacteria | 2218 |
| 72 | Ga0070694_100113077 | 3300005444 | Bacteria | 1937 |
| 73 | Ga0070694_100154274 | 3300005444 | Bacteria | 1680 |
| 74 | Ga0070694_100272810 | 3300005444 | Bacteria | 1287 |
| 75 | Ga0070708_100000712 | 3300005445 | Bacteria | 25260 |
| 76 | Ga0070708_100120462 | 3300005445 | Bacteria | 2420 |
| 77 | Ga0070708_100201526 | 3300005445 | Bacteria | 1863 |
| 78 | Ga0070681_10000652 | 3300005458 | Bacteria | 28661 |
| 79 | Ga0070681_10007377 | 3300005458 | Bacteria | 10746 |
| 80 | Ga0070681_10017148 | 3300005458 | Bacteria | 7240 |
| 81 | Ga0070681_10025235 | 3300005458 | Bacteria | 5978 |
| 82 | Ga0068867_100055514 | 3300005459 | Bacteria | 2929 |
| 83 | Ga0068867_100221565 | 3300005459 | Bacteria | 1525 |
| 84 | Ga0068867_100370004 | 3300005459 | Bacteria | 1201 |
| 85 | Ga0070685_10008200 | 3300005466 | Bacteria | 5356 |
| 86 | Ga0070706_100000019 | 3300005467 | Bacteria | 166483 |
| 87 | Ga0070706_100019218 | 3300005467 | Bacteria | 6303 |
| 88 | Ga0070706_100071143 | 3300005467 | Bacteria | 3216 |
| 89 | Ga0070706_100209630 | 3300005467 | Bacteria | 1820 |
| 90 | Ga0070706_100228410 | 3300005467 | Bacteria | 1737 |
| 91 | Ga0070706_100296151 | 3300005467 | Bacteria | 1510 |
| 92 | Ga0070707_100074187 | 3300005468 | Bacteria | 3281 |
| 93 | Ga0070707_100347907 | 3300005468 | Unclassified | 1440 |
| 94 | Ga0070698_100001795 | 3300005471 | Bacteria | 23876 |
| 95 | Ga0070698_100010300 | 3300005471 | Bacteria | 9980 |
| 96 | Ga0070698_100011347 | 3300005471 | Bacteria | 9462 |
| 97 | Ga0070698_100015979 | 3300005471 | Bacteria | 7928 |
| 98 | Ga0070698_100027198 | 3300005471 | Bacteria | 5950 |
| 99 | Ga0070698_100100096 | 3300005471 | Bacteria | 2871 |
| 100 | Ga0070698_100122266 | 3300005471 | Bacteria | 2562 |
| 101 | Ga0070698_100512394 | 3300005471 | Unclassified | 1138 |
| 102 | Ga0070699_100000762 | 3300005518 | Bacteria | 29755 |
| 103 | Ga0070699_100009442 | 3300005518 | Bacteria | 8453 |
| 104 | Ga0070699_100028441 | 3300005518 | Unclassified | 4821 |
| 105 | Ga0070699_100037327 | 3300005518 | Unclassified | 4203 |
| 106 | Ga0070699_100445537 | 3300005518 | Bacteria | 1174 |
| 107 | Ga0070679_100000059 | 3300005530 | Bacteria | 81792 |
| 108 | Ga0070679_100010562 | 3300005530 | Bacteria | 8759 |
| 109 | Ga0070697_100000042 | 3300005536 | Bacteria | 94533 |
| 110 | Ga0070697_100003739 | 3300005536 | Bacteria | 11687 |
| 111 | Ga0070697_100024734 | 3300005536 | Bacteria | 4782 |
| 112 | Ga0070697_100043534 | 3300005536 | Unclassified | 3636 |
| 113 | Ga0070697_100122860 | 3300005536 | Bacteria | 2173 |
| 114 | Ga0070697_100268934 | 3300005536 | Bacteria | 1461 |
| 115 | Ga0070697_100282925 | 3300005536 | Bacteria | 1423 |
| 116 | Ga0068853_100001826 | 3300005539 | Bacteria | 15651 |
| 117 | Ga0068853_100004548 | 3300005539 | Bacteria | 10765 |
| 118 | Ga0068853_100045901 | 3300005539 | Unclassified | 3744 |
| 119 | Ga0068853_100090772 | 3300005539 | Bacteria | 2685 |
| 120 | Ga0068853_100598090 | 3300005539 | Bacteria | 1047 |
| 121 | Ga0070672_100027332 | 3300005543 | Unclassified | 4254 |
| 122 | Ga0070686_100007489 | 3300005544 | Bacteria | 6092 |
| 123 | Ga0070686_100014669 | 3300005544 | Bacteria | 4520 |
| 124 | Ga0070686_100071852 | 3300005544 | Bacteria | 2267 |
| 125 | Ga0070695_100134619 | 3300005545 | Unclassified | 1707 |
| 126 | Ga0070695_100229709 | 3300005545 | Unclassified | 1341 |
| 127 | Ga0070695_100285215 | 3300005545 | Unclassified | 1215 |
| 128 | Ga0070695_100288040 | 3300005545 | Unclassified | 1209 |
| 129 | Ga0070695_100372115 | 3300005545 | Bacteria | 1076 |
| 130 | Ga0070696_100013272 | 3300005546 | Bacteria | 5527 |
| 131 | Ga0070696_100095392 | 3300005546 | Bacteria | 2124 |
| 132 | Ga0070696_100123152 | 3300005546 | Unclassified | 1879 |
| 133 | Ga0070696_100123346 | 3300005546 | Bacteria | 1877 |
| 134 | Ga0070696_100239671 | 3300005546 | Unclassified | 1367 |
| 135 | Ga0070693_100047820 | 3300005547 | Bacteria | 2435 |
| 136 | Ga0070693_100152884 | 3300005547 | Bacteria | 1463 |
| 137 | Ga0070665_100143185 | 3300005548 | Bacteria | 2394 |
| 138 | Ga0070704_100106072 | 3300005549 | Unclassified | 2128 |
| 139 | Ga0070704_100123251 | 3300005549 | Bacteria | 1995 |
| 140 | Ga0070704_100254165 | 3300005549 | Unclassified | 1445 |
| 141 | Ga0070704_100537424 | 3300005549 | Bacteria | 1020 |
| 142 | Ga0070664_100002145 | 3300005564 | Bacteria | 15812 |
| 143 | Ga0070664_100102256 | 3300005564 | Bacteria | 2493 |
| 144 | Ga0068857_100027600 | 3300005577 | Bacteria | 5008 |
| 145 | Ga0068857_100113682 | 3300005577 | Bacteria | 2434 |
| 146 | Ga0068854_100140401 | 3300005578 | Bacteria | 1853 |
| 147 | Ga0068856_100008069 | 3300005614 | Bacteria | 10276 |
| 148 | Ga0068856_100261964 | 3300005614 | Unclassified | 1744 |
| 149 | Ga0070702_100034128 | 3300005615 | Unclassified | 2803 |
| 150 | Ga0070702_100060805 | 3300005615 | Unclassified | 2197 |
| 151 | Ga0070702_100140205 | 3300005615 | Bacteria | 1539 |
| 152 | Ga0068852_100116876 | 3300005616 | Bacteria | 2434 |
| 153 | Ga0068852_100147223 | 3300005616 | Unclassified | 2186 |
| 154 | Ga0068859_100008267 | 3300005617 | Bacteria | 10551 |
| 155 | Ga0068859_100032356 | 3300005617 | Bacteria | 5254 |
| 156 | Ga0068859_100050998 | 3300005617 | Bacteria | 4158 |
| 157 | Ga0068859_100061392 | 3300005617 | Unclassified | 3787 |
| 158 | Ga0068859_100092564 | 3300005617 | Bacteria | 3075 |
| 159 | Ga0068859_100150640 | 3300005617 | Bacteria | 2401 |
| 160 | Ga0068859_100283359 | 3300005617 | Bacteria | 1750 |
| 161 | Ga0068864_100045057 | 3300005618 | Bacteria | 3783 |
| 162 | Ga0068864_100119744 | 3300005618 | Bacteria | 2352 |
| 163 | Ga0068866_10006288 | 3300005718 | Bacteria | 4944 |
| 164 | Ga0068861_100028204 | 3300005719 | Bacteria | 4096 |
| 165 | Ga0068861_100052147 | 3300005719 | Unclassified | 3108 |
| 166 | Ga0068861_100121128 | 3300005719 | Unclassified | 2111 |
| 167 | Ga0068861_100155255 | 3300005719 | Bacteria | 1882 |
| 168 | Ga0068870_10082529 | 3300005840 | Bacteria | 1780 |
| 169 | Ga0068863_100007143 | 3300005841 | Bacteria | 10955 |
| 170 | Ga0068863_100050260 | 3300005841 | Bacteria | 3952 |
| 171 | Ga0068863_100168029 | 3300005841 | Bacteria | 2104 |
| 172 | Ga0068863_100169635 | 3300005841 | Bacteria | 2093 |
| 173 | Ga0068858_100021547 | 3300005842 | Bacteria | 6023 |
| 174 | Ga0068858_100050959 | 3300005842 | Bacteria | 3831 |
| 175 | Ga0068860_100035364 | 3300005843 | Bacteria | 4791 |
| 176 | Ga0068860_100051684 | 3300005843 | Bacteria | 3909 |
| 177 | Ga0068860_100082106 | 3300005843 | Unclassified | 3066 |
| 178 | Ga0068862_100003110 | 3300005844 | Bacteria | 14465 |
| 179 | Ga0068862_100012756 | 3300005844 | Bacteria | 6955 |
| 180 | Ga0068862_100036359 | 3300005844 | Bacteria | 4174 |
| 181 | Ga0081455_10004961 | 3300005937 | Bacteria | 14715 |
| 182 | Ga0081539_10001629 | 3300005985 | Bacteria | 36707 |
| 183 | Ga0070716_100000003 | 3300006173 | Bacteria | 312721 |
| 184 | Ga0070716_100066083 | 3300006173 | Unclassified | 2108 |
| 185 | Ga0097621_100055478 | 3300006237 | Bacteria | 3235 |
| 186 | Ga0097621_100151118 | 3300006237 | Unclassified | 1991 |
| 187 | Ga0097621_100159992 | 3300006237 | Unclassified | 1935 |
| 188 | Ga0068871_100087187 | 3300006358 | Bacteria | 2594 |
| 189 | Ga0068871_100145501 | 3300006358 | Unclassified | 2017 |
| 190 | Ga0075428_100038593 | 3300006844 | Bacteria | 5256 |
| 191 | Ga0075428_100082227 | 3300006844 | Bacteria | 3514 |
| 192 | Ga0075428_100199331 | 3300006844 | Bacteria | 2164 |
| 193 | Ga0075430_100052936 | 3300006846 | Bacteria | 3418 |
| 194 | Ga0075431_100057757 | 3300006847 | Bacteria | 4002 |
| 195 | Ga0075431_100196345 | 3300006847 | Bacteria | 2066 |
| 196 | Ga0075431_100236852 | 3300006847 | Bacteria | 1858 |
| 197 | Ga0075433_10000077 | 3300006852 | Bacteria | 44120 |
| 198 | Ga0075433_10019790 | 3300006852 | Bacteria | 5617 |
| 199 | Ga0075433_10032906 | 3300006852 | Bacteria | 4443 |
| 200 | Ga0075433_10043355 | 3300006852 | Bacteria | 3904 |
| 201 | Ga0075433_10076608 | 3300006852 | Bacteria | 2945 |
| 202 | Ga0075433_10104959 | 3300006852 | Bacteria | 2504 |
| 203 | Ga0075433_10127699 | 3300006852 | Bacteria | 2258 |
| 204 | Ga0075433_10154970 | 3300006852 | Bacteria | 2038 |
| 205 | Ga0075433_10319457 | 3300006852 | Unclassified | 1374 |
| 206 | Ga0075434_100025117 | 3300006871 | Bacteria | 5829 |
| 207 | Ga0075434_100077273 | 3300006871 | Bacteria | 3324 |
| 208 | Ga0075434_100450137 | 3300006871 | Unclassified | 1309 |
| 209 | Ga0075429_100010583 | 3300006880 | Bacteria | 7979 |
| 210 | Ga0075429_100067081 | 3300006880 | Bacteria | 3123 |
| 211 | Ga0068865_100006970 | 3300006881 | Bacteria | 6930 |
| 212 | Ga0068865_100221713 | 3300006881 | Bacteria | 1479 |
| 213 | Ga0075436_100000430 | 3300006914 | Bacteria | 26922 |
| 214 | Ga0075436_100005320 | 3300006914 | Bacteria | 8850 |
| 215 | Ga0097620_100008267 | 3300006931 | Bacteria | 10551 |
| 216 | Ga0097620_100032360 | 3300006931 | Bacteria | 5254 |
| 217 | Ga0097620_100050999 | 3300006931 | Bacteria | 4158 |
| 218 | Ga0097620_100061392 | 3300006931 | Unclassified | 3787 |
| 219 | Ga0097620_100092566 | 3300006931 | Bacteria | 3075 |
| 220 | Ga0097620_100150640 | 3300006931 | Bacteria | 2401 |
| 221 | Ga0097620_100283359 | 3300006931 | Bacteria | 1750 |
| 222 | Ga0105240_10032438 | 3300009093 | Bacteria | 6762 |
| 223 | Ga0105240_10052115 | 3300009093 | Bacteria | 5145 |
| 224 | Ga0111539_10000931 | 3300009094 | Bacteria | 38341 |
| 225 | Ga0111539_10021046 | 3300009094 | Bacteria | 8032 |
| 226 | Ga0111539_10033381 | 3300009094 | Bacteria | 6248 |
| 227 | Ga0111539_10060692 | 3300009094 | Bacteria | 4481 |
| 228 | Ga0111539_10081967 | 3300009094 | Bacteria | 3794 |
| 229 | Ga0105245_10025941 | 3300009098 | Bacteria | 5155 |
| 230 | Ga0105247_10079679 | 3300009101 | Bacteria | 2061 |
| 231 | Ga0114129_10007505 | 3300009147 | Bacteria | 15532 |
| 232 | Ga0114129_10009464 | 3300009147 | Bacteria | 13885 |
| 233 | Ga0114129_10053293 | 3300009147 | Bacteria | 5674 |
| 234 | Ga0114129_10059719 | 3300009147 | Bacteria | 5331 |
| 235 | Ga0114129_10086283 | 3300009147 | Bacteria | 4354 |
| 236 | Ga0114129_10776519 | 3300009147 | Bacteria | 1224 |
| 237 | Ga0105243_10000364 | 3300009148 | Bacteria | 48410 |
| 238 | Ga0105243_10010652 | 3300009148 | Bacteria | 6973 |
| 239 | Ga0105243_10039358 | 3300009148 | Unclassified | 3685 |
| 240 | Ga0105243_10070485 | 3300009148 | Unclassified | 2823 |
| 241 | Ga0105243_10103913 | 3300009148 | Bacteria | 2363 |
| 242 | Ga0105243_10178954 | 3300009148 | Bacteria | 1843 |
| 243 | Ga0105243_10263664 | 3300009148 | Bacteria | 1544 |
| 244 | Ga0105243_10443689 | 3300009148 | Bacteria | 1216 |
| 245 | Ga0105241_10037464 | 3300009174 | Bacteria | 3654 |
| 246 | Ga0105241_10056946 | 3300009174 | Bacteria | 2997 |
| 247 | Ga0105241_10076283 | 3300009174 | Unclassified | 2613 |
| 248 | Ga0105242_10000270 | 3300009176 | Bacteria | 41208 |
| 249 | Ga0105242_10055842 | 3300009176 | Unclassified | 3231 |
| 250 | Ga0105242_10322279 | 3300009176 | Bacteria | 1418 |
| 251 | Ga0105248_10006116 | 3300009177 | Bacteria | 13205 |
| 252 | Ga0105248_10013612 | 3300009177 | Bacteria | 8955 |
| 253 | Ga0105248_10027885 | 3300009177 | Bacteria | 6287 |
| 254 | Ga0105248_10082984 | 3300009177 | Bacteria | 3605 |
| 255 | Ga0105248_10088171 | 3300009177 | Bacteria | 3492 |
| 256 | Ga0105248_10102545 | 3300009177 | Unclassified | 3225 |
| 257 | Ga0105248_10113874 | 3300009177 | Bacteria | 3050 |
| 258 | Ga0105237_10002452 | 3300009545 | Bacteria | 23028 |
| 259 | Ga0105238_10005750 | 3300009551 | Bacteria | 12267 |
| 260 | Ga0105239_10023464 | 3300010375 | Bacteria | 6794 |
| 261 | Ga0105239_10246922 | 3300010375 | Bacteria | 2004 |
| 262 | Ga0105246_10077510 | 3300011119 | Unclassified | 2358 |
| 263 | Ga0105246_10106984 | 3300011119 | Unclassified | 2047 |
| 264 | Ga0157373_10001793 | 3300013100 | Bacteria | 16329 |
| 265 | Ga0157369_10062528 | 3300013105 | Unclassified | 4011 |
| 266 | Ga0157374_10051995 | 3300013296 | Bacteria | 3814 |
| 267 | Ga0157378_10051258 | 3300013297 | Bacteria | 3672 |
| 268 | Ga0157378_10064569 | 3300013297 | Bacteria | 3275 |
| 269 | Ga0157378_10069987 | 3300013297 | Bacteria | 3149 |
| 270 | Ga0157378_10073860 | 3300013297 | Bacteria | 3067 |
| 271 | Ga0157378_10078110 | 3300013297 | Bacteria | 2985 |
| 272 | Ga0157378_10092539 | 3300013297 | Bacteria | 2751 |
| 273 | Ga0163162_10000506 | 3300013306 | Bacteria | 36273 |
| 274 | Ga0163162_10028650 | 3300013306 | Bacteria | 5512 |
| 275 | Ga0163162_10037254 | 3300013306 | Unclassified | 4852 |
| 276 | Ga0163162_10047474 | 3300013306 | Bacteria | 4303 |
| 277 | Ga0163162_10056297 | 3300013306 | Bacteria | 3961 |
| 278 | Ga0163162_10096655 | 3300013306 | Bacteria | 3042 |
| 279 | Ga0157372_10003813 | 3300013307 | Bacteria | 16192 |
| 280 | Ga0157372_10102117 | 3300013307 | Unclassified | 3275 |
| 281 | Ga0157372_10105276 | 3300013307 | Bacteria | 3227 |
| 282 | Ga0157375_10020001 | 3300013308 | Bacteria | 6105 |
| 283 | Ga0157375_10060945 | 3300013308 | Bacteria | 3744 |
| 284 | Ga0157375_10222652 | 3300013308 | Bacteria | 2045 |
| 285 | Ga0157375_10390474 | 3300013308 | Bacteria | 1558 |
| 286 | Ga0163163_10003818 | 3300014325 | Bacteria | 12834 |
| 287 | Ga0163163_10003828 | 3300014325 | Bacteria | 12813 |
| 288 | Ga0163163_10055145 | 3300014325 | Bacteria | 3928 |
| 289 | Ga0163163_10068061 | 3300014325 | Bacteria | 3542 |
| 290 | Ga0163163_10078283 | 3300014325 | Bacteria | 3303 |
| 291 | Ga0163163_10083312 | 3300014325 | Bacteria | 3203 |
| 292 | Ga0163163_10286952 | 3300014325 | Bacteria | 1698 |
| 293 | Ga0157380_10002797 | 3300014326 | Bacteria | 11862 |
| 294 | Ga0157380_10042001 | 3300014326 | Bacteria | 3572 |
| 295 | Ga0157380_10043600 | 3300014326 | Bacteria | 3512 |
| 296 | Ga0157380_10066004 | 3300014326 | Bacteria | 2910 |
| 297 | Ga0157380_10092640 | 3300014326 | Unclassified | 2497 |
| 298 | Ga0157380_10093930 | 3300014326 | Bacteria | 2481 |
| 299 | Ga0157377_10180279 | 3300014745 | Unclassified | 1328 |
| 300 | Ga0157376_10008505 | 3300014969 | Bacteria | 7410 |
| 301 | Ga0157376_10025139 | 3300014969 | Bacteria | 4688 |
| 302 | Ga0157376_10454756 | 3300014969 | Unclassified | 1250 |
| 303 | Ga0163161_10016077 | 3300017792 | Bacteria | 5224 |
| 304 | Ga0163161_10017409 | 3300017792 | Bacteria | 5029 |
| 305 | Ga0163161_10091613 | 3300017792 | Bacteria | 2250 |
| 306 | Ga0207697_10007114 | 3300025315 | Bacteria | 5008 |
| 307 | Ga0207653_10009486 | 3300025885 | Bacteria | 3034 |
| 308 | Ga0207643_10018228 | 3300025908 | Bacteria | 3844 |
| 309 | Ga0207643_10038185 | 3300025908 | Bacteria | 2697 |
| 310 | Ga0207643_10040350 | 3300025908 | Bacteria | 2628 |
| 311 | Ga0207643_10180533 | 3300025908 | Unclassified | 1277 |
| 312 | Ga0207684_10000079 | 3300025910 | Bacteria | 179842 |
| 313 | Ga0207684_10001129 | 3300025910 | Bacteria | 29818 |
| 314 | Ga0207684_10038188 | 3300025910 | Bacteria | 4075 |
| 315 | Ga0207684_10216813 | 3300025910 | Bacteria | 1651 |
| 316 | Ga0207654_10043026 | 3300025911 | Unclassified | 2558 |
| 317 | Ga0207654_10133429 | 3300025911 | Bacteria | 1574 |
| 318 | Ga0207654_10147894 | 3300025911 | Bacteria | 1505 |
| 319 | Ga0207654_10235679 | 3300025911 | Unclassified | 1221 |
| 320 | Ga0207707_10000008 | 3300025912 | Bacteria | 330313 |
| 321 | Ga0207707_10049229 | 3300025912 | Bacteria | 3671 |
| 322 | Ga0207707_10096179 | 3300025912 | Bacteria | 2588 |
| 323 | Ga0207671_10002542 | 3300025914 | Bacteria | 19413 |
| 324 | Ga0207671_10181156 | 3300025914 | Bacteria | 1640 |
| 325 | Ga0207660_10000437 | 3300025917 | Bacteria | 27518 |
| 326 | Ga0207660_10043834 | 3300025917 | Bacteria | 3145 |
| 327 | Ga0207660_10046994 | 3300025917 | Unclassified | 3049 |
| 328 | Ga0207662_10131348 | 3300025918 | Unclassified | 1579 |
| 329 | Ga0207649_10076995 | 3300025920 | Bacteria | 2148 |
| 330 | Ga0207652_10000085 | 3300025921 | Bacteria | 101176 |
| 331 | Ga0207652_10015613 | 3300025921 | Bacteria | 6181 |
| 332 | Ga0207652_10026033 | 3300025921 | Unclassified | 4869 |
| 333 | Ga0207652_10370554 | 3300025921 | Bacteria | 1293 |
| 334 | Ga0207646_10040132 | 3300025922 | Bacteria | 4210 |
| 335 | Ga0207646_10305877 | 3300025922 | Unclassified | 1436 |
| 336 | Ga0207681_10025813 | 3300025923 | Bacteria | 3783 |
| 337 | Ga0207694_10024149 | 3300025924 | Bacteria | 4617 |
| 338 | Ga0207650_10000675 | 3300025925 | Bacteria | 26793 |
| 339 | Ga0207650_10246162 | 3300025925 | Unclassified | 1446 |
| 340 | Ga0207659_10401591 | 3300025926 | Bacteria | 1146 |
| 341 | Ga0207706_10207515 | 3300025933 | Bacteria | 1718 |
| 342 | Ga0207686_10000039 | 3300025934 | Bacteria | 126792 |
| 343 | Ga0207709_10000192 | 3300025935 | Bacteria | 81277 |
| 344 | Ga0207709_10047006 | 3300025935 | Bacteria | 2622 |
| 345 | Ga0207709_10065908 | 3300025935 | Bacteria | 2279 |
| 346 | Ga0207709_10332697 | 3300025935 | Bacteria | 1140 |
| 347 | Ga0207670_10019054 | 3300025936 | Bacteria | 4183 |
| 348 | Ga0207704_10175567 | 3300025938 | Bacteria | 1542 |
| 349 | Ga0207691_10000845 | 3300025940 | Bacteria | 30493 |
| 350 | Ga0207691_10029652 | 3300025940 | Bacteria | 5118 |
| 351 | Ga0207711_10002073 | 3300025941 | Bacteria | 18109 |
| 352 | Ga0207711_10017312 | 3300025941 | Bacteria | 5988 |
| 353 | Ga0207711_10044446 | 3300025941 | Unclassified | 3792 |
| 354 | Ga0207711_10073559 | 3300025941 | Bacteria | 2970 |
| 355 | Ga0207711_10089815 | 3300025941 | Bacteria | 2700 |
| 356 | Ga0207689_10001578 | 3300025942 | Bacteria | 21602 |
| 357 | Ga0207689_10005172 | 3300025942 | Bacteria | 11719 |
| 358 | Ga0207689_10012682 | 3300025942 | Bacteria | 7201 |
| 359 | Ga0207689_10021423 | 3300025942 | Bacteria | 5433 |
| 360 | Ga0207689_10037623 | 3300025942 | Bacteria | 4013 |
| 361 | Ga0207689_10116476 | 3300025942 | Unclassified | 2196 |
| 362 | Ga0207651_10084175 | 3300025960 | Bacteria | 2303 |
| 363 | Ga0207651_10400778 | 3300025960 | Unclassified | 1167 |
| 364 | Ga0207712_10061028 | 3300025961 | Bacteria | 2675 |
| 365 | Ga0207668_10357318 | 3300025972 | Bacteria | 1223 |
| 366 | Ga0207640_10132510 | 3300025981 | Bacteria | 1804 |
| 367 | Ga0207677_10041972 | 3300026023 | Bacteria | 3029 |
| 368 | Ga0207677_10092923 | 3300026023 | Bacteria | 2198 |
| 369 | Ga0207703_10045150 | 3300026035 | Bacteria | 3543 |
| 370 | Ga0207703_10085256 | 3300026035 | Bacteria | 2643 |
| 371 | Ga0207703_10287287 | 3300026035 | Unclassified | 1496 |
| 372 | Ga0207639_10001389 | 3300026041 | Bacteria | 16345 |
| 373 | Ga0207639_10111247 | 3300026041 | Bacteria | 2232 |
| 374 | Ga0207639_10499378 | 3300026041 | Bacteria | 1111 |
| 375 | Ga0207708_10000094 | 3300026075 | Bacteria | 67925 |
| 376 | Ga0207708_10005226 | 3300026075 | Bacteria | 9567 |
| 377 | Ga0207708_10052463 | 3300026075 | Bacteria | 3106 |
| 378 | Ga0207708_10101164 | 3300026075 | Bacteria | 2231 |
| 379 | Ga0207708_10163001 | 3300026075 | Bacteria | 1761 |
| 380 | Ga0207708_10217873 | 3300026075 | Bacteria | 1528 |
| 381 | Ga0207702_10007133 | 3300026078 | Bacteria | 9562 |
| 382 | Ga0207702_10226166 | 3300026078 | Unclassified | 1746 |
| 383 | Ga0207641_10045239 | 3300026088 | Bacteria | 3706 |
| 384 | Ga0207641_10047514 | 3300026088 | Bacteria | 3619 |
| 385 | Ga0207641_10245324 | 3300026088 | Unclassified | 1671 |
| 386 | Ga0207648_10009944 | 3300026089 | Bacteria | 9064 |
| 387 | Ga0207648_10143314 | 3300026089 | Unclassified | 2107 |
| 388 | Ga0207648_10294766 | 3300026089 | Bacteria | 1453 |
| 389 | Ga0207648_10384162 | 3300026089 | Bacteria | 1270 |
| 390 | Ga0207676_10017608 | 3300026095 | Bacteria | 5180 |
| 391 | Ga0207676_10070435 | 3300026095 | Bacteria | 2804 |
| 392 | Ga0207676_10104941 | 3300026095 | Bacteria | 2351 |
| 393 | Ga0207676_10140707 | 3300026095 | Bacteria | 2065 |
| 394 | Ga0207676_10215729 | 3300026095 | Unclassified | 1706 |
| 395 | Ga0207674_10002177 | 3300026116 | Bacteria | 24786 |
| 396 | Ga0207674_10120512 | 3300026116 | Bacteria | 2591 |
| 397 | Ga0207674_10180392 | 3300026116 | Bacteria | 2063 |
| 398 | Ga0207675_100008853 | 3300026118 | Bacteria | 9444 |
| 399 | Ga0207675_100052030 | 3300026118 | Bacteria | 3822 |
| 400 | Ga0207675_100133362 | 3300026118 | Bacteria | 2355 |
| 401 | Ga0207675_100352086 | 3300026118 | Bacteria | 1443 |
| 402 | Ga0207683_10369349 | 3300026121 | Unclassified | 1318 |
| 403 | Ga0207698_10175242 | 3300026142 | Bacteria | 1893 |
| 404 | Ga0207698_10191126 | 3300026142 | Bacteria | 1824 |
| 405 | Ga0207698_10248917 | 3300026142 | Bacteria | 1625 |
| 406 | Ga0207428_10000547 | 3300027907 | Bacteria | 44826 |
| 407 | Ga0207428_10022018 | 3300027907 | Bacteria | 5384 |
| 408 | Ga0207428_10024065 | 3300027907 | Bacteria | 5113 |
| 409 | Ga0268266_10107286 | 3300028379 | Bacteria | 2469 |
| 410 | Ga0268266_10286091 | 3300028379 | Unclassified | 1534 |
| 411 | Ga0268265_10063476 | 3300028380 | Bacteria | 2842 |
| 412 | Ga0268264_10100442 | 3300028381 | Bacteria | 2513 |
| 413 | Ga0268264_10153247 | 3300028381 | Bacteria | 2069 |
| 414 | Ga0268264_10159320 | 3300028381 | Bacteria | 2031 |
| 415 | Ga0265323_10014428 | 3300028653 | Unclassified | 3131 |
| 416 | Ga0307515_10003491 | 3300028794 | Bacteria | 33042 |
| 417 | Ga0265332_10008807 | 3300031238 | Bacteria | 4518 |
| 418 | Ga0307405_10125344 | 3300031731 | Unclassified | 1765 |
| 419 | Ga0307405_10156630 | 3300031731 | Bacteria | 1608 |
| 420 | Ga0316577_10009237 | 3300031733 | Bacteria | 5302 |
| 421 | Ga0307413_10050646 | 3300031824 | Bacteria | 2497 |
| 422 | Ga0307410_10085158 | 3300031852 | Bacteria | 2230 |
| 423 | Ga0307406_10107008 | 3300031901 | Bacteria | 1917 |
| 424 | Ga0307412_10136054 | 3300031911 | Bacteria | 1793 |
| 425 | Ga0307416_100411930 | 3300032002 | Unclassified | 1393 |
| 426 | Ga0307416_100430747 | 3300032002 | Bacteria | 1366 |
| 427 | Ga0307414_10002794 | 3300032004 | Bacteria | 9192 |
| 428 | Ga0307414_10088976 | 3300032004 | Unclassified | 2287 |
| 429 | Ga0307411_10004628 | 3300032005 | Bacteria | 6625 |
| 430 | Ga0307415_100017580 | 3300032126 | Bacteria | 4292 |
| 431 | Ga0307415_100063379 | 3300032126 | Bacteria | 2568 |
| 432 | Ga0307415_100185262 | 3300032126 | Bacteria | 1637 |
| 433 | Ga0373949_0000002 | 3300035090 | Bacteria | 102187 |
| 434 | Ga0373954_0137673 | 3300035118 | Bacteria | 1190 |
| 435 | Ga0373961_0000007 | 3300035241 | Bacteria | 145618 |
| 436 | Ga0316574_0068959 | 3300035398 | Bacteria | 2231 |
| 437 | Ga0316582_0059239 | 3300036647 | Bacteria | 2451 |
| 438 | Ga0316584_0004208 | 3300036712 | Bacteria | 9500 |
| 439 | Ga0316584_0021012 | 3300036712 | Bacteria | 4741 |
| 440 | Ga0395900_0104225 | 3300037418 | Bacteria | 2914 |
| 441 | Ga0395898_0015621 | 3300037466 | Bacteria | 7783 |
| 442 | Ga0395898_0041835 | 3300037466 | Bacteria | 4524 |
| 443 | Ga0316581_0001779 | 3300037588 | Bacteria | 4983 |
| 444 | Ga0395901_0228634 | 3300038443 | Bacteria | 1943 |
| 445 | Ga0395901_0597298 | 3300038443 | Bacteria | 1113 |
| 446 | Ga0439448_0014612 | 3300042005 | Unclassified | 2371 |
| 447 | Ga0439458_0001329 | 3300042157 | Bacteria | 6241 |
| 448 | Ga0466961_0108762 | 3300044693 | Unclassified | 1745 |
| 449 | Ga0466959_0032900 | 3300045049 | Unclassified | 3838 |
| 450 | Ga0466958_0048800 | 3300045836 | Unclassified | 2560 |
| 451 | Ga0495582_0206352 | 3300046473 | Bacteria | 1123 |
| 452 | Ga0495663_0000205 | 3300046525 | Bacteria | 23523 |
| 453 | Ga0495598_0000026 | 3300046537 | Bacteria | 23756 |
| 454 | Ga0495621_0000017 | 3300046539 | Bacteria | 32151 |
| 455 | Ga0495634_0147998 | 3300046642 | Unclassified | 1487 |
| 456 | Ga0495613_0118706 | 3300046689 | Bacteria | 1901 |
| 457 | Ga0495672_0006640 | 3300047320 | Bacteria | 8889 |
| 458 | Ga0496102_0009856 | 3300048905 | Bacteria | 8213 |
| 459 | Ga0496102_0371516 | 3300048905 | Unclassified | 1346 |
| 460 | Ga0496106_0016826 | 3300048909 | Bacteria | 5410 |
| 461 | Ga0496106_0099674 | 3300048909 | Bacteria | 2252 |
| 462 | Ga0496107_0014787 | 3300048910 | Bacteria | 5463 |
| 463 | Ga0496108_0405714 | 3300048911 | Bacteria | 1190 |
| 464 | Ga0496110_0547639 | 3300048913 | Unclassified | 1052 |
| 465 | Ga0496111_0133108 | 3300048914 | Bacteria | 1841 |
| 466 | Ga0496112_0179328 | 3300048915 | Bacteria | 2082 |
| 467 | Ga0496112_0182205 | 3300048915 | Bacteria | 2064 |
| 468 | Ga0496112_0191386 | 3300048915 | Bacteria | 2008 |
| 469 | Ga0501291_001239 | 3300049514 | Bacteria | 2945 |
| 470 | Ga0501299_005123 | 3300049522 | Bacteria | 1998 |
| 471 | Ga0501038_0016873 | 3300049574 | Bacteria | 6610 |
| 472 | Ga0501069_0107064 | 3300049585 | Unclassified | 1590 |
| 473 | Ga0501074_0147183 | 3300049590 | Bacteria | 1684 |
| 474 | Ga0501207_000932 | 3300049654 | Bacteria | 3522 |
| 475 | Ga0501216_003201 | 3300049660 | Bacteria | 2377 |
| 476 | Ga0501217_008628 | 3300049661 | Bacteria | 2205 |
| 477 | Ga0501223_006284 | 3300049663 | Bacteria | 2464 |
| 478 | Ga0501224_000630 | 3300049664 | Bacteria | 4341 |
| 479 | Ga0501227_002526 | 3300049665 | Bacteria | 4042 |
| 480 | Ga0501230_008936 | 3300049667 | Bacteria | 1529 |
| 481 | Ga0501259_014066 | 3300049688 | Unclassified | 1352 |
| 482 | Ga0501259_016877 | 3300049688 | Bacteria | 1260 |
| 483 | Ga0501225_0000657 | 3300049705 | Bacteria | 10764 |
| 484 | Ga0501234_001847 | 3300049707 | Bacteria | 3344 |
| 485 | Ga0501283_007718 | 3300049779 | Bacteria | 1539 |
| 486 | Ga0501283_016116 | 3300049779 | Bacteria | 1156 |
| 487 | nmdc:mga05p37_134431_c1 | 3300050507 | Bacteria | 3034 |
| 488 | nmdc:mga05p37_15372_c1 | 3300050507 | Bacteria | 9195 |
| 489 | nmdc:mga05p37_17262_c1 | 3300050507 | Bacteria | 8706 |
| 490 | nmdc:mga05p37_208510_c1 | 3300050507 | Unclassified | 2363 |
| 491 | nmdc:mga05p37_26698_c1 | 3300050507 | Bacteria | 7023 |
| 492 | nmdc:mga05p37_49287_c1 | 3300050507 | Bacteria | 5180 |
| 493 | nmdc:mga05p37_50790_c1 | 3300050507 | Bacteria | 5100 |
| 494 | nmdc:mga09592_187007_c1 | 3300050508 | Bacteria | 1792 |
| 495 | nmdc:mga09592_26460_c1 | 3300050508 | Bacteria | 4806 |
| 496 | nmdc:mga09592_63824_c1 | 3300050508 | Bacteria | 3118 |
| 497 | nmdc:mga09592_66917_c1 | 3300050508 | Bacteria | 3046 |
| 498 | nmdc:mga0qj67_52941_c1 | 3300050509 | Unclassified | 3213 |
| 499 | nmdc:mga06r32_102485_c1 | 3300050510 | Bacteria | 2810 |
| 500 | nmdc:mga08y16_37241_c1 | 3300050511 | Bacteria | 5110 |
| 501 | nmdc:mga08y16_8785_c1 | 3300050511 | Bacteria | 10605 |
| 502 | nmdc:mga0n895_246416_c1 | 3300050512 | Bacteria | 1813 |
| 503 | nmdc:mga0n895_27684_c1 | 3300050512 | Bacteria | 5387 |
| 504 | nmdc:mga0n895_326904_c1 | 3300050512 | Bacteria | 1554 |
| 505 | nmdc:mga0n895_80823_c1 | 3300050512 | Bacteria | 3239 |
| 506 | nmdc:mga08x19_11_c1 | 3300050514 | Bacteria | 403007 |
| 507 | nmdc:mga08x19_1646_c2 | 3300050514 | Bacteria | 4644 |
| 508 | nmdc:mga0a205_103911_c1 | 3300050515 | Bacteria | 2740 |
| 509 | nmdc:mga0a205_152845_c1 | 3300050515 | Unclassified | 2207 |
| 510 | nmdc:mga0a205_300533_c1 | 3300050515 | Bacteria | 1478 |
| 511 | nmdc:mga0a205_34073_c2 | 3300050515 | Bacteria | 4529 |
| 512 | nmdc:mga0a205_72441_c1 | 3300050515 | Bacteria | 3328 |
| 513 | nmdc:mga0a205_75622_c1 | 3300050515 | Bacteria | 3254 |
| 514 | nmdc:mga0a205_94478_c1 | 3300050515 | Bacteria | 2889 |
| 515 | Ga0500566_0057126 | 3300053094 | Bacteria | 2217 |
| 516 | Ga0500637_0035399 | 3300053178 | Bacteria | 2799 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036712 | Ga0316584_0021012 | Ga0316584_0021012_1631_2488 | 284 |
| 2 | 3300005295 | Ga0065707_10002738 | Ga0065707_100027386 | 290 |
| 3 | 3300003323 | rootH1_10022019 | rootH1_100220193 | 291 |
| 4 | 3300005471 | Ga0070698_100001795 | Ga0070698_1000017955 | 302 |
| 5 | 3300005444 | Ga0070694_100084228 | Ga0070694_1000842282 | 303 |
| 6 | 3300005547 | Ga0070693_100152884 | Ga0070693_1001528841 | 310 |
| 7 | 3300005549 | Ga0070704_100106072 | Ga0070704_1001060723 | 310 |
| 8 | 3300025910 | Ga0207684_10216813 | Ga0207684_102168131 | 310 |
| 9 | 3300025911 | Ga0207654_10133429 | Ga0207654_101334292 | 310 |
| 10 | 3300049590 | Ga0501074_0147183 | Ga0501074_0147183_210_1148 | 310 |
| 11 | 3300005536 | Ga0070697_100043534 | Ga0070697_1000435342 | 312 |
| 12 | 3300005340 | Ga0070689_100068761 | Ga0070689_1000687612 | 313 |
| 13 | 3300009148 | Ga0105243_10178954 | Ga0105243_101789542 | 313 |
| 14 | 3300025935 | Ga0207709_10332697 | Ga0207709_103326971 | 313 |
| 15 | 3300025936 | Ga0207670_10019054 | Ga0207670_100190542 | 313 |
| 16 | 3300025972 | Ga0207668_10357318 | Ga0207668_103573182 | 313 |
| 17 | 3300035118 | Ga0373954_0137673 | Ga0373954_0137673_70_1014 | 313 |
| 18 | 3300035241 | Ga0373961_0000007 | Ga0373961_0000007_109738_110682 | 313 |
| 19 | 3300044693 | Ga0466961_0108762 | Ga0466961_0108762_457_1467 | 313 |
| 20 | 3300045049 | Ga0466959_0032900 | Ga0466959_0032900_2148_3158 | 313 |
| 21 | 3300045836 | Ga0466958_0048800 | Ga0466958_0048800_712_1722 | 313 |
| 22 | 3300053094 | Ga0500566_0057126 | Ga0500566_0057126_799_1755 | 313 |
| 23 | 3300005334 | Ga0068869_100085343 | Ga0068869_1000853431 | 314 |
| 24 | 3300006844 | Ga0075428_100199331 | Ga0075428_1001993313 | 314 |
| 25 | 3300006880 | Ga0075429_100010583 | Ga0075429_1000105833 | 314 |
| 26 | 3300009177 | Ga0105248_10027885 | Ga0105248_100278852 | 314 |
| 27 | 3300014325 | Ga0163163_10083312 | Ga0163163_100833121 | 314 |
| 28 | 3300025941 | Ga0207711_10017312 | Ga0207711_100173125 | 314 |
| 29 | 3300025942 | Ga0207689_10012682 | Ga0207689_100126822 | 314 |
| 30 | 3300028653 | Ga0265323_10014428 | Ga0265323_100144283 | 314 |
| 31 | 3300031733 | Ga0316577_10009237 | Ga0316577_100092375 | 314 |
| 32 | 3300035398 | Ga0316574_0068959 | Ga0316574_0068959_112_1080 | 314 |
| 33 | 3300036647 | Ga0316582_0059239 | Ga0316582_0059239_127_1095 | 314 |
| 34 | 3300036712 | Ga0316584_0004208 | Ga0316584_0004208_5575_6543 | 314 |
| 35 | 3300037588 | Ga0316581_0001779 | Ga0316581_0001779_1622_2590 | 314 |
| 36 | 3300046642 | Ga0495634_0147998 | Ga0495634_0147998_432_1403 | 314 |
| 37 | 3300046689 | Ga0495613_0118706 | Ga0495613_0118706_849_1820 | 314 |
| 38 | 3300050508 | nmdc:mga09592_63824_c1 | nmdc:mga09592_63824_c1_949_1896 | 314 |
| 39 | 3300005937 | Ga0081455_10004961 | Ga0081455_1000496110 | 315 |
| 40 | 2162886012 | MBSR1b_contig_3301288 | MBSR1b_0093.00001840 | 316 |
| 41 | 3300005293 | Ga0065715_10207950 | Ga0065715_102079501 | 316 |
| 42 | 3300005365 | Ga0070688_100215154 | Ga0070688_1002151541 | 316 |
| 43 | 3300005367 | Ga0070667_100066755 | Ga0070667_1000667553 | 316 |
| 44 | 3300005564 | Ga0070664_100102256 | Ga0070664_1001022563 | 316 |
| 45 | 3300005578 | Ga0068854_100140401 | Ga0068854_1001404012 | 316 |
| 46 | 3300005617 | Ga0068859_100050998 | Ga0068859_1000509982 | 316 |
| 47 | 3300005844 | Ga0068862_100036359 | Ga0068862_1000363591 | 316 |
| 48 | 3300006173 | Ga0070716_100000003 | Ga0070716_10000000344 | 316 |
| 49 | 3300006844 | Ga0075428_100038593 | Ga0075428_1000385932 | 316 |
| 50 | 3300006844 | Ga0075428_100082227 | Ga0075428_1000822274 | 316 |
| 51 | 3300006847 | Ga0075431_100057757 | Ga0075431_1000577572 | 316 |
| 52 | 3300006852 | Ga0075433_10000077 | Ga0075433_1000007718 | 316 |
| 53 | 3300006852 | Ga0075433_10076608 | Ga0075433_100766082 | 316 |
| 54 | 3300006871 | Ga0075434_100025117 | Ga0075434_1000251173 | 316 |
| 55 | 3300006880 | Ga0075429_100067081 | Ga0075429_1000670812 | 316 |
| 56 | 3300006914 | Ga0075436_100000430 | Ga0075436_10000043016 | 316 |
| 57 | 3300006931 | Ga0097620_100050999 | Ga0097620_1000509992 | 316 |
| 58 | 3300009094 | Ga0111539_10021046 | Ga0111539_100210467 | 316 |
| 59 | 3300009094 | Ga0111539_10060692 | Ga0111539_100606923 | 316 |
| 60 | 3300009147 | Ga0114129_10009464 | Ga0114129_100094649 | 316 |
| 61 | 3300009148 | Ga0105243_10000364 | Ga0105243_1000036426 | 316 |
| 62 | 3300009176 | Ga0105242_10000270 | Ga0105242_1000027022 | 316 |
| 63 | 3300013297 | Ga0157378_10064569 | Ga0157378_100645693 | 316 |
| 64 | 3300014326 | Ga0157380_10093930 | Ga0157380_100939302 | 316 |
| 65 | 3300014745 | Ga0157377_10180279 | Ga0157377_101802792 | 316 |
| 66 | 3300025922 | Ga0207646_10040132 | Ga0207646_100401324 | 316 |
| 67 | 3300025925 | Ga0207650_10246162 | Ga0207650_102461622 | 316 |
| 68 | 3300025934 | Ga0207686_10000039 | Ga0207686_1000003953 | 316 |
| 69 | 3300025935 | Ga0207709_10000192 | Ga0207709_1000019253 | 316 |
| 70 | 3300025942 | Ga0207689_10037623 | Ga0207689_100376234 | 316 |
| 71 | 3300025961 | Ga0207712_10061028 | Ga0207712_100610282 | 316 |
| 72 | 3300025981 | Ga0207640_10132510 | Ga0207640_101325102 | 316 |
| 73 | 3300026089 | Ga0207648_10384162 | Ga0207648_103841621 | 316 |
| 74 | 3300026142 | Ga0207698_10175242 | Ga0207698_101752422 | 316 |
| 75 | 3300027907 | Ga0207428_10022018 | Ga0207428_100220182 | 316 |
| 76 | 3300027907 | Ga0207428_10024065 | Ga0207428_100240654 | 316 |
| 77 | 3300031731 | Ga0307405_10125344 | Ga0307405_101253441 | 316 |
| 78 | 3300031852 | Ga0307410_10085158 | Ga0307410_100851581 | 316 |
| 79 | 3300032004 | Ga0307414_10088976 | Ga0307414_100889762 | 316 |
| 80 | 3300032126 | Ga0307415_100017580 | Ga0307415_1000175803 | 316 |
| 81 | 3300049667 | Ga0501230_008936 | Ga0501230_008936_296_1246 | 316 |
| 82 | 3300050507 | nmdc:mga05p37_17262_c1 | nmdc:mga05p37_17262_c1_6026_7030 | 316 |
| 83 | 3300050507 | nmdc:mga05p37_26698_c1 | nmdc:mga05p37_26698_c1_54_1007 | 316 |
| 84 | 3300050508 | nmdc:mga09592_187007_c1 | nmdc:mga09592_187007_c1_336_1289 | 316 |
| 85 | 3300050508 | nmdc:mga09592_66917_c1 | nmdc:mga09592_66917_c1_656_1642 | 316 |
| 86 | 3300050510 | nmdc:mga06r32_102485_c1 | nmdc:mga06r32_102485_c1_365_1318 | 316 |
| 87 | 3300050511 | nmdc:mga08y16_37241_c1 | nmdc:mga08y16_37241_c1_3164_4117 | 316 |
| 88 | 3300050512 | nmdc:mga0n895_27684_c1 | nmdc:mga0n895_27684_c1_3574_4527 | 316 |
| 89 | 3300050514 | nmdc:mga08x19_11_c1 | nmdc:mga08x19_11_c1_155890_156855 | 316 |
| 90 | 3300050515 | nmdc:mga0a205_72441_c1 | nmdc:mga0a205_72441_c1_1413_2366 | 316 |
| 91 | 2162886012 | MBSR1b_contig_6004661 | MBSR1b_0496.00005250 | 317 |
| 92 | 3300005289 | Ga0065704_10001172 | Ga0065704_100011721 | 317 |
| 93 | 3300005289 | Ga0065704_10005075 | Ga0065704_100050751 | 317 |
| 94 | 3300005289 | Ga0065704_10088859 | Ga0065704_100888594 | 317 |
| 95 | 3300005290 | Ga0065712_10000113 | Ga0065712_1000011388 | 317 |
| 96 | 3300005293 | Ga0065715_10001857 | Ga0065715_100018571 | 317 |
| 97 | 3300005293 | Ga0065715_10090791 | Ga0065715_100907914 | 317 |
| 98 | 3300005293 | Ga0065715_10218360 | Ga0065715_102183601 | 317 |
| 99 | 3300005295 | Ga0065707_10000618 | Ga0065707_100006186 | 317 |
| 100 | 3300005295 | Ga0065707_10128044 | Ga0065707_101280443 | 317 |
| 101 | 3300005330 | Ga0070690_100047136 | Ga0070690_1000471362 | 317 |
| 102 | 3300005330 | Ga0070690_100119598 | Ga0070690_1001195982 | 317 |
| 103 | 3300005330 | Ga0070690_100229610 | Ga0070690_1002296101 | 317 |
| 104 | 3300005331 | Ga0070670_100442728 | Ga0070670_1004427281 | 317 |
| 105 | 3300005334 | Ga0068869_100012238 | Ga0068869_1000122383 | 317 |
| 106 | 3300005334 | Ga0068869_100017229 | Ga0068869_1000172293 | 317 |
| 107 | 3300005334 | Ga0068869_100022585 | Ga0068869_1000225854 | 317 |
| 108 | 3300005336 | Ga0070680_100000139 | Ga0070680_1000001398 | 317 |
| 109 | 3300005336 | Ga0070680_100059028 | Ga0070680_1000590285 | 317 |
| 110 | 3300005336 | Ga0070680_100194367 | Ga0070680_1001943672 | 317 |
| 111 | 3300005337 | Ga0070682_100007777 | Ga0070682_1000077775 | 317 |
| 112 | 3300005338 | Ga0068868_100018825 | Ga0068868_1000188253 | 317 |
| 113 | 3300005338 | Ga0068868_100073096 | Ga0068868_1000730964 | 317 |
| 114 | 3300005339 | Ga0070660_100249885 | Ga0070660_1002498851 | 317 |
| 115 | 3300005340 | Ga0070689_100000520 | Ga0070689_1000005206 | 317 |
| 116 | 3300005343 | Ga0070687_100126646 | Ga0070687_1001266461 | 317 |
| 117 | 3300005345 | Ga0070692_10001914 | Ga0070692_100019147 | 317 |
| 118 | 3300005345 | Ga0070692_10036942 | Ga0070692_100369423 | 317 |
| 119 | 3300005345 | Ga0070692_10074714 | Ga0070692_100747142 | 317 |
| 120 | 3300005354 | Ga0070675_100041509 | Ga0070675_1000415093 | 317 |
| 121 | 3300005354 | Ga0070675_100116928 | Ga0070675_1001169282 | 317 |
| 122 | 3300005355 | Ga0070671_100002973 | Ga0070671_1000029734 | 317 |
| 123 | 3300005355 | Ga0070671_100031196 | Ga0070671_1000311964 | 317 |
| 124 | 3300005364 | Ga0070673_100013543 | Ga0070673_1000135434 | 317 |
| 125 | 3300005364 | Ga0070673_100137978 | Ga0070673_1001379781 | 317 |
| 126 | 3300005365 | Ga0070688_100133781 | Ga0070688_1001337812 | 317 |
| 127 | 3300005366 | Ga0070659_100000997 | Ga0070659_10000099711 | 317 |
| 128 | 3300005367 | Ga0070667_100063879 | Ga0070667_1000638793 | 317 |
| 129 | 3300005406 | Ga0070703_10051880 | Ga0070703_100518801 | 317 |
| 130 | 3300005438 | Ga0070701_10039966 | Ga0070701_100399664 | 317 |
| 131 | 3300005438 | Ga0070701_10044685 | Ga0070701_100446852 | 317 |
| 132 | 3300005438 | Ga0070701_10098483 | Ga0070701_100984831 | 317 |
| 133 | 3300005440 | Ga0070705_100010487 | Ga0070705_1000104872 | 317 |
| 134 | 3300005441 | Ga0070700_100000070 | Ga0070700_10000007014 | 317 |
| 135 | 3300005441 | Ga0070700_100011545 | Ga0070700_1000115456 | 317 |
| 136 | 3300005441 | Ga0070700_100019262 | Ga0070700_1000192622 | 317 |
| 137 | 3300005441 | Ga0070700_100121209 | Ga0070700_1001212091 | 317 |
| 138 | 3300005441 | Ga0070700_100249245 | Ga0070700_1002492451 | 317 |
| 139 | 3300005444 | Ga0070694_100007993 | Ga0070694_1000079933 | 317 |
| 140 | 3300005444 | Ga0070694_100010270 | Ga0070694_1000102702 | 317 |
| 141 | 3300005444 | Ga0070694_100039347 | Ga0070694_1000393474 | 317 |
| 142 | 3300005444 | Ga0070694_100113077 | Ga0070694_1001130772 | 317 |
| 143 | 3300005445 | Ga0070708_100000712 | Ga0070708_10000071210 | 317 |
| 144 | 3300005445 | Ga0070708_100120462 | Ga0070708_1001204622 | 317 |
| 145 | 3300005458 | Ga0070681_10000652 | Ga0070681_1000065217 | 317 |
| 146 | 3300005458 | Ga0070681_10007377 | Ga0070681_100073775 | 317 |
| 147 | 3300005458 | Ga0070681_10017148 | Ga0070681_100171486 | 317 |
| 148 | 3300005458 | Ga0070681_10025235 | Ga0070681_100252353 | 317 |
| 149 | 3300005459 | Ga0068867_100055514 | Ga0068867_1000555142 | 317 |
| 150 | 3300005459 | Ga0068867_100221565 | Ga0068867_1002215651 | 317 |
| 151 | 3300005459 | Ga0068867_100370004 | Ga0068867_1003700041 | 317 |
| 152 | 3300005466 | Ga0070685_10008200 | Ga0070685_100082001 | 317 |
| 153 | 3300005467 | Ga0070706_100000019 | Ga0070706_10000001987 | 317 |
| 154 | 3300005467 | Ga0070706_100071143 | Ga0070706_1000711431 | 317 |
| 155 | 3300005467 | Ga0070706_100209630 | Ga0070706_1002096301 | 317 |
| 156 | 3300005467 | Ga0070706_100228410 | Ga0070706_1002284102 | 317 |
| 157 | 3300005467 | Ga0070706_100296151 | Ga0070706_1002961511 | 317 |
| 158 | 3300005468 | Ga0070707_100074187 | Ga0070707_1000741872 | 317 |
| 159 | 3300005468 | Ga0070707_100347907 | Ga0070707_1003479071 | 317 |
| 160 | 3300005471 | Ga0070698_100011347 | Ga0070698_1000113474 | 317 |
| 161 | 3300005471 | Ga0070698_100027198 | Ga0070698_1000271981 | 317 |
| 162 | 3300005471 | Ga0070698_100100096 | Ga0070698_1001000962 | 317 |
| 163 | 3300005471 | Ga0070698_100512394 | Ga0070698_1005123941 | 317 |
| 164 | 3300005518 | Ga0070699_100000762 | Ga0070699_10000076213 | 317 |
| 165 | 3300005518 | Ga0070699_100009442 | Ga0070699_1000094424 | 317 |
| 166 | 3300005518 | Ga0070699_100037327 | Ga0070699_1000373272 | 317 |
| 167 | 3300005518 | Ga0070699_100445537 | Ga0070699_1004455371 | 317 |
| 168 | 3300005530 | Ga0070679_100000059 | Ga0070679_1000000596 | 317 |
| 169 | 3300005530 | Ga0070679_100010562 | Ga0070679_1000105626 | 317 |
| 170 | 3300005536 | Ga0070697_100024734 | Ga0070697_1000247341 | 317 |
| 171 | 3300005536 | Ga0070697_100122860 | Ga0070697_1001228603 | 317 |
| 172 | 3300005536 | Ga0070697_100268934 | Ga0070697_1002689341 | 317 |
| 173 | 3300005536 | Ga0070697_100282925 | Ga0070697_1002829252 | 317 |
| 174 | 3300005539 | Ga0068853_100001826 | Ga0068853_10000182619 | 317 |
| 175 | 3300005539 | Ga0068853_100004548 | Ga0068853_1000045486 | 317 |
| 176 | 3300005539 | Ga0068853_100045901 | Ga0068853_1000459013 | 317 |
| 177 | 3300005539 | Ga0068853_100090772 | Ga0068853_1000907722 | 317 |
| 178 | 3300005539 | Ga0068853_100598090 | Ga0068853_1005980901 | 317 |
| 179 | 3300005543 | Ga0070672_100027332 | Ga0070672_1000273322 | 317 |
| 180 | 3300005544 | Ga0070686_100007489 | Ga0070686_1000074894 | 317 |
| 181 | 3300005544 | Ga0070686_100071852 | Ga0070686_1000718522 | 317 |
| 182 | 3300005545 | Ga0070695_100134619 | Ga0070695_1001346192 | 317 |
| 183 | 3300005545 | Ga0070695_100285215 | Ga0070695_1002852151 | 317 |
| 184 | 3300005545 | Ga0070695_100288040 | Ga0070695_1002880401 | 317 |
| 185 | 3300005545 | Ga0070695_100372115 | Ga0070695_1003721151 | 317 |
| 186 | 3300005546 | Ga0070696_100013272 | Ga0070696_1000132721 | 317 |
| 187 | 3300005546 | Ga0070696_100095392 | Ga0070696_1000953922 | 317 |
| 188 | 3300005546 | Ga0070696_100123152 | Ga0070696_1001231523 | 317 |
| 189 | 3300005546 | Ga0070696_100123346 | Ga0070696_1001233462 | 317 |
| 190 | 3300005547 | Ga0070693_100047820 | Ga0070693_1000478202 | 317 |
| 191 | 3300005548 | Ga0070665_100143185 | Ga0070665_1001431852 | 317 |
| 192 | 3300005549 | Ga0070704_100254165 | Ga0070704_1002541651 | 317 |
| 193 | 3300005564 | Ga0070664_100002145 | Ga0070664_1000021457 | 317 |
| 194 | 3300005577 | Ga0068857_100027600 | Ga0068857_1000276006 | 317 |
| 195 | 3300005577 | Ga0068857_100113682 | Ga0068857_1001136824 | 317 |
| 196 | 3300005614 | Ga0068856_100008069 | Ga0068856_1000080698 | 317 |
| 197 | 3300005614 | Ga0068856_100261964 | Ga0068856_1002619642 | 317 |
| 198 | 3300005615 | Ga0070702_100034128 | Ga0070702_1000341282 | 317 |
| 199 | 3300005615 | Ga0070702_100060805 | Ga0070702_1000608054 | 317 |
| 200 | 3300005615 | Ga0070702_100140205 | Ga0070702_1001402052 | 317 |
| 201 | 3300005616 | Ga0068852_100116876 | Ga0068852_1001168762 | 317 |
| 202 | 3300005616 | Ga0068852_100147223 | Ga0068852_1001472232 | 317 |
| 203 | 3300005617 | Ga0068859_100008267 | Ga0068859_1000082679 | 317 |
| 204 | 3300005617 | Ga0068859_100032356 | Ga0068859_1000323562 | 317 |
| 205 | 3300005617 | Ga0068859_100061392 | Ga0068859_1000613923 | 317 |
| 206 | 3300005617 | Ga0068859_100092564 | Ga0068859_1000925642 | 317 |
| 207 | 3300005617 | Ga0068859_100150640 | Ga0068859_1001506402 | 317 |
| 208 | 3300005617 | Ga0068859_100283359 | Ga0068859_1002833592 | 317 |
| 209 | 3300005618 | Ga0068864_100045057 | Ga0068864_1000450574 | 317 |
| 210 | 3300005618 | Ga0068864_100119744 | Ga0068864_1001197442 | 317 |
| 211 | 3300005718 | Ga0068866_10006288 | Ga0068866_100062884 | 317 |
| 212 | 3300005719 | Ga0068861_100028204 | Ga0068861_1000282044 | 317 |
| 213 | 3300005719 | Ga0068861_100052147 | Ga0068861_1000521474 | 317 |
| 214 | 3300005719 | Ga0068861_100121128 | Ga0068861_1001211282 | 317 |
| 215 | 3300005719 | Ga0068861_100155255 | Ga0068861_1001552551 | 317 |
| 216 | 3300005840 | Ga0068870_10082529 | Ga0068870_100825291 | 317 |
| 217 | 3300005841 | Ga0068863_100007143 | Ga0068863_1000071439 | 317 |
| 218 | 3300005841 | Ga0068863_100050260 | Ga0068863_1000502604 | 317 |
| 219 | 3300005841 | Ga0068863_100168029 | Ga0068863_1001680292 | 317 |
| 220 | 3300005841 | Ga0068863_100169635 | Ga0068863_1001696353 | 317 |
| 221 | 3300005842 | Ga0068858_100021547 | Ga0068858_1000215473 | 317 |
| 222 | 3300005842 | Ga0068858_100050959 | Ga0068858_1000509593 | 317 |
| 223 | 3300005843 | Ga0068860_100035364 | Ga0068860_1000353644 | 317 |
| 224 | 3300005843 | Ga0068860_100051684 | Ga0068860_1000516845 | 317 |
| 225 | 3300005843 | Ga0068860_100082106 | Ga0068860_1000821062 | 317 |
| 226 | 3300005844 | Ga0068862_100003110 | Ga0068862_10000311010 | 317 |
| 227 | 3300005844 | Ga0068862_100012756 | Ga0068862_1000127563 | 317 |
| 228 | 3300005985 | Ga0081539_10001629 | Ga0081539_100016296 | 317 |
| 229 | 3300006173 | Ga0070716_100066083 | Ga0070716_1000660832 | 317 |
| 230 | 3300006237 | Ga0097621_100055478 | Ga0097621_1000554783 | 317 |
| 231 | 3300006237 | Ga0097621_100151118 | Ga0097621_1001511181 | 317 |
| 232 | 3300006237 | Ga0097621_100159992 | Ga0097621_1001599921 | 317 |
| 233 | 3300006358 | Ga0068871_100087187 | Ga0068871_1000871874 | 317 |
| 234 | 3300006358 | Ga0068871_100145501 | Ga0068871_1001455012 | 317 |
| 235 | 3300006846 | Ga0075430_100052936 | Ga0075430_1000529361 | 317 |
| 236 | 3300006847 | Ga0075431_100196345 | Ga0075431_1001963452 | 317 |
| 237 | 3300006847 | Ga0075431_100236852 | Ga0075431_1002368521 | 317 |
| 238 | 3300006852 | Ga0075433_10019790 | Ga0075433_100197901 | 317 |
| 239 | 3300006852 | Ga0075433_10032906 | Ga0075433_100329064 | 317 |
| 240 | 3300006852 | Ga0075433_10043355 | Ga0075433_100433554 | 317 |
| 241 | 3300006852 | Ga0075433_10104959 | Ga0075433_101049595 | 317 |
| 242 | 3300006852 | Ga0075433_10127699 | Ga0075433_101276992 | 317 |
| 243 | 3300006852 | Ga0075433_10154970 | Ga0075433_101549702 | 317 |
| 244 | 3300006852 | Ga0075433_10319457 | Ga0075433_103194572 | 317 |
| 245 | 3300006871 | Ga0075434_100077273 | Ga0075434_1000772732 | 317 |
| 246 | 3300006871 | Ga0075434_100450137 | Ga0075434_1004501372 | 317 |
| 247 | 3300006881 | Ga0068865_100006970 | Ga0068865_1000069703 | 317 |
| 248 | 3300006881 | Ga0068865_100221713 | Ga0068865_1002217132 | 317 |
| 249 | 3300006914 | Ga0075436_100005320 | Ga0075436_1000053205 | 317 |
| 250 | 3300006931 | Ga0097620_100008267 | Ga0097620_1000082679 | 317 |
| 251 | 3300006931 | Ga0097620_100032360 | Ga0097620_1000323602 | 317 |
| 252 | 3300006931 | Ga0097620_100061392 | Ga0097620_1000613923 | 317 |
| 253 | 3300006931 | Ga0097620_100092566 | Ga0097620_1000925662 | 317 |
| 254 | 3300006931 | Ga0097620_100150640 | Ga0097620_1001506402 | 317 |
| 255 | 3300006931 | Ga0097620_100283359 | Ga0097620_1002833592 | 317 |
| 256 | 3300009093 | Ga0105240_10032438 | Ga0105240_100324383 | 317 |
| 257 | 3300009093 | Ga0105240_10052115 | Ga0105240_100521156 | 317 |
| 258 | 3300009094 | Ga0111539_10000931 | Ga0111539_100009316 | 317 |
| 259 | 3300009094 | Ga0111539_10033381 | Ga0111539_100333817 | 317 |
| 260 | 3300009094 | Ga0111539_10081967 | Ga0111539_100819672 | 317 |
| 261 | 3300009098 | Ga0105245_10025941 | Ga0105245_100259412 | 317 |
| 262 | 3300009101 | Ga0105247_10079679 | Ga0105247_100796792 | 317 |
| 263 | 3300009147 | Ga0114129_10007505 | Ga0114129_100075058 | 317 |
| 264 | 3300009147 | Ga0114129_10053293 | Ga0114129_100532933 | 317 |
| 265 | 3300009147 | Ga0114129_10059719 | Ga0114129_100597194 | 317 |
| 266 | 3300009147 | Ga0114129_10086283 | Ga0114129_100862833 | 317 |
| 267 | 3300009147 | Ga0114129_10776519 | Ga0114129_107765191 | 317 |
| 268 | 3300009148 | Ga0105243_10010652 | Ga0105243_100106521 | 317 |
| 269 | 3300009148 | Ga0105243_10039358 | Ga0105243_100393582 | 317 |
| 270 | 3300009148 | Ga0105243_10263664 | Ga0105243_102636641 | 317 |
| 271 | 3300009148 | Ga0105243_10443689 | Ga0105243_104436892 | 317 |
| 272 | 3300009174 | Ga0105241_10037464 | Ga0105241_100374642 | 317 |
| 273 | 3300009174 | Ga0105241_10056946 | Ga0105241_100569464 | 317 |
| 274 | 3300009174 | Ga0105241_10076283 | Ga0105241_100762831 | 317 |
| 275 | 3300009176 | Ga0105242_10055842 | Ga0105242_100558421 | 317 |
| 276 | 3300009176 | Ga0105242_10322279 | Ga0105242_103222792 | 317 |
| 277 | 3300009177 | Ga0105248_10006116 | Ga0105248_100061167 | 317 |
| 278 | 3300009177 | Ga0105248_10013612 | Ga0105248_100136129 | 317 |
| 279 | 3300009177 | Ga0105248_10082984 | Ga0105248_100829842 | 317 |
| 280 | 3300009177 | Ga0105248_10088171 | Ga0105248_100881713 | 317 |
| 281 | 3300009177 | Ga0105248_10102545 | Ga0105248_101025452 | 317 |
| 282 | 3300009177 | Ga0105248_10113874 | Ga0105248_101138742 | 317 |
| 283 | 3300009545 | Ga0105237_10002452 | Ga0105237_1000245212 | 317 |
| 284 | 3300009551 | Ga0105238_10005750 | Ga0105238_100057509 | 317 |
| 285 | 3300010375 | Ga0105239_10023464 | Ga0105239_100234645 | 317 |
| 286 | 3300010375 | Ga0105239_10246922 | Ga0105239_102469223 | 317 |
| 287 | 3300011119 | Ga0105246_10077510 | Ga0105246_100775102 | 317 |
| 288 | 3300011119 | Ga0105246_10106984 | Ga0105246_101069842 | 317 |
| 289 | 3300013100 | Ga0157373_10001793 | Ga0157373_100017939 | 317 |
| 290 | 3300013105 | Ga0157369_10062528 | Ga0157369_100625283 | 317 |
| 291 | 3300013296 | Ga0157374_10051995 | Ga0157374_100519953 | 317 |
| 292 | 3300013297 | Ga0157378_10051258 | Ga0157378_100512583 | 317 |
| 293 | 3300013297 | Ga0157378_10073860 | Ga0157378_100738602 | 317 |
| 294 | 3300013297 | Ga0157378_10078110 | Ga0157378_100781102 | 317 |
| 295 | 3300013297 | Ga0157378_10092539 | Ga0157378_100925392 | 317 |
| 296 | 3300013306 | Ga0163162_10000506 | Ga0163162_100005062 | 317 |
| 297 | 3300013306 | Ga0163162_10028650 | Ga0163162_100286501 | 317 |
| 298 | 3300013306 | Ga0163162_10037254 | Ga0163162_100372544 | 317 |
| 299 | 3300013306 | Ga0163162_10047474 | Ga0163162_100474742 | 317 |
| 300 | 3300013306 | Ga0163162_10056297 | Ga0163162_100562973 | 317 |
| 301 | 3300013306 | Ga0163162_10096655 | Ga0163162_100966554 | 317 |
| 302 | 3300013307 | Ga0157372_10003813 | Ga0157372_1000381311 | 317 |
| 303 | 3300013307 | Ga0157372_10102117 | Ga0157372_101021172 | 317 |
| 304 | 3300013307 | Ga0157372_10105276 | Ga0157372_101052762 | 317 |
| 305 | 3300013308 | Ga0157375_10020001 | Ga0157375_100200013 | 317 |
| 306 | 3300013308 | Ga0157375_10060945 | Ga0157375_100609454 | 317 |
| 307 | 3300013308 | Ga0157375_10222652 | Ga0157375_102226522 | 317 |
| 308 | 3300013308 | Ga0157375_10390474 | Ga0157375_103904742 | 317 |
| 309 | 3300014325 | Ga0163163_10003818 | Ga0163163_100038186 | 317 |
| 310 | 3300014325 | Ga0163163_10003828 | Ga0163163_1000382813 | 317 |
| 311 | 3300014325 | Ga0163163_10055145 | Ga0163163_100551454 | 317 |
| 312 | 3300014325 | Ga0163163_10068061 | Ga0163163_100680613 | 317 |
| 313 | 3300014325 | Ga0163163_10078283 | Ga0163163_100782833 | 317 |
| 314 | 3300014325 | Ga0163163_10286952 | Ga0163163_102869523 | 317 |
| 315 | 3300014326 | Ga0157380_10002797 | Ga0157380_100027973 | 317 |
| 316 | 3300014326 | Ga0157380_10043600 | Ga0157380_100436002 | 317 |
| 317 | 3300014326 | Ga0157380_10066004 | Ga0157380_100660042 | 317 |
| 318 | 3300014326 | Ga0157380_10092640 | Ga0157380_100926404 | 317 |
| 319 | 3300014969 | Ga0157376_10008505 | Ga0157376_100085058 | 317 |
| 320 | 3300014969 | Ga0157376_10025139 | Ga0157376_100251392 | 317 |
| 321 | 3300014969 | Ga0157376_10454756 | Ga0157376_104547561 | 317 |
| 322 | 3300017792 | Ga0163161_10016077 | Ga0163161_100160773 | 317 |
| 323 | 3300017792 | Ga0163161_10017409 | Ga0163161_100174094 | 317 |
| 324 | 3300017792 | Ga0163161_10091613 | Ga0163161_100916132 | 317 |
| 325 | 3300025315 | Ga0207697_10007114 | Ga0207697_100071143 | 317 |
| 326 | 3300025885 | Ga0207653_10009486 | Ga0207653_100094863 | 317 |
| 327 | 3300025908 | Ga0207643_10018228 | Ga0207643_100182282 | 317 |
| 328 | 3300025908 | Ga0207643_10038185 | Ga0207643_100381851 | 317 |
| 329 | 3300025908 | Ga0207643_10040350 | Ga0207643_100403504 | 317 |
| 330 | 3300025908 | Ga0207643_10180533 | Ga0207643_101805332 | 317 |
| 331 | 3300025910 | Ga0207684_10000079 | Ga0207684_10000079143 | 317 |
| 332 | 3300025910 | Ga0207684_10038188 | Ga0207684_100381883 | 317 |
| 333 | 3300025911 | Ga0207654_10043026 | Ga0207654_100430264 | 317 |
| 334 | 3300025911 | Ga0207654_10147894 | Ga0207654_101478942 | 317 |
| 335 | 3300025911 | Ga0207654_10235679 | Ga0207654_102356791 | 317 |
| 336 | 3300025912 | Ga0207707_10000008 | Ga0207707_1000000817 | 317 |
| 337 | 3300025912 | Ga0207707_10049229 | Ga0207707_100492291 | 317 |
| 338 | 3300025912 | Ga0207707_10096179 | Ga0207707_100961792 | 317 |
| 339 | 3300025914 | Ga0207671_10002542 | Ga0207671_100025426 | 317 |
| 340 | 3300025914 | Ga0207671_10181156 | Ga0207671_101811562 | 317 |
| 341 | 3300025917 | Ga0207660_10000437 | Ga0207660_1000043715 | 317 |
| 342 | 3300025917 | Ga0207660_10043834 | Ga0207660_100438345 | 317 |
| 343 | 3300025917 | Ga0207660_10046994 | Ga0207660_100469943 | 317 |
| 344 | 3300025918 | Ga0207662_10131348 | Ga0207662_101313481 | 317 |
| 345 | 3300025920 | Ga0207649_10076995 | Ga0207649_100769952 | 317 |
| 346 | 3300025921 | Ga0207652_10000085 | Ga0207652_1000008571 | 317 |
| 347 | 3300025921 | Ga0207652_10015613 | Ga0207652_100156132 | 317 |
| 348 | 3300025921 | Ga0207652_10026033 | Ga0207652_100260335 | 317 |
| 349 | 3300025921 | Ga0207652_10370554 | Ga0207652_103705542 | 317 |
| 350 | 3300025922 | Ga0207646_10305877 | Ga0207646_103058771 | 317 |
| 351 | 3300025923 | Ga0207681_10025813 | Ga0207681_100258134 | 317 |
| 352 | 3300025924 | Ga0207694_10024149 | Ga0207694_100241492 | 317 |
| 353 | 3300025926 | Ga0207659_10401591 | Ga0207659_104015911 | 317 |
| 354 | 3300025933 | Ga0207706_10207515 | Ga0207706_102075151 | 317 |
| 355 | 3300025935 | Ga0207709_10065908 | Ga0207709_100659082 | 317 |
| 356 | 3300025938 | Ga0207704_10175567 | Ga0207704_101755672 | 317 |
| 357 | 3300025940 | Ga0207691_10000845 | Ga0207691_100008458 | 317 |
| 358 | 3300025940 | Ga0207691_10029652 | Ga0207691_100296522 | 317 |
| 359 | 3300025941 | Ga0207711_10002073 | Ga0207711_100020734 | 317 |
| 360 | 3300025941 | Ga0207711_10044446 | Ga0207711_100444462 | 317 |
| 361 | 3300025941 | Ga0207711_10073559 | Ga0207711_100735592 | 317 |
| 362 | 3300025941 | Ga0207711_10089815 | Ga0207711_100898152 | 317 |
| 363 | 3300025942 | Ga0207689_10001578 | Ga0207689_1000157815 | 317 |
| 364 | 3300025942 | Ga0207689_10021423 | Ga0207689_100214232 | 317 |
| 365 | 3300025942 | Ga0207689_10116476 | Ga0207689_101164763 | 317 |
| 366 | 3300025960 | Ga0207651_10400778 | Ga0207651_104007781 | 317 |
| 367 | 3300026023 | Ga0207677_10041972 | Ga0207677_100419724 | 317 |
| 368 | 3300026023 | Ga0207677_10092923 | Ga0207677_100929233 | 317 |
| 369 | 3300026035 | Ga0207703_10045150 | Ga0207703_100451503 | 317 |
| 370 | 3300026035 | Ga0207703_10085256 | Ga0207703_100852562 | 317 |
| 371 | 3300026035 | Ga0207703_10287287 | Ga0207703_102872871 | 317 |
| 372 | 3300026041 | Ga0207639_10001389 | Ga0207639_100013894 | 317 |
| 373 | 3300026041 | Ga0207639_10111247 | Ga0207639_101112472 | 317 |
| 374 | 3300026041 | Ga0207639_10499378 | Ga0207639_104993781 | 317 |
| 375 | 3300026075 | Ga0207708_10000094 | Ga0207708_100000946 | 317 |
| 376 | 3300026075 | Ga0207708_10005226 | Ga0207708_1000522610 | 317 |
| 377 | 3300026075 | Ga0207708_10052463 | Ga0207708_100524632 | 317 |
| 378 | 3300026075 | Ga0207708_10101164 | Ga0207708_101011642 | 317 |
| 379 | 3300026075 | Ga0207708_10163001 | Ga0207708_101630012 | 317 |
| 380 | 3300026075 | Ga0207708_10217873 | Ga0207708_102178731 | 317 |
| 381 | 3300026078 | Ga0207702_10007133 | Ga0207702_100071335 | 317 |
| 382 | 3300026078 | Ga0207702_10226166 | Ga0207702_102261662 | 317 |
| 383 | 3300026088 | Ga0207641_10045239 | Ga0207641_100452392 | 317 |
| 384 | 3300026088 | Ga0207641_10047514 | Ga0207641_100475142 | 317 |
| 385 | 3300026088 | Ga0207641_10245324 | Ga0207641_102453242 | 317 |
| 386 | 3300026089 | Ga0207648_10009944 | Ga0207648_100099443 | 317 |
| 387 | 3300026089 | Ga0207648_10143314 | Ga0207648_101433142 | 317 |
| 388 | 3300026089 | Ga0207648_10294766 | Ga0207648_102947662 | 317 |
| 389 | 3300026095 | Ga0207676_10017608 | Ga0207676_100176084 | 317 |
| 390 | 3300026095 | Ga0207676_10070435 | Ga0207676_100704354 | 317 |
| 391 | 3300026095 | Ga0207676_10104941 | Ga0207676_101049412 | 317 |
| 392 | 3300026095 | Ga0207676_10140707 | Ga0207676_101407073 | 317 |
| 393 | 3300026095 | Ga0207676_10215729 | Ga0207676_102157292 | 317 |
| 394 | 3300026116 | Ga0207674_10002177 | Ga0207674_1000217713 | 317 |
| 395 | 3300026116 | Ga0207674_10120512 | Ga0207674_101205124 | 317 |
| 396 | 3300026116 | Ga0207674_10180392 | Ga0207674_101803922 | 317 |
| 397 | 3300026118 | Ga0207675_100008853 | Ga0207675_1000088534 | 317 |
| 398 | 3300026118 | Ga0207675_100052030 | Ga0207675_1000520302 | 317 |
| 399 | 3300026118 | Ga0207675_100133362 | Ga0207675_1001333621 | 317 |
| 400 | 3300026118 | Ga0207675_100352086 | Ga0207675_1003520861 | 317 |
| 401 | 3300026121 | Ga0207683_10369349 | Ga0207683_103693491 | 317 |
| 402 | 3300026142 | Ga0207698_10191126 | Ga0207698_101911262 | 317 |
| 403 | 3300026142 | Ga0207698_10248917 | Ga0207698_102489172 | 317 |
| 404 | 3300027907 | Ga0207428_10000547 | Ga0207428_1000054726 | 317 |
| 405 | 3300028379 | Ga0268266_10107286 | Ga0268266_101072862 | 317 |
| 406 | 3300028379 | Ga0268266_10286091 | Ga0268266_102860912 | 317 |
| 407 | 3300028380 | Ga0268265_10063476 | Ga0268265_100634762 | 317 |
| 408 | 3300028381 | Ga0268264_10100442 | Ga0268264_101004424 | 317 |
| 409 | 3300028381 | Ga0268264_10153247 | Ga0268264_101532471 | 317 |
| 410 | 3300028381 | Ga0268264_10159320 | Ga0268264_101593202 | 317 |
| 411 | 3300028794 | Ga0307515_10003491 | Ga0307515_1000349110 | 317 |
| 412 | 3300031238 | Ga0265332_10008807 | Ga0265332_100088077 | 317 |
| 413 | 3300031731 | Ga0307405_10156630 | Ga0307405_101566301 | 317 |
| 414 | 3300031824 | Ga0307413_10050646 | Ga0307413_100506462 | 317 |
| 415 | 3300031901 | Ga0307406_10107008 | Ga0307406_101070081 | 317 |
| 416 | 3300031911 | Ga0307412_10136054 | Ga0307412_101360542 | 317 |
| 417 | 3300032002 | Ga0307416_100411930 | Ga0307416_1004119302 | 317 |
| 418 | 3300032002 | Ga0307416_100430747 | Ga0307416_1004307471 | 317 |
| 419 | 3300032004 | Ga0307414_10002794 | Ga0307414_100027944 | 317 |
| 420 | 3300032005 | Ga0307411_10004628 | Ga0307411_100046284 | 317 |
| 421 | 3300032126 | Ga0307415_100063379 | Ga0307415_1000633792 | 317 |
| 422 | 3300032126 | Ga0307415_100185262 | Ga0307415_1001852622 | 317 |
| 423 | 3300035090 | Ga0373949_0000002 | Ga0373949_0000002_95481_96575 | 317 |
| 424 | 3300037418 | Ga0395900_0104225 | Ga0395900_0104225_1927_2880 | 317 |
| 425 | 3300037466 | Ga0395898_0015621 | Ga0395898_0015621_3621_4574 | 317 |
| 426 | 3300037466 | Ga0395898_0041835 | Ga0395898_0041835_954_1910 | 317 |
| 427 | 3300038443 | Ga0395901_0228634 | Ga0395901_0228634_662_1615 | 317 |
| 428 | 3300038443 | Ga0395901_0597298 | Ga0395901_0597298_106_1059 | 317 |
| 429 | 3300042005 | Ga0439448_0014612 | Ga0439448_0014612_1113_2066 | 317 |
| 430 | 3300042157 | Ga0439458_0001329 | Ga0439458_0001329_395_1348 | 317 |
| 431 | 3300046473 | Ga0495582_0206352 | Ga0495582_0206352_104_1057 | 317 |
| 432 | 3300048905 | Ga0496102_0009856 | Ga0496102_0009856_3618_4577 | 317 |
| 433 | 3300048905 | Ga0496102_0371516 | Ga0496102_0371516_75_1028 | 317 |
| 434 | 3300048909 | Ga0496106_0016826 | Ga0496106_0016826_2681_3634 | 317 |
| 435 | 3300048909 | Ga0496106_0099674 | Ga0496106_0099674_100_1059 | 317 |
| 436 | 3300048910 | Ga0496107_0014787 | Ga0496107_0014787_1978_2931 | 317 |
| 437 | 3300048911 | Ga0496108_0405714 | Ga0496108_0405714_31_990 | 317 |
| 438 | 3300048913 | Ga0496110_0547639 | Ga0496110_0547639_20_973 | 317 |
| 439 | 3300048914 | Ga0496111_0133108 | Ga0496111_0133108_42_1001 | 317 |
| 440 | 3300048915 | Ga0496112_0179328 | Ga0496112_0179328_325_1281 | 317 |
| 441 | 3300048915 | Ga0496112_0182205 | Ga0496112_0182205_817_1770 | 317 |
| 442 | 3300048915 | Ga0496112_0191386 | Ga0496112_0191386_978_1931 | 317 |
| 443 | 3300049514 | Ga0501291_001239 | Ga0501291_001239_1939_2925 | 317 |
| 444 | 3300049522 | Ga0501299_005123 | Ga0501299_005123_992_1978 | 317 |
| 445 | 3300049574 | Ga0501038_0016873 | Ga0501038_0016873_5074_6027 | 317 |
| 446 | 3300049585 | Ga0501069_0107064 | Ga0501069_0107064_187_1140 | 317 |
| 447 | 3300049654 | Ga0501207_000932 | Ga0501207_000932_2156_3109 | 317 |
| 448 | 3300049660 | Ga0501216_003201 | Ga0501216_003201_23_991 | 317 |
| 449 | 3300049661 | Ga0501217_008628 | Ga0501217_008628_357_1310 | 317 |
| 450 | 3300049663 | Ga0501223_006284 | Ga0501223_006284_646_1614 | 317 |
| 451 | 3300049664 | Ga0501224_000630 | Ga0501224_000630_1961_2914 | 317 |
| 452 | 3300049665 | Ga0501227_002526 | Ga0501227_002526_954_1907 | 317 |
| 453 | 3300049688 | Ga0501259_014066 | Ga0501259_014066_41_1009 | 317 |
| 454 | 3300049688 | Ga0501259_016877 | Ga0501259_016877_275_1228 | 317 |
| 455 | 3300049705 | Ga0501225_0000657 | Ga0501225_0000657_2220_3173 | 317 |
| 456 | 3300049707 | Ga0501234_001847 | Ga0501234_001847_1775_2728 | 317 |
| 457 | 3300049779 | Ga0501283_007718 | Ga0501283_007718_244_1212 | 317 |
| 458 | 3300049779 | Ga0501283_016116 | Ga0501283_016116_46_999 | 317 |
| 459 | 3300050507 | nmdc:mga05p37_134431_c1 | nmdc:mga05p37_134431_c1_2001_2960 | 317 |
| 460 | 3300050507 | nmdc:mga05p37_15372_c1 | nmdc:mga05p37_15372_c1_5659_6612 | 317 |
| 461 | 3300050507 | nmdc:mga05p37_208510_c1 | nmdc:mga05p37_208510_c1_500_1453 | 317 |
| 462 | 3300050507 | nmdc:mga05p37_49287_c1 | nmdc:mga05p37_49287_c1_1588_2541 | 317 |
| 463 | 3300050507 | nmdc:mga05p37_50790_c1 | nmdc:mga05p37_50790_c1_2463_3416 | 317 |
| 464 | 3300050508 | nmdc:mga09592_26460_c1 | nmdc:mga09592_26460_c1_1234_2187 | 317 |
| 465 | 3300050509 | nmdc:mga0qj67_52941_c1 | nmdc:mga0qj67_52941_c1_1500_2453 | 317 |
| 466 | 3300050511 | nmdc:mga08y16_8785_c1 | nmdc:mga08y16_8785_c1_8711_9664 | 317 |
| 467 | 3300050512 | nmdc:mga0n895_246416_c1 | nmdc:mga0n895_246416_c1_176_1135 | 317 |
| 468 | 3300050512 | nmdc:mga0n895_326904_c1 | nmdc:mga0n895_326904_c1_87_1040 | 317 |
| 469 | 3300050512 | nmdc:mga0n895_80823_c1 | nmdc:mga0n895_80823_c1_336_1298 | 317 |
| 470 | 3300050514 | nmdc:mga08x19_1646_c2 | nmdc:mga08x19_1646_c2_236_1189 | 317 |
| 471 | 3300050515 | nmdc:mga0a205_103911_c1 | nmdc:mga0a205_103911_c1_1109_2071 | 317 |
| 472 | 3300050515 | nmdc:mga0a205_152845_c1 | nmdc:mga0a205_152845_c1_264_1217 | 317 |
| 473 | 3300050515 | nmdc:mga0a205_300533_c1 | nmdc:mga0a205_300533_c1_129_1088 | 317 |
| 474 | 3300050515 | nmdc:mga0a205_34073_c2 | nmdc:mga0a205_34073_c2_884_1837 | 317 |
| 475 | 3300050515 | nmdc:mga0a205_75622_c1 | nmdc:mga0a205_75622_c1_1708_2661 | 317 |
| 476 | 3300050515 | nmdc:mga0a205_94478_c1 | nmdc:mga0a205_94478_c1_1558_2511 | 317 |
| 477 | 3300053178 | Ga0500637_0035399 | Ga0500637_0035399_800_1780 | 317 |
| 478 | 3300005445 | Ga0070708_100201526 | Ga0070708_1002015262 | 319 |
| 479 | 3300005471 | Ga0070698_100122266 | Ga0070698_1001222662 | 319 |
| 480 | 3300005518 | Ga0070699_100028441 | Ga0070699_1000284415 | 319 |
| 481 | 3300005536 | Ga0070697_100000042 | Ga0070697_10000004235 | 319 |
| 482 | 2162886007 | SwRhRL2b_contig_1244686 | SwRhRL2b_0092.00001370 | 320 |
| 483 | 3300005289 | Ga0065704_10080862 | Ga0065704_100808624 | 320 |
| 484 | 3300005293 | Ga0065715_10091179 | Ga0065715_100911794 | 320 |
| 485 | 3300005293 | Ga0065715_10209568 | Ga0065715_102095681 | 320 |
| 486 | 3300005295 | Ga0065707_10240432 | Ga0065707_102404321 | 320 |
| 487 | 3300005331 | Ga0070670_100001205 | Ga0070670_10000120513 | 320 |
| 488 | 3300005334 | Ga0068869_100029900 | Ga0068869_1000299005 | 320 |
| 489 | 3300005337 | Ga0070682_100000051 | Ga0070682_10000005190 | 320 |
| 490 | 3300005438 | Ga0070701_10086495 | Ga0070701_100864952 | 320 |
| 491 | 3300005440 | Ga0070705_100061538 | Ga0070705_1000615383 | 320 |
| 492 | 3300005440 | Ga0070705_100083776 | Ga0070705_1000837762 | 320 |
| 493 | 3300005444 | Ga0070694_100154274 | Ga0070694_1001542741 | 320 |
| 494 | 3300005444 | Ga0070694_100272810 | Ga0070694_1002728101 | 320 |
| 495 | 3300005467 | Ga0070706_100019218 | Ga0070706_1000192182 | 320 |
| 496 | 3300005471 | Ga0070698_100010300 | Ga0070698_1000103007 | 320 |
| 497 | 3300005471 | Ga0070698_100015979 | Ga0070698_1000159793 | 320 |
| 498 | 3300005536 | Ga0070697_100003739 | Ga0070697_1000037396 | 320 |
| 499 | 3300005544 | Ga0070686_100014669 | Ga0070686_1000146692 | 320 |
| 500 | 3300005545 | Ga0070695_100229709 | Ga0070695_1002297091 | 320 |
| 501 | 3300005546 | Ga0070696_100239671 | Ga0070696_1002396711 | 320 |
| 502 | 3300005549 | Ga0070704_100123251 | Ga0070704_1001232512 | 320 |
| 503 | 3300005549 | Ga0070704_100537424 | Ga0070704_1005374241 | 320 |
| 504 | 3300009148 | Ga0105243_10070485 | Ga0105243_100704851 | 320 |
| 505 | 3300009148 | Ga0105243_10103913 | Ga0105243_101039132 | 320 |
| 506 | 3300013297 | Ga0157378_10069987 | Ga0157378_100699871 | 320 |
| 507 | 3300014326 | Ga0157380_10042001 | Ga0157380_100420013 | 320 |
| 508 | 3300025910 | Ga0207684_10001129 | Ga0207684_100011295 | 320 |
| 509 | 3300025925 | Ga0207650_10000675 | Ga0207650_1000067519 | 320 |
| 510 | 3300025935 | Ga0207709_10047006 | Ga0207709_100470063 | 320 |
| 511 | 3300025942 | Ga0207689_10005172 | Ga0207689_100051721 | 320 |
| 512 | 3300025960 | Ga0207651_10084175 | Ga0207651_100841752 | 320 |
| 513 | 3300046525 | Ga0495663_0000205 | Ga0495663_0000205_2861_3823 | 320 |
| 514 | 3300046537 | Ga0495598_0000026 | Ga0495598_0000026_5023_5985 | 320 |
| 515 | 3300046539 | Ga0495621_0000017 | Ga0495621_0000017_24903_25865 | 320 |
| 516 | 3300047320 | Ga0495672_0006640 | Ga0495672_0006640_4702_5664 | 320 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qe3-assembly1.cif.gz_A | sheep liver sorbitol dehydrogenase | 0.9178 | 2 | 320 |
| 4ejm-assembly1.cif.gz_A | crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to nadp | 0.9152 | 2 | 320 |
| 4ilk-assembly1.cif.gz_A | crystal structure of short chain alcohol dehydrogenase (rspb) from e. coli cft073 (efi target efi-506413) complexed with cofactor nadh | 0.915 | 1 | 320 |
| 1pl6-assembly1.cif.gz_A | human sdh/nadh/inhibitor complex | 0.9149 | 2 | 320 |
| 4uej-assembly1.cif.gz_A | closed state of galactitol-1-phosphate 5-dehydrogenase from e. coli in complex with glycerol. | 0.9135 | 1 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HWA7_1_176_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9488 | 154 | 183 | 3.50.50.60 |
| af_I1JQG5_3_382_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9285 | 155 | 186 | 3.50.50.60 |
| af_A0A1D6E3F3_39_301_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9206 | 155 | 187 | 3.50.50.60 |
| af_Q54H99_9_164_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9156 | 154 | 186 | 3.50.50.60 |
| af_F1Q713_10_342_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9152 | 6 | 313 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353CC17-F1-model_v4 | Dehydrogenase | 0.9867 | 1 | 133 |
|
| AF-A0A1X4G6N6-F1-model_v4 | Alcohol dehydrogenase | 0.9741 | 1 | 320 |
|
| AF-A0A447G1P2-F1-model_v4 | deleted | 0.9725 | 1 | 320 |
|
| AF-A0A496TK90-F1-model_v4 | Alcohol dehydrogenase | 0.9713 | 1 | 320 |
|
| AF-A0A447G1P2-F1-model_v4 | deleted | 0.9694 | 1 | 320 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar