F457964

General Info

Members Datasets Scaffolds Average Seq Length
516 316 511 162

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100111402|Ga0070714_1001114022
Length 188
Sequence MLSKTCTIEKMSSSFGDPTPITPAPMSTYTLSVNGQSHSVDVTPDTPLLWVLRDSLGLVGTKYGCGIGECGACTVHLDGAAKRACQTAISDVGRAEVTTIEGLDPAGKHPLQQAWCELDVPQCGYCQGGQIMTAAALLKSNPRPTDADIDRTMSGNLCRCASYYRIRAGIKRAAELTAGATPANGGQS

Samples

Sample ID Description Type Environment
1 2643221583 Caulobacter sp. Root655 Isolate Unclassified
2 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
3 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
4 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
5 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
143 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
144 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
148 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
190 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
215 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
246 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
247 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
252 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
264 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
283 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
289 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
290 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
291 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
292 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
293 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
294 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
295 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
296 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
297 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
298 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
299 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
300 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
301 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
302 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
303 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
306 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
307 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
308 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
309 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
310 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
311 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
312 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
313 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
314 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
315 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0.97
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.2
Nodule 0
Rhizoplane 1.36
Rhizosphere 89.34
Stem 0
Stem Tuber 0
Unclassified 3.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10031117 3300003322 Bacteria 4104
2 rootL2_10033961 3300003322 Bacteria 10305
3 rootL2_10110047 3300003322 Bacteria 1664
4 rootH1_10014934 3300003323 Bacteria 16432
5 JGI25404J52841_10009761 3300003659 Bacteria 2057
6 Ga0058863_10032759 3300004799 Bacteria 3240
7 Ga0058861_10029376 3300004800 Bacteria 1266
8 Ga0058862_12650850 3300004803 Bacteria 1066
9 Ga0058862_12859001 3300004803 Bacteria 3318
10 Ga0070683_100012825 3300005329 Bacteria 7294
11 Ga0070683_100024987 3300005329 Bacteria 5358
12 Ga0070683_100056927 3300005329 Bacteria 3631
13 Ga0070683_100270691 3300005329 Unclassified 1616
14 Ga0070683_100596360 3300005329 Bacteria 1057
15 Ga0070683_100859276 3300005329 Bacteria 870
16 Ga0070690_100149200 3300005330 Bacteria 1594
17 Ga0070690_100251961 3300005330 Bacteria 1249
18 Ga0070670_100008411 3300005331 Bacteria 8796
19 Ga0068869_101024647 3300005334 Bacteria 720
20 Ga0070666_10126744 3300005335 Bacteria 1772
21 Ga0070680_100024507 3300005336 Bacteria 4821
22 Ga0070680_100126717 3300005336 Bacteria 2134
23 Ga0070680_100580343 3300005336 Bacteria 962
24 Ga0070680_101512936 3300005336 Bacteria 581
25 Ga0070682_100010752 3300005337 Bacteria 5205
26 Ga0070660_100020159 3300005339 Bacteria 4896
27 Ga0070689_100127275 3300005340 Bacteria 2039
28 Ga0070689_101849991 3300005340 Bacteria 551
29 Ga0070687_100813852 3300005343 Bacteria 663
30 Ga0070661_100100903 3300005344 Bacteria 2146
31 Ga0070661_100870557 3300005344 Bacteria 742
32 Ga0070668_100944767 3300005347 Bacteria 772
33 Ga0070675_100041543 3300005354 Bacteria 3756
34 Ga0070671_100497776 3300005355 Bacteria 1048
35 Ga0070674_101265397 3300005356 Bacteria 657
36 Ga0070673_100007403 3300005364 Bacteria 7236
37 Ga0070673_100286777 3300005364 Bacteria 1446
38 Ga0070673_100623859 3300005364 Bacteria 985
39 Ga0070688_100009049 3300005365 Bacteria 5430
40 Ga0070667_100206137 3300005367 Bacteria 1746
41 Ga0070667_100227566 3300005367 Bacteria 1662
42 Ga0070709_10010971 3300005434 Bacteria 5032
43 Ga0070714_100111402 3300005435 Bacteria 2424
44 Ga0070705_100402208 3300005440 Bacteria 1014
45 Ga0070708_100000494 3300005445 Bacteria 29731
46 Ga0070708_100664938 3300005445 Bacteria 981
47 Ga0070663_100387145 3300005455 Bacteria 1140
48 Ga0070678_100732665 3300005456 Bacteria 893
49 Ga0070678_101008026 3300005456 Bacteria 766
50 Ga0070662_100019485 3300005457 Bacteria 4606
51 Ga0070681_10004438 3300005458 Bacteria 13364
52 Ga0070681_10029352 3300005458 Bacteria 5523
53 Ga0070681_10061105 3300005458 Bacteria 3744
54 Ga0070685_10621407 3300005466 Bacteria 780
55 Ga0070706_100197676 3300005467 Bacteria 1878
56 Ga0070679_100001857 3300005530 Bacteria 18992
57 Ga0070679_100004565 3300005530 Bacteria 12789
58 Ga0070679_100024072 3300005530 Bacteria 5965
59 Ga0070679_100581990 3300005530 Bacteria 1063
60 Ga0070684_100047868 3300005535 Bacteria 3707
61 Ga0070684_100069700 3300005535 Bacteria 3092
62 Ga0070684_100103639 3300005535 Bacteria 2545
63 Ga0070684_100193321 3300005535 Bacteria 1852
64 Ga0070684_100243311 3300005535 Bacteria 1644
65 Ga0070684_100255050 3300005535 Bacteria 1603
66 Ga0070684_100506800 3300005535 Bacteria 1118
67 Ga0070686_100142072 3300005544 Bacteria 1672
68 Ga0070695_100064459 3300005545 Bacteria 2384
69 Ga0070696_100000289 3300005546 Bacteria 30405
70 Ga0070693_100006910 3300005547 Bacteria 5518
71 Ga0070665_100068008 3300005548 Bacteria 3572
72 Ga0070665_100358276 3300005548 Bacteria 1464
73 Ga0068855_100187902 3300005563 Bacteria 2332
74 Ga0070664_100074197 3300005564 Bacteria 2920
75 Ga0070664_100086790 3300005564 Unclassified 2704
76 Ga0070664_100654097 3300005564 Bacteria 977
77 Ga0070664_100827237 3300005564 Bacteria 866
78 Ga0068856_100079040 3300005614 Bacteria 3261
79 Ga0068856_100121434 3300005614 Bacteria 2614
80 Ga0068856_101403008 3300005614 Bacteria 713
81 Ga0070702_100008765 3300005615 Bacteria 4917
82 Ga0070702_100541827 3300005615 Bacteria 862
83 Ga0068852_100080241 3300005616 Bacteria 2892
84 Ga0068859_100024088 3300005617 Bacteria 6108
85 Ga0068859_101216077 3300005617 Bacteria 830
86 Ga0068866_10863047 3300005718 Bacteria 634
87 Ga0068860_100020204 3300005843 Bacteria 6455
88 Ga0081540_1005479 3300005983 Bacteria 9470
89 Ga0081540_1031094 3300005983 Bacteria 2944
90 Ga0081540_1053744 3300005983 Bacteria 1973
91 Ga0070717_10334111 3300006028 Bacteria 1352
92 Ga0070716_100097312 3300006173 Bacteria 1796
93 Ga0097621_100762020 3300006237 Bacteria 894
94 Ga0097621_101054144 3300006237 Bacteria 762
95 Ga0068871_100182402 3300006358 Bacteria 1804
96 Ga0075430_100139716 3300006846 Bacteria 2017
97 Ga0075431_100142684 3300006847 Bacteria 2469
98 Ga0075433_10068524 3300006852 Bacteria 3115
99 Ga0068865_100214398 3300006881 Bacteria 1502
100 Ga0097620_100024088 3300006931 Bacteria 6108
101 Ga0097620_101216076 3300006931 Bacteria 830
102 Ga0075435_100506290 3300007076 Bacteria 1044
103 Ga0105245_10014485 3300009098 Bacteria 6868
104 Ga0105245_10306877 3300009098 Bacteria 1559
105 Ga0105243_10286293 3300009148 Bacteria 1487
106 Ga0105243_10761868 3300009148 Bacteria 950
107 Ga0105241_10037359 3300009174 Bacteria 3658
108 Ga0105241_11547553 3300009174 Bacteria 640
109 Ga0105242_10296316 3300009176 Bacteria 1474
110 Ga0105242_10334988 3300009176 Bacteria 1393
111 Ga0105248_10021923 3300009177 Bacteria 7078
112 Ga0105248_10536658 3300009177 Bacteria 1319
113 Ga0105248_10730201 3300009177 Bacteria 1117
114 Ga0105237_10262707 3300009545 Bacteria 1729
115 Ga0105238_12389455 3300009551 Bacteria 564
116 Ga0105249_10926245 3300009553 Bacteria 939
117 Ga0099796_10024787 3300010159 Bacteria 1887
118 Ga0105239_10687755 3300010375 Bacteria 1169
119 Ga0105239_11681939 3300010375 Bacteria 734
120 Ga0105246_10068452 3300011119 Bacteria 2490
121 Ga0105246_10133341 3300011119 Bacteria 1858
122 Ga0157373_10028569 3300013100 Bacteria 4023
123 Ga0157373_10312598 3300013100 Bacteria 1117
124 Ga0157370_10086558 3300013104 Bacteria 2944
125 Ga0157370_10098753 3300013104 Bacteria 2737
126 Ga0157370_10848312 3300013104 Bacteria 830
127 Ga0157369_10234203 3300013105 Bacteria 1919
128 Ga0157369_10598761 3300013105 Bacteria 1138
129 Ga0157369_11605615 3300013105 Bacteria 661
130 Ga0157374_10721824 3300013296 Bacteria 1010
131 Ga0157378_11819558 3300013297 Bacteria 657
132 Ga0157378_12591636 3300013297 Bacteria 559
133 Ga0163162_10539488 3300013306 Bacteria 1295
134 Ga0157372_10003395 3300013307 Bacteria 17187
135 Ga0157372_10022621 3300013307 Bacteria 6804
136 Ga0157372_10342487 3300013307 Bacteria 1741
137 Ga0157372_10481173 3300013307 Bacteria 1447
138 Ga0157372_10865043 3300013307 Bacteria 1049
139 Ga0157372_10922411 3300013307 Bacteria 1013
140 Ga0157375_10066711 3300013308 Bacteria 3594
141 Ga0157375_10173212 3300013308 Bacteria 2306
142 Ga0157375_10544698 3300013308 Bacteria 1322
143 Ga0157375_11159260 3300013308 Bacteria 906
144 Ga0163163_10041187 3300014325 Bacteria 4516
145 Ga0163163_10709289 3300014325 Bacteria 1070
146 Ga0163163_10853720 3300014325 Bacteria 974
147 Ga0157380_10392505 3300014326 Bacteria 1314
148 Ga0157377_10122357 3300014745 Bacteria 1579
149 Ga0157376_10018950 3300014969 Bacteria 5291
150 Ga0157376_10357491 3300014969 Bacteria 1400
151 Ga0157376_10735482 3300014969 Bacteria 994
152 Ga0182007_10162035 3300015262 Bacteria 765
153 Ga0213873_10000314 3300021358 Bacteria 8243
154 Ga0213872_10017536 3300021361 Bacteria 3307
155 Ga0213872_10067832 3300021361 Bacteria 1610
156 Ga0213874_10017392 3300021377 Bacteria 1928
157 Ga0213876_10022155 3300021384 Bacteria 3360
158 Ga0213871_10050474 3300021441 Bacteria 1138
159 Ga0209564_1027065 3300025295 Bacteria 1873
160 Ga0207692_10000427 3300025898 Bacteria 14774
161 Ga0207642_10527748 3300025899 Bacteria 726
162 Ga0207647_10170765 3300025904 Bacteria 1266
163 Ga0207699_10000213 3300025906 Bacteria 34254
164 Ga0207645_10150291 3300025907 Bacteria 1520
165 Ga0207705_10756443 3300025909 Bacteria 755
166 Ga0207707_10009363 3300025912 Bacteria 8496
167 Ga0207707_10025736 3300025912 Bacteria 5147
168 Ga0207707_10061052 3300025912 Bacteria 3280
169 Ga0207707_10697642 3300025912 Bacteria 852
170 Ga0207695_10101967 3300025913 Bacteria 2864
171 Ga0207693_10010945 3300025915 Bacteria 7350
172 Ga0207663_10012297 3300025916 Bacteria 4624
173 Ga0207660_10043349 3300025917 Bacteria 3162
174 Ga0207660_10139369 3300025917 Bacteria 1853
175 Ga0207662_10262666 3300025918 Bacteria 1137
176 Ga0207657_10023463 3300025919 Bacteria 5743
177 Ga0207649_10018032 3300025920 Bacteria 4006
178 Ga0207652_10005321 3300025921 Bacteria 10442
179 Ga0207652_10006050 3300025921 Bacteria 9795
180 Ga0207652_10049728 3300025921 Bacteria 3590
181 Ga0207652_10232723 3300025921 Bacteria 1661
182 Ga0207652_10321451 3300025921 Bacteria 1397
183 Ga0207646_11666326 3300025922 Bacteria 549
184 Ga0207694_10036296 3300025924 Bacteria 3782
185 Ga0207650_10674122 3300025925 Bacteria 872
186 Ga0207659_10302257 3300025926 Unclassified 1314
187 Ga0207687_10017035 3300025927 Bacteria 4777
188 Ga0207700_10099356 3300025928 Bacteria 2317
189 Ga0207664_10003422 3300025929 Bacteria 10577
190 Ga0207644_10745297 3300025931 Bacteria 818
191 Ga0207644_11637912 3300025931 Bacteria 540
192 Ga0207690_10973395 3300025932 Bacteria 705
193 Ga0207706_10071082 3300025933 Bacteria 3060
194 Ga0207706_10075649 3300025933 Bacteria 2961
195 Ga0207686_10102656 3300025934 Bacteria 1912
196 Ga0207686_10116904 3300025934 Bacteria 1808
197 Ga0207670_10100351 3300025936 Bacteria 2066
198 Ga0207665_10010201 3300025939 Bacteria 6168
199 Ga0207665_10242088 3300025939 Archaea 1329
200 Ga0207711_10207961 3300025941 Bacteria 1787
201 Ga0207689_10045647 3300025942 Bacteria 3622
202 Ga0207689_10216700 3300025942 Bacteria 1582
203 Ga0207661_10005343 3300025944 Bacteria 9043
204 Ga0207661_10014967 3300025944 Bacteria 5696
205 Ga0207661_10122822 3300025944 Bacteria 2213
206 Ga0207661_10249360 3300025944 Bacteria 1577
207 Ga0207661_10328323 3300025944 Bacteria 1376
208 Ga0207661_10379229 3300025944 Bacteria 1280
209 Ga0207661_10515401 3300025944 Bacteria 1093
210 Ga0207679_10059934 3300025945 Bacteria 2826
211 Ga0207679_10818004 3300025945 Bacteria 850
212 Ga0207667_10080584 3300025949 Bacteria 3373
213 Ga0207651_10170950 3300025960 Bacteria 1714
214 Ga0207668_10331808 3300025972 Bacteria 1266
215 Ga0207668_11299626 3300025972 Bacteria 655
216 Ga0207678_10251262 3300026067 Bacteria 1514
217 Ga0207702_10077274 3300026078 Bacteria 2879
218 Ga0207702_10410800 3300026078 Unclassified 1307
219 Ga0207648_10082795 3300026089 Bacteria 2798
220 Ga0207676_10123894 3300026095 Bacteria 2184
221 Ga0207676_10369896 3300026095 Bacteria 1331
222 Ga0207674_10001931 3300026116 Bacteria 26314
223 Ga0207674_10161318 3300026116 Bacteria 2196
224 Ga0207683_10292987 3300026121 Bacteria 1488
225 Ga0207683_10419960 3300026121 Bacteria 1232
226 Ga0207698_10542118 3300026142 Bacteria 1139
227 Ga0207428_10141857 3300027907 Bacteria 1833
228 Ga0268266_10047169 3300028379 Bacteria 3690
229 Ga0268266_10266276 3300028379 Bacteria 1590
230 Ga0268265_11410548 3300028380 Bacteria 699
231 Ga0268264_10377173 3300028381 Bacteria 1357
232 Ga0265337_1030410 3300028556 Bacteria 1608
233 Ga0265326_10015744 3300028558 Bacteria 2191
234 Ga0265319_1001014 3300028563 Bacteria 17548
235 Ga0265319_1001685 3300028563 Bacteria 12765
236 Ga0265319_1002881 3300028563 Bacteria 9188
237 Ga0265319_1011749 3300028563 Bacteria 3566
238 Ga0265319_1049898 3300028563 Bacteria 1384
239 Ga0265334_10005729 3300028573 Bacteria 5415
240 Ga0265334_10010638 3300028573 Bacteria 3884
241 Ga0265318_10001158 3300028577 Bacteria 16360
242 Ga0265318_10002409 3300028577 Bacteria 10004
243 Ga0265318_10005763 3300028577 Bacteria 5788
244 Ga0265318_10038052 3300028577 Bacteria 1841
245 Ga0265322_10031570 3300028654 Bacteria 1512
246 Ga0265336_10088368 3300028666 Bacteria 924
247 Ga0265338_10007620 3300028800 Bacteria 13362
248 Ga0265338_10082599 3300028800 Bacteria 2689
249 Ga0265338_10086852 3300028800 Bacteria 2601
250 Ga0265330_10003624 3300031235 Bacteria 8037
251 Ga0265332_10036124 3300031238 Bacteria 2145
252 Ga0265332_10216163 3300031238 Bacteria 795
253 Ga0265328_10006874 3300031239 Bacteria 4779
254 Ga0265328_10031108 3300031239 Bacteria 1985
255 Ga0265328_10078547 3300031239 Bacteria 1216
256 Ga0265320_10000575 3300031240 Bacteria 28210
257 Ga0265320_10007360 3300031240 Bacteria 6834
258 Ga0265320_10011301 3300031240 Bacteria 5260
259 Ga0265320_10014274 3300031240 Bacteria 4528
260 Ga0265320_10024753 3300031240 Bacteria 3168
261 Ga0265320_10096682 3300031240 Bacteria 1363
262 Ga0265325_10004359 3300031241 Bacteria 8957
263 Ga0265329_10001559 3300031242 Bacteria 10975
264 Ga0265340_10007496 3300031247 Bacteria 5923
265 Ga0265340_10035080 3300031247 Bacteria 2492
266 Ga0265339_10068859 3300031249 Bacteria 1890
267 Ga0265331_10004592 3300031250 Bacteria 8586
268 Ga0265331_10008083 3300031250 Bacteria 6009
269 Ga0265331_10096038 3300031250 Bacteria 1367
270 Ga0265316_10006913 3300031344 Bacteria 10763
271 Ga0265316_10060798 3300031344 Bacteria 2936
272 Ga0265316_10098940 3300031344 Bacteria 2219
273 Ga0265316_10186991 3300031344 Bacteria 1540
274 Ga0265316_10527086 3300031344 Unclassified 842
275 Ga0265313_10001119 3300031595 Bacteria 25614
276 Ga0265313_10003063 3300031595 Bacteria 13875
277 Ga0265313_10004776 3300031595 Bacteria 10210
278 Ga0265313_10006776 3300031595 Bacteria 8011
279 Ga0265313_10021622 3300031595 Bacteria 3514
280 Ga0265314_10010603 3300031711 Bacteria 7669
281 Ga0265314_10521630 3300031711 Bacteria 622
282 Ga0265342_10003518 3300031712 Bacteria 12809
283 Ga0265342_10014230 3300031712 Bacteria 5289
284 Ga0265342_10086331 3300031712 Bacteria 1804
285 Ga0265342_10088050 3300031712 Bacteria 1783
286 Ga0307409_100656861 3300031995 Bacteria 1043
287 Ga0307416_101194964 3300032002 Bacteria 866
288 Ga0307411_10789687 3300032005 Bacteria 835
289 Ga0373926_0124741 3300035083 Bacteria 972
290 Ga0373934_0044387 3300035086 Bacteria 1757
291 Ga0373923_0003560 3300035111 Bacteria 5013
292 Ga0373923_0184696 3300035111 Bacteria 959
293 Ga0373945_0500040 3300035116 Unclassified 542
294 Ga0373954_0061835 3300035118 Bacteria 1768
295 Ga0373954_0107020 3300035118 Bacteria 1351
296 Ga0373956_0004997 3300035119 Bacteria 5312
297 Ga0373956_0022145 3300035119 Bacteria 2716
298 Ga0373957_0135320 3300035120 Bacteria 1005
299 Ga0373955_0001186 3300035172 Bacteria 11101
300 Ga0373955_0007825 3300035172 Bacteria 4929
301 Ga0373955_0033854 3300035172 Bacteria 2693
302 Ga0373962_0193779 3300035242 Bacteria 685
303 Ga0373924_0000442 3300035410 Bacteria 12714
304 Ga0373924_0089787 3300035410 Bacteria 1314
305 Ga0373931_0029518 3300035691 Bacteria 2816
306 Ga0373935_0058419 3300035692 Bacteria 2464
307 Ga0373935_1117030 3300035692 Bacteria 587
308 Ga0373927_0215547 3300035695 Bacteria 1261
309 Ga0373933_0000501 3300035724 Bacteria 24379
310 Ga0373933_0027715 3300035724 Bacteria 3265
311 Ga0373947_0096074 3300035725 Bacteria 1855
312 Ga0373947_0565618 3300035725 Bacteria 774
313 Ga0373937_0000649 3300036401 Bacteria 30519
314 Ga0373937_0006774 3300036401 Bacteria 9891
315 Ga0373937_0428729 3300036401 Bacteria 1255
316 Ga0373925_0121458 3300037068 Bacteria 2028
317 Ga0436364_1347693 3300037853 Bacteria 1106
318 Ga0436365_0003491 3300039437 Bacteria 5126
319 Ga0436365_1926543 3300039437 Bacteria 3906
320 Ga0436360_0192702 3300039438 Bacteria 9450
321 Ga0436360_1059052 3300039438 Bacteria 964
322 Ga0436360_1344670 3300039438 Bacteria 2360
323 Ga0436361_0090190 3300039447 Bacteria 1714
324 Ga0436361_0900803 3300039447 Bacteria 1295
325 Ga0436361_0900950 3300039447 Bacteria 2346
326 Ga0436361_1179158 3300039447 Bacteria 4064
327 Ga0436363_1318239 3300039450 Bacteria 3403
328 Ga0436362_0105480 3300039453 Bacteria 14435
329 Ga0436362_1208409 3300039453 Bacteria 750
330 Ga0451807_1825705 3300041486 Bacteria 561
331 Ga0450898_038793 3300042134 Bacteria 895
332 Ga0439434_0171290 3300042435 Bacteria 724
333 Ga0450916_038562 3300042530 Bacteria 720
334 Ga0451577_0002349 3300042876 Bacteria 22746
335 Ga0453684_0000534 3300044712 Bacteria 144649
336 Ga0453684_0397407 3300044712 Bacteria 1544
337 Ga0466957_0383343 3300044842 Bacteria 959
338 Ga0451576_0000087 3300045051 Bacteria 234554
339 Ga0451576_0006613 3300045051 Bacteria 14171
340 Ga0451576_0096701 3300045051 Bacteria 3071
341 Ga0466967_0892437 3300045976 Bacteria 884
342 Ga0495629_0039594 3300046459 Bacteria 3317
343 Ga0495629_0176785 3300046459 Bacteria 1480
344 Ga0495629_0437856 3300046459 Unclassified 886
345 Ga0495629_0495676 3300046459 Bacteria 824
346 Ga0495651_0000045 3300046462 Bacteria 90367
347 Ga0495651_0116316 3300046462 Bacteria 1970
348 Ga0495653_0000093 3300046463 Bacteria 74824
349 Ga0495580_0156548 3300046472 Bacteria 1577
350 Ga0495582_0019325 3300046473 Bacteria 3725
351 Ga0495639_0027462 3300046475 Bacteria 2520
352 Ga0495639_0100441 3300046475 Bacteria 1365
353 Ga0495662_0117476 3300046476 Bacteria 1305
354 Ga0495664_0063602 3300046477 Bacteria 2199
355 Ga0495594_0063626 3300046499 Unclassified 2044
356 Ga0495594_0296993 3300046499 Bacteria 920
357 Ga0495594_0382315 3300046499 Bacteria 801
358 Ga0495608_0009509 3300046511 Bacteria 6791
359 Ga0495608_0224645 3300046511 Bacteria 1177
360 Ga0495618_0034143 3300046514 Bacteria 3189
361 Ga0495618_0156092 3300046514 Bacteria 1456
362 Ga0495620_0027451 3300046515 Bacteria 2663
363 Ga0495628_0000568 3300046516 Bacteria 33938
364 Ga0495628_0302667 3300046516 Bacteria 1183
365 Ga0495630_0005102 3300046517 Bacteria 9234
366 Ga0495630_0067126 3300046517 Bacteria 2696
367 Ga0495630_0485383 3300046517 Bacteria 947
368 Ga0495643_0006921 3300046522 Bacteria 7378
369 Ga0495648_0131506 3300046524 Bacteria 1330
370 Ga0495648_0414226 3300046524 Bacteria 599
371 Ga0495666_0026970 3300046526 Bacteria 2828
372 Ga0495642_0271760 3300046528 Bacteria 742
373 Ga0495652_0000166 3300046529 Bacteria 75721
374 Ga0495652_0085729 3300046529 Bacteria 2588
375 Ga0495654_0070660 3300046530 Bacteria 1655
376 Ga0495665_0018414 3300046531 Bacteria 3753
377 Ga0495665_0100274 3300046531 Bacteria 1520
378 Ga0495665_0654722 3300046531 Bacteria 523
379 Ga0495586_0034625 3300046535 Bacteria 2713
380 Ga0495586_0041267 3300046535 Bacteria 2485
381 Ga0495586_0071502 3300046535 Bacteria 1896
382 Ga0495587_0003696 3300046536 Bacteria 10179
383 Ga0495609_0019944 3300046538 Bacteria 3100
384 Ga0495609_0039159 3300046538 Bacteria 2135
385 Ga0495597_0011191 3300046542 Bacteria 4353
386 Ga0495597_0015635 3300046542 Bacteria 3591
387 Ga0495645_0000218 3300046543 Bacteria 41357
388 Ga0495645_0000833 3300046543 Bacteria 20988
389 Ga0495622_0000742 3300046557 Bacteria 18318
390 Ga0495667_0000788 3300046559 Bacteria 20352
391 Ga0495667_0031759 3300046559 Bacteria 3541
392 Ga0495634_0126343 3300046642 Bacteria 1634
393 Ga0495634_0147095 3300046642 Bacteria 1492
394 Ga0495611_0260891 3300046648 Bacteria 802
395 Ga0495611_0353789 3300046648 Bacteria 674
396 Ga0495625_0032162 3300046660 Bacteria 3895
397 Ga0495625_0101921 3300046660 Bacteria 1971
398 Ga0495635_0000043 3300046663 Bacteria 84495
399 Ga0495657_0000172 3300046675 Bacteria 58377
400 Ga0495599_0002832 3300046678 Bacteria 10102
401 Ga0495599_0028469 3300046678 Bacteria 3502
402 Ga0495623_0000120 3300046679 Bacteria 48263
403 Ga0495623_0017600 3300046679 Bacteria 4614
404 Ga0495646_0000732 3300046680 Bacteria 18243
405 Ga0495647_0398115 3300046681 Bacteria 632
406 Ga0495658_0278172 3300046683 Unclassified 1056
407 Ga0495613_0012865 3300046689 Bacteria 6220
408 Ga0495613_0388303 3300046689 Bacteria 954
409 Ga0495600_0000093 3300046809 Bacteria 48851
410 Ga0495600_0046252 3300046809 Bacteria 2840
411 Ga0495581_0015761 3300047315 Bacteria 4389
412 Ga0495581_0138697 3300047315 Bacteria 1418
413 Ga0495581_0216599 3300047315 Bacteria 1119
414 Ga0495581_0469207 3300047315 Bacteria 732
415 Ga0495604_0000166 3300047317 Bacteria 57892
416 Ga0495674_0000520 3300047319 Bacteria 35433
417 Ga0495674_0005433 3300047319 Bacteria 12239
418 Ga0495674_1076488 3300047319 Bacteria 613
419 Ga0495672_0000630 3300047320 Bacteria 39369
420 Ga0495672_0005815 3300047320 Bacteria 9682
421 Ga0495672_0136607 3300047320 Bacteria 1285
422 Ga0495680_0005857 3300047322 Bacteria 11504
423 Ga0495687_069531 3300047443 Bacteria 1417
424 Ga0495675_0003188 3300047444 Bacteria 9859
425 Ga0495675_0007016 3300047444 Bacteria 6925
426 Ga0495677_0225374 3300047445 Bacteria 731
427 Ga0495679_009921 3300047446 Bacteria 3776
428 Ga0495681_0063444 3300047470 Bacteria 1695
429 Ga0495684_0000034 3300047471 Bacteria 111355
430 Ga0495684_0067224 3300047471 Bacteria 2726
431 Ga0495684_0166140 3300047471 Unclassified 1644
432 Ga0495593_0127547 3300047673 Bacteria 1293
433 Ga0495602_0000684 3300048088 Bacteria 31846
434 Ga0495602_0834068 3300048088 Bacteria 617
435 Ga0495614_0336647 3300048089 Bacteria 702
436 Ga0495626_0016415 3300048091 Bacteria 3759
437 Ga0496108_0450249 3300048911 Bacteria 1125
438 Ga0496109_0111163 3300048912 Bacteria 2548
439 Ga0496111_1009034 3300048914 Bacteria 596
440 Ga0496112_0005535 3300048915 Bacteria 10944
441 Ga0496113_0050543 3300048916 Bacteria 3100
442 Ga0496115_1106998 3300048918 Bacteria 600
443 Ga0496119_0004112 3300048922 Bacteria 14658
444 Ga0496120_0243442 3300048923 Bacteria 848
445 Ga0496125_0025606 3300048928 Bacteria 5399
446 Ga0501308_033133 3300049128 Bacteria 701
447 Ga0495682_0124141 3300049460 Bacteria 924
448 Ga0501291_029558 3300049514 Bacteria 918
449 Ga0501032_0001213 3300049569 Bacteria 20627
450 Ga0501032_0013091 3300049569 Bacteria 5908
451 Ga0501033_0003055 3300049570 Bacteria 13918
452 Ga0501036_0791629 3300049572 Bacteria 781
453 Ga0501036_1179783 3300049572 Bacteria 624
454 Ga0501037_0021558 3300049573 Bacteria 4763
455 Ga0501037_0030523 3300049573 Bacteria 3983
456 Ga0501043_0105330 3300049579 Bacteria 2216
457 Ga0501043_0245453 3300049579 Bacteria 1380
458 Ga0501046_0004848 3300049580 Bacteria 12122
459 Ga0501067_0000546 3300049583 Bacteria 20441
460 Ga0501070_1052507 3300049586 Bacteria 629
461 Ga0501072_0153559 3300049588 Bacteria 1836
462 Ga0501073_0000004 3300049589 Bacteria 261794
463 Ga0501077_0000008 3300049593 Bacteria 106496
464 Ga0501230_057797 3300049667 Bacteria 781
465 Ga0501080_0065118 3300049742 Bacteria 3391
466 Ga0501083_0286745 3300049744 Bacteria 1071
467 Ga0501035_1091396 3300049822 Bacteria 624
468 Ga0501044_0007493 3300049823 Bacteria 12004
469 Ga0501044_0050528 3300049823 Bacteria 4289
470 Ga0501044_0773155 3300049823 Bacteria 841
471 nmdc:mga05p37_98070_c1 3300050507 Bacteria 3610
472 nmdc:mga09592_166276_c1 3300050508 Bacteria 1907
473 nmdc:mga0qj67_118310_c1 3300050509 Bacteria 2142
474 nmdc:mga0qj67_166645_c1 3300050509 Bacteria 1789
475 nmdc:mga06r32_156416_c1 3300050510 Bacteria 2261
476 nmdc:mga06r32_43798_c1 3300050510 Bacteria 4259
477 nmdc:mga0a205_201001_c1 3300050515 Bacteria 1883
478 Ga0495601_0043447 3300053077 Bacteria 2822
479 Ga0495612_0000690 3300053078 Bacteria 13635
480 Ga0500635_0000080 3300053080 Bacteria 63214
481 Ga0500578_0155143 3300053086 Bacteria 1424
482 Ga0500643_000276 3300053087 Bacteria 44463
483 Ga0500647_0229388 3300053091 Bacteria 827
484 Ga0500583_0051768 3300053092 Bacteria 1909
485 Ga0500566_0095711 3300053094 Bacteria 1635
486 Ga0500555_001650 3300053103 Bacteria 6740
487 Ga0500556_0001835 3300053104 Bacteria 7755
488 Ga0500569_002128 3300053109 Bacteria 3854
489 Ga0500595_006120 3300053119 Bacteria 5157
490 Ga0500597_184228 3300053120 Bacteria 884
491 Ga0500607_198653 3300053121 Bacteria 865
492 Ga0500608_060472 3300053122 Bacteria 1811
493 Ga0500614_002135 3300053123 Bacteria 4509
494 Ga0500618_000024 3300053125 Bacteria 152149
495 Ga0500642_0042020 3300053130 Bacteria 1980
496 Ga0500559_0003697 3300053136 Bacteria 7459
497 Ga0500559_0013894 3300053136 Bacteria 3405
498 Ga0500559_0155332 3300053136 Bacteria 1074
499 Ga0500568_0006998 3300053139 Bacteria 5583
500 Ga0500577_0325912 3300053142 Bacteria 671
501 Ga0500590_011497 3300053148 Bacteria 4485
502 Ga0500619_109727 3300053154 Bacteria 939
503 Ga0500638_205536 3300053162 Bacteria 829
504 Ga0500636_0005352 3300053177 Bacteria 7318
505 Ga0500636_0093513 3300053177 Bacteria 1719
506 Ga0500637_0032253 3300053178 Bacteria 2920
507 Ga0500625_072625 3300053729 Bacteria 1526
508 Ga0500596_000241 3300053735 Bacteria 9458
509 Ga0500601_015292 3300053737 Bacteria 872
510 Ga0500661_000098 3300055283 Bacteria 14033
511 Ga0501082_0102568 3300060353 Bacteria 2475

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005330 Ga0070690_100251961 Ga0070690_1002519611 147
2 3300013307 Ga0157372_10481173 Ga0157372_104811731 147
3 3300025933 Ga0207706_10075649 Ga0207706_100756491 147
4 iso_pu_bacteria 2786546940 2788434762 147
5 iso_pu_bacteria 2919450847 2919455402 147
6 3300006846 Ga0075430_100139716 Ga0075430_1001397162 148
7 3300006847 Ga0075431_100142684 Ga0075431_1001426842 148
8 3300032005 Ga0307411_10789687 Ga0307411_107896872 148
9 3300037853 Ga0436364_1347693 Ga0436364_1347693_204_662 148
10 3300042134 Ga0450898_038793 Ga0450898_038793_138_617 148
11 3300042435 Ga0439434_0171290 Ga0439434_0171290_153_632 148
12 3300042530 Ga0450916_038562 Ga0450916_038562_27_506 148
13 3300046524 Ga0495648_0131506 Ga0495648_0131506_361_840 148
14 3300046538 Ga0495609_0039159 Ga0495609_0039159_763_1242 148
15 3300046542 Ga0495597_0015635 Ga0495597_0015635_525_1004 148
16 3300046681 Ga0495647_0398115 Ga0495647_0398115_31_489 148
17 3300047470 Ga0495681_0063444 Ga0495681_0063444_1166_1645 148
18 3300048091 Ga0495626_0016415 Ga0495626_0016415_3180_3659 148
19 3300049569 Ga0501032_0001213 Ga0501032_0001213_1364_1825 148
20 3300049572 Ga0501036_0791629 Ga0501036_0791629_195_656 148
21 3300049572 Ga0501036_1179783 Ga0501036_1179783_98_559 148
22 3300049573 Ga0501037_0030523 Ga0501037_0030523_3011_3472 148
23 3300049579 Ga0501043_0105330 Ga0501043_0105330_1532_1993 148
24 3300049583 Ga0501067_0000546 Ga0501067_0000546_9166_9627 148
25 3300049588 Ga0501072_0153559 Ga0501072_0153559_1292_1753 148
26 3300049589 Ga0501073_0000004 Ga0501073_0000004_86804_87265 148
27 3300049593 Ga0501077_0000008 Ga0501077_0000008_67989_68450 148
28 3300049742 Ga0501080_0065118 Ga0501080_0065118_835_1296 148
29 3300049744 Ga0501083_0286745 Ga0501083_0286745_462_923 148
30 3300049823 Ga0501044_0050528 Ga0501044_0050528_667_1128 148
31 3300050509 nmdc:mga0qj67_118310_c1 nmdc:mga0qj67_118310_c1_209_685 148
32 3300050510 nmdc:mga06r32_156416_c1 nmdc:mga06r32_156416_c1_876_1352 148
33 3300060353 Ga0501082_0102568 Ga0501082_0102568_821_1282 148
34 3300021377 Ga0213874_10017392 Ga0213874_100173922 149
35 3300039438 Ga0436360_1344670 Ga0436360_1344670_1281_1766 149
36 3300039447 Ga0436361_1179158 Ga0436361_1179158_2747_3232 149
37 3300039450 Ga0436363_1318239 Ga0436363_1318239_858_1343 149
38 3300039453 Ga0436362_1208409 Ga0436362_1208409_167_652 149
39 3300046528 Ga0495642_0271760 Ga0495642_0271760_181_669 149
40 3300047445 Ga0495677_0225374 Ga0495677_0225374_76_564 149
41 iso_pu_bacteria 2894510363 2894513719 149
42 3300003322 rootL2_10033961 rootL2_100339617 150
43 3300003323 rootH1_10014934 rootH1_1001493415 150
44 3300003659 JGI25404J52841_10009761 JGI25404J52841_100097612 150
45 3300005983 Ga0081540_1005479 Ga0081540_10054793 150
46 3300005983 Ga0081540_1031094 Ga0081540_10310942 150
47 3300005983 Ga0081540_1053744 Ga0081540_10537442 150
48 3300006852 Ga0075433_10068524 Ga0075433_100685242 150
49 3300010159 Ga0099796_10024787 Ga0099796_100247872 150
50 3300021358 Ga0213873_10000314 Ga0213873_100003143 150
51 3300021361 Ga0213872_10017536 Ga0213872_100175362 150
52 3300021361 Ga0213872_10067832 Ga0213872_100678322 150
53 3300021441 Ga0213871_10050474 Ga0213871_100504741 150
54 3300025295 Ga0209564_1027065 Ga0209564_10270652 150
55 3300025898 Ga0207692_10000427 Ga0207692_100004277 150
56 3300025906 Ga0207699_10000213 Ga0207699_1000021326 150
57 3300025915 Ga0207693_10010945 Ga0207693_100109456 150
58 3300025916 Ga0207663_10012297 Ga0207663_100122975 150
59 3300025928 Ga0207700_10099356 Ga0207700_100993562 150
60 3300025929 Ga0207664_10003422 Ga0207664_100034222 150
61 3300025939 Ga0207665_10010201 Ga0207665_100102013 150
62 3300026142 Ga0207698_10542118 Ga0207698_105421182 150
63 3300027907 Ga0207428_10141857 Ga0207428_101418572 150
64 3300028558 Ga0265326_10015744 Ga0265326_100157442 150
65 3300028563 Ga0265319_1011749 Ga0265319_10117492 150
66 3300028573 Ga0265334_10005729 Ga0265334_100057292 150
67 3300028577 Ga0265318_10001158 Ga0265318_100011588 150
68 3300028800 Ga0265338_10082599 Ga0265338_100825992 150
69 3300031235 Ga0265330_10003624 Ga0265330_100036244 150
70 3300031238 Ga0265332_10036124 Ga0265332_100361242 150
71 3300031239 Ga0265328_10006874 Ga0265328_100068744 150
72 3300031241 Ga0265325_10004359 Ga0265325_100043593 150
73 3300031242 Ga0265329_10001559 Ga0265329_100015596 150
74 3300031247 Ga0265340_10007496 Ga0265340_100074962 150
75 3300031250 Ga0265331_10004592 Ga0265331_100045923 150
76 3300031344 Ga0265316_10006913 Ga0265316_100069135 150
77 3300031595 Ga0265313_10006776 Ga0265313_100067768 150
78 3300031711 Ga0265314_10010603 Ga0265314_100106035 150
79 3300031712 Ga0265342_10003518 Ga0265342_100035185 150
80 3300039438 Ga0436360_0192702 Ga0436360_0192702_7722_8195 150
81 3300039438 Ga0436360_1059052 Ga0436360_1059052_332_805 150
82 3300039447 Ga0436361_0090190 Ga0436361_0090190_141_614 150
83 3300039447 Ga0436361_0900803 Ga0436361_0900803_796_1269 150
84 3300039447 Ga0436361_0900950 Ga0436361_0900950_1257_1730 150
85 3300039453 Ga0436362_0105480 Ga0436362_0105480_2737_3210 150
86 3300041486 Ga0451807_1825705 Ga0451807_1825705_79_546 150
87 3300046459 Ga0495629_0176785 Ga0495629_0176785_388_855 150
88 3300046499 Ga0495594_0382315 Ga0495594_0382315_155_622 150
89 3300046515 Ga0495620_0027451 Ga0495620_0027451_436_903 150
90 3300046522 Ga0495643_0006921 Ga0495643_0006921_3639_4106 150
91 3300046524 Ga0495648_0414226 Ga0495648_0414226_18_485 150
92 3300046530 Ga0495654_0070660 Ga0495654_0070660_285_752 150
93 3300046538 Ga0495609_0019944 Ga0495609_0019944_261_728 150
94 3300046542 Ga0495597_0011191 Ga0495597_0011191_2549_3016 150
95 3300046557 Ga0495622_0000742 Ga0495622_0000742_8593_9060 150
96 3300046648 Ga0495611_0260891 Ga0495611_0260891_226_690 150
97 3300046648 Ga0495611_0353789 Ga0495611_0353789_136_603 150
98 3300046660 Ga0495625_0101921 Ga0495625_0101921_1134_1601 150
99 3300047320 Ga0495672_0000630 Ga0495672_0000630_15235_15699 150
100 3300047443 Ga0495687_069531 Ga0495687_069531_52_519 150
101 3300047446 Ga0495679_009921 Ga0495679_009921_99_563 150
102 3300048089 Ga0495614_0336647 Ga0495614_0336647_153_620 150
103 3300048928 Ga0496125_0025606 Ga0496125_0025606_3759_4223 150
104 3300049460 Ga0495682_0124141 Ga0495682_0124141_203_670 150
105 3300050507 nmdc:mga05p37_98070_c1 nmdc:mga05p37_98070_c1_2171_2635 150
106 3300050508 nmdc:mga09592_166276_c1 nmdc:mga09592_166276_c1_539_1003 150
107 3300050509 nmdc:mga0qj67_166645_c1 nmdc:mga0qj67_166645_c1_657_1121 150
108 3300050510 nmdc:mga06r32_43798_c1 nmdc:mga06r32_43798_c1_3285_3749 150
109 3300050515 nmdc:mga0a205_201001_c1 nmdc:mga0a205_201001_c1_65_529 150
110 3300053080 Ga0500635_0000080 Ga0500635_0000080_27607_28074 150
111 3300053086 Ga0500578_0155143 Ga0500578_0155143_891_1358 150
112 3300053087 Ga0500643_000276 Ga0500643_000276_8839_9303 150
113 3300053091 Ga0500647_0229388 Ga0500647_0229388_137_604 150
114 3300053092 Ga0500583_0051768 Ga0500583_0051768_292_759 150
115 3300053094 Ga0500566_0095711 Ga0500566_0095711_999_1466 150
116 3300053104 Ga0500556_0001835 Ga0500556_0001835_5720_6184 150
117 3300053109 Ga0500569_002128 Ga0500569_002128_2554_3021 150
118 3300053119 Ga0500595_006120 Ga0500595_006120_4327_4794 150
119 3300053120 Ga0500597_184228 Ga0500597_184228_246_713 150
120 3300053121 Ga0500607_198653 Ga0500607_198653_384_851 150
121 3300053122 Ga0500608_060472 Ga0500608_060472_981_1448 150
122 3300053123 Ga0500614_002135 Ga0500614_002135_282_749 150
123 3300053125 Ga0500618_000024 Ga0500618_000024_58142_58606 150
124 3300053130 Ga0500642_0042020 Ga0500642_0042020_335_802 150
125 3300053136 Ga0500559_0003697 Ga0500559_0003697_4310_4774 150
126 3300053136 Ga0500559_0013894 Ga0500559_0013894_2691_3155 150
127 3300053136 Ga0500559_0155332 Ga0500559_0155332_343_810 150
128 3300053142 Ga0500577_0325912 Ga0500577_0325912_147_614 150
129 3300053148 Ga0500590_011497 Ga0500590_011497_285_752 150
130 3300053154 Ga0500619_109727 Ga0500619_109727_442_909 150
131 3300053162 Ga0500638_205536 Ga0500638_205536_267_734 150
132 3300053177 Ga0500636_0005352 Ga0500636_0005352_396_863 150
133 3300053177 Ga0500636_0093513 Ga0500636_0093513_126_593 150
134 3300053178 Ga0500637_0032253 Ga0500637_0032253_423_890 150
135 3300053729 Ga0500625_072625 Ga0500625_072625_180_647 150
136 3300053735 Ga0500596_000241 Ga0500596_000241_4933_5400 150
137 3300053737 Ga0500601_015292 Ga0500601_015292_209_676 150
138 3300055283 Ga0500661_000098 Ga0500661_000098_6131_6595 150
139 iso_pu_bacteria 2643221583 2643923250 150
140 iso_pu_bacteria 2884960567 2884962571 150
141 3300003322 rootL2_10110047 rootL2_101100473 151
142 3300004799 Ga0058863_10032759 Ga0058863_100327591 151
143 3300004800 Ga0058861_10029376 Ga0058861_100293761 151
144 3300004803 Ga0058862_12650850 Ga0058862_126508502 151
145 3300004803 Ga0058862_12859001 Ga0058862_128590012 151
146 3300005329 Ga0070683_100012825 Ga0070683_1000128252 151
147 3300005329 Ga0070683_100056927 Ga0070683_1000569272 151
148 3300005329 Ga0070683_100270691 Ga0070683_1002706912 151
149 3300005329 Ga0070683_100859276 Ga0070683_1008592762 151
150 3300005330 Ga0070690_100149200 Ga0070690_1001492002 151
151 3300005334 Ga0068869_101024647 Ga0068869_1010246471 151
152 3300005336 Ga0070680_100126717 Ga0070680_1001267172 151
153 3300005336 Ga0070680_100580343 Ga0070680_1005803431 151
154 3300005336 Ga0070680_101512936 Ga0070680_1015129361 151
155 3300005340 Ga0070689_100127275 Ga0070689_1001272752 151
156 3300005340 Ga0070689_101849991 Ga0070689_1018499911 151
157 3300005343 Ga0070687_100813852 Ga0070687_1008138521 151
158 3300005344 Ga0070661_100870557 Ga0070661_1008705571 151
159 3300005347 Ga0070668_100944767 Ga0070668_1009447672 151
160 3300005356 Ga0070674_101265397 Ga0070674_1012653971 151
161 3300005364 Ga0070673_100007403 Ga0070673_1000074034 151
162 3300005364 Ga0070673_100623859 Ga0070673_1006238592 151
163 3300005365 Ga0070688_100009049 Ga0070688_1000090493 151
164 3300005367 Ga0070667_100227566 Ga0070667_1002275663 151
165 3300005434 Ga0070709_10010971 Ga0070709_100109712 151
166 3300005435 Ga0070714_100111402 Ga0070714_1001114022 151
167 3300005445 Ga0070708_100000494 Ga0070708_1000004948 151
168 3300005445 Ga0070708_100664938 Ga0070708_1006649382 151
169 3300005456 Ga0070678_101008026 Ga0070678_1010080261 151
170 3300005458 Ga0070681_10004438 Ga0070681_100044387 151
171 3300005458 Ga0070681_10029352 Ga0070681_100293525 151
172 3300005466 Ga0070685_10621407 Ga0070685_106214071 151
173 3300005467 Ga0070706_100197676 Ga0070706_1001976761 151
174 3300005530 Ga0070679_100001857 Ga0070679_1000018572 151
175 3300005530 Ga0070679_100004565 Ga0070679_1000045657 151
176 3300005530 Ga0070679_100024072 Ga0070679_1000240721 151
177 3300005530 Ga0070679_100581990 Ga0070679_1005819902 151
178 3300005535 Ga0070684_100069700 Ga0070684_1000697002 151
179 3300005535 Ga0070684_100193321 Ga0070684_1001933212 151
180 3300005535 Ga0070684_100243311 Ga0070684_1002433112 151
181 3300005535 Ga0070684_100255050 Ga0070684_1002550502 151
182 3300005535 Ga0070684_100506800 Ga0070684_1005068002 151
183 3300005546 Ga0070696_100000289 Ga0070696_10000028926 151
184 3300005548 Ga0070665_100068008 Ga0070665_1000680081 151
185 3300005548 Ga0070665_100358276 Ga0070665_1003582761 151
186 3300005564 Ga0070664_100086790 Ga0070664_1000867902 151
187 3300005564 Ga0070664_100654097 Ga0070664_1006540972 151
188 3300005614 Ga0068856_100121434 Ga0068856_1001214343 151
189 3300005614 Ga0068856_101403008 Ga0068856_1014030082 151
190 3300005615 Ga0070702_100541827 Ga0070702_1005418272 151
191 3300005617 Ga0068859_101216077 Ga0068859_1012160771 151
192 3300005718 Ga0068866_10863047 Ga0068866_108630471 151
193 3300006173 Ga0070716_100097312 Ga0070716_1000973124 151
194 3300006237 Ga0097621_100762020 Ga0097621_1007620202 151
195 3300006881 Ga0068865_100214398 Ga0068865_1002143982 151
196 3300006931 Ga0097620_101216076 Ga0097620_1012160761 151
197 3300009098 Ga0105245_10306877 Ga0105245_103068772 151
198 3300009148 Ga0105243_10761868 Ga0105243_107618681 151
199 3300009174 Ga0105241_11547553 Ga0105241_115475531 151
200 3300009176 Ga0105242_10296316 Ga0105242_102963162 151
201 3300009176 Ga0105242_10334988 Ga0105242_103349881 151
202 3300009177 Ga0105248_10730201 Ga0105248_107302011 151
203 3300009545 Ga0105237_10262707 Ga0105237_102627072 151
204 3300010375 Ga0105239_11681939 Ga0105239_116819391 151
205 3300011119 Ga0105246_10133341 Ga0105246_101333412 151
206 3300013100 Ga0157373_10312598 Ga0157373_103125982 151
207 3300013104 Ga0157370_10086558 Ga0157370_100865582 151
208 3300013104 Ga0157370_10098753 Ga0157370_100987532 151
209 3300013104 Ga0157370_10848312 Ga0157370_108483121 151
210 3300013105 Ga0157369_10234203 Ga0157369_102342032 151
211 3300013105 Ga0157369_10598761 Ga0157369_105987612 151
212 3300013105 Ga0157369_11605615 Ga0157369_116056152 151
213 3300013296 Ga0157374_10721824 Ga0157374_107218242 151
214 3300013297 Ga0157378_11819558 Ga0157378_118195581 151
215 3300013297 Ga0157378_12591636 Ga0157378_125916361 151
216 3300013307 Ga0157372_10003395 Ga0157372_1000339513 151
217 3300013307 Ga0157372_10022621 Ga0157372_100226216 151
218 3300013307 Ga0157372_10342487 Ga0157372_103424873 151
219 3300013307 Ga0157372_10865043 Ga0157372_108650431 151
220 3300013307 Ga0157372_10922411 Ga0157372_109224112 151
221 3300013308 Ga0157375_10173212 Ga0157375_101732122 151
222 3300013308 Ga0157375_10544698 Ga0157375_105446982 151
223 3300014325 Ga0163163_10853720 Ga0163163_108537202 151
224 3300014326 Ga0157380_10392505 Ga0157380_103925052 151
225 3300014969 Ga0157376_10357491 Ga0157376_103574912 151
226 3300015262 Ga0182007_10162035 Ga0182007_101620351 151
227 3300021384 Ga0213876_10022155 Ga0213876_100221555 151
228 3300025899 Ga0207642_10527748 Ga0207642_105277482 151
229 3300025904 Ga0207647_10170765 Ga0207647_101707651 151
230 3300025907 Ga0207645_10150291 Ga0207645_101502912 151
231 3300025912 Ga0207707_10009363 Ga0207707_100093637 151
232 3300025912 Ga0207707_10025736 Ga0207707_100257363 151
233 3300025912 Ga0207707_10697642 Ga0207707_106976422 151
234 3300025913 Ga0207695_10101967 Ga0207695_101019673 151
235 3300025917 Ga0207660_10139369 Ga0207660_101393692 151
236 3300025918 Ga0207662_10262666 Ga0207662_102626662 151
237 3300025921 Ga0207652_10005321 Ga0207652_100053219 151
238 3300025921 Ga0207652_10006050 Ga0207652_100060508 151
239 3300025921 Ga0207652_10049728 Ga0207652_100497283 151
240 3300025921 Ga0207652_10232723 Ga0207652_102327232 151
241 3300025921 Ga0207652_10321451 Ga0207652_103214512 151
242 3300025922 Ga0207646_11666326 Ga0207646_116663261 151
243 3300025925 Ga0207650_10674122 Ga0207650_106741222 151
244 3300025926 Ga0207659_10302257 Ga0207659_103022572 151
245 3300025931 Ga0207644_10745297 Ga0207644_107452972 151
246 3300025931 Ga0207644_11637912 Ga0207644_116379121 151
247 3300025932 Ga0207690_10973395 Ga0207690_109733951 151
248 3300025934 Ga0207686_10116904 Ga0207686_101169042 151
249 3300025936 Ga0207670_10100351 Ga0207670_101003512 151
250 3300025939 Ga0207665_10242088 Ga0207665_102420882 151
251 3300025942 Ga0207689_10216700 Ga0207689_102167002 151
252 3300025944 Ga0207661_10005343 Ga0207661_100053432 151
253 3300025944 Ga0207661_10014967 Ga0207661_100149672 151
254 3300025944 Ga0207661_10122822 Ga0207661_101228222 151
255 3300025944 Ga0207661_10379229 Ga0207661_103792292 151
256 3300025944 Ga0207661_10515401 Ga0207661_105154012 151
257 3300025945 Ga0207679_10818004 Ga0207679_108180042 151
258 3300025960 Ga0207651_10170950 Ga0207651_101709502 151
259 3300025972 Ga0207668_10331808 Ga0207668_103318082 151
260 3300025972 Ga0207668_11299626 Ga0207668_112996261 151
261 3300026078 Ga0207702_10410800 Ga0207702_104108002 151
262 3300026089 Ga0207648_10082795 Ga0207648_100827952 151
263 3300026095 Ga0207676_10369896 Ga0207676_103698962 151
264 3300026116 Ga0207674_10161318 Ga0207674_101613182 151
265 3300026121 Ga0207683_10292987 Ga0207683_102929872 151
266 3300028379 Ga0268266_10047169 Ga0268266_100471693 151
267 3300028379 Ga0268266_10266276 Ga0268266_102662761 151
268 3300028556 Ga0265337_1030410 Ga0265337_10304102 151
269 3300028563 Ga0265319_1001014 Ga0265319_10010142 151
270 3300028563 Ga0265319_1002881 Ga0265319_10028813 151
271 3300028563 Ga0265319_1049898 Ga0265319_10498982 151
272 3300028573 Ga0265334_10010638 Ga0265334_100106383 151
273 3300028577 Ga0265318_10002409 Ga0265318_100024095 151
274 3300028577 Ga0265318_10005763 Ga0265318_100057632 151
275 3300028654 Ga0265322_10031570 Ga0265322_100315702 151
276 3300028800 Ga0265338_10007620 Ga0265338_100076206 151
277 3300028800 Ga0265338_10086852 Ga0265338_100868522 151
278 3300031238 Ga0265332_10216163 Ga0265332_102161631 151
279 3300031239 Ga0265328_10031108 Ga0265328_100311082 151
280 3300031239 Ga0265328_10078547 Ga0265328_100785472 151
281 3300031240 Ga0265320_10000575 Ga0265320_1000057515 151
282 3300031240 Ga0265320_10011301 Ga0265320_100113015 151
283 3300031240 Ga0265320_10024753 Ga0265320_100247531 151
284 3300031240 Ga0265320_10096682 Ga0265320_100966821 151
285 3300031247 Ga0265340_10035080 Ga0265340_100350802 151
286 3300031249 Ga0265339_10068859 Ga0265339_100688592 151
287 3300031250 Ga0265331_10096038 Ga0265331_100960382 151
288 3300031344 Ga0265316_10060798 Ga0265316_100607982 151
289 3300031344 Ga0265316_10098940 Ga0265316_100989402 151
290 3300031344 Ga0265316_10186991 Ga0265316_101869912 151
291 3300031595 Ga0265313_10001119 Ga0265313_100011195 151
292 3300031595 Ga0265313_10003063 Ga0265313_100030632 151
293 3300031595 Ga0265313_10004776 Ga0265313_100047767 151
294 3300031595 Ga0265313_10021622 Ga0265313_100216222 151
295 3300031711 Ga0265314_10521630 Ga0265314_105216301 151
296 3300031712 Ga0265342_10014230 Ga0265342_100142306 151
297 3300031712 Ga0265342_10086331 Ga0265342_100863312 151
298 3300031712 Ga0265342_10088050 Ga0265342_100880502 151
299 3300031995 Ga0307409_100656861 Ga0307409_1006568612 151
300 3300032002 Ga0307416_101194964 Ga0307416_1011949642 151
301 3300035083 Ga0373926_0124741 Ga0373926_0124741_329_820 151
302 3300035086 Ga0373934_0044387 Ga0373934_0044387_82_573 151
303 3300035111 Ga0373923_0003560 Ga0373923_0003560_3524_4015 151
304 3300035111 Ga0373923_0184696 Ga0373923_0184696_95_586 151
305 3300035116 Ga0373945_0500040 Ga0373945_0500040_25_516 151
306 3300035118 Ga0373954_0061835 Ga0373954_0061835_790_1281 151
307 3300035119 Ga0373956_0004997 Ga0373956_0004997_2651_3142 151
308 3300035119 Ga0373956_0022145 Ga0373956_0022145_1913_2404 151
309 3300035172 Ga0373955_0001186 Ga0373955_0001186_7297_7788 151
310 3300035172 Ga0373955_0007825 Ga0373955_0007825_3212_3703 151
311 3300035410 Ga0373924_0000442 Ga0373924_0000442_12052_12543 151
312 3300035410 Ga0373924_0089787 Ga0373924_0089787_466_957 151
313 3300035692 Ga0373935_0058419 Ga0373935_0058419_701_1192 151
314 3300035692 Ga0373935_1117030 Ga0373935_1117030_35_526 151
315 3300035695 Ga0373927_0215547 Ga0373927_0215547_577_1068 151
316 3300035724 Ga0373933_0000501 Ga0373933_0000501_18162_18653 151
317 3300035724 Ga0373933_0027715 Ga0373933_0027715_940_1431 151
318 3300035725 Ga0373947_0096074 Ga0373947_0096074_1243_1734 151
319 3300035725 Ga0373947_0565618 Ga0373947_0565618_212_703 151
320 3300036401 Ga0373937_0000649 Ga0373937_0000649_5028_5519 151
321 3300036401 Ga0373937_0006774 Ga0373937_0006774_4121_4612 151
322 3300037068 Ga0373925_0121458 Ga0373925_0121458_428_919 151
323 3300039437 Ga0436365_0003491 Ga0436365_0003491_3240_3731 151
324 3300039437 Ga0436365_1926543 Ga0436365_1926543_1013_1504 151
325 3300044842 Ga0466957_0383343 Ga0466957_0383343_102_578 151
326 3300045976 Ga0466967_0892437 Ga0466967_0892437_94_582 151
327 3300046459 Ga0495629_0039594 Ga0495629_0039594_383_874 151
328 3300046459 Ga0495629_0437856 Ga0495629_0437856_184_675 151
329 3300046459 Ga0495629_0495676 Ga0495629_0495676_136_627 151
330 3300046462 Ga0495651_0000045 Ga0495651_0000045_60150_60641 151
331 3300046462 Ga0495651_0116316 Ga0495651_0116316_754_1245 151
332 3300046463 Ga0495653_0000093 Ga0495653_0000093_51493_51984 151
333 3300046472 Ga0495580_0156548 Ga0495580_0156548_295_786 151
334 3300046473 Ga0495582_0019325 Ga0495582_0019325_1850_2341 151
335 3300046475 Ga0495639_0027462 Ga0495639_0027462_228_719 151
336 3300046475 Ga0495639_0100441 Ga0495639_0100441_538_1029 151
337 3300046476 Ga0495662_0117476 Ga0495662_0117476_142_633 151
338 3300046477 Ga0495664_0063602 Ga0495664_0063602_858_1349 151
339 3300046499 Ga0495594_0063626 Ga0495594_0063626_305_796 151
340 3300046499 Ga0495594_0296993 Ga0495594_0296993_297_788 151
341 3300046511 Ga0495608_0009509 Ga0495608_0009509_6121_6612 151
342 3300046511 Ga0495608_0224645 Ga0495608_0224645_362_853 151
343 3300046514 Ga0495618_0034143 Ga0495618_0034143_2143_2634 151
344 3300046514 Ga0495618_0156092 Ga0495618_0156092_524_1015 151
345 3300046516 Ga0495628_0000568 Ga0495628_0000568_746_1237 151
346 3300046516 Ga0495628_0302667 Ga0495628_0302667_564_1055 151
347 3300046517 Ga0495630_0005102 Ga0495630_0005102_6191_6682 151
348 3300046517 Ga0495630_0067126 Ga0495630_0067126_1105_1596 151
349 3300046517 Ga0495630_0485383 Ga0495630_0485383_111_602 151
350 3300046526 Ga0495666_0026970 Ga0495666_0026970_863_1354 151
351 3300046529 Ga0495652_0000166 Ga0495652_0000166_22934_23425 151
352 3300046529 Ga0495652_0085729 Ga0495652_0085729_803_1294 151
353 3300046531 Ga0495665_0018414 Ga0495665_0018414_1728_2219 151
354 3300046531 Ga0495665_0100274 Ga0495665_0100274_900_1391 151
355 3300046535 Ga0495586_0034625 Ga0495586_0034625_303_794 151
356 3300046535 Ga0495586_0041267 Ga0495586_0041267_229_720 151
357 3300046535 Ga0495586_0071502 Ga0495586_0071502_295_786 151
358 3300046536 Ga0495587_0003696 Ga0495587_0003696_7646_8137 151
359 3300046543 Ga0495645_0000218 Ga0495645_0000218_13695_14186 151
360 3300046543 Ga0495645_0000833 Ga0495645_0000833_9778_10269 151
361 3300046559 Ga0495667_0000788 Ga0495667_0000788_6898_7389 151
362 3300046559 Ga0495667_0031759 Ga0495667_0031759_1607_2098 151
363 3300046642 Ga0495634_0126343 Ga0495634_0126343_943_1434 151
364 3300046642 Ga0495634_0147095 Ga0495634_0147095_957_1448 151
365 3300046663 Ga0495635_0000043 Ga0495635_0000043_59004_59495 151
366 3300046675 Ga0495657_0000172 Ga0495657_0000172_27888_28379 151
367 3300046678 Ga0495599_0002832 Ga0495599_0002832_3391_3882 151
368 3300046678 Ga0495599_0028469 Ga0495599_0028469_2145_2636 151
369 3300046679 Ga0495623_0000120 Ga0495623_0000120_22881_23372 151
370 3300046679 Ga0495623_0017600 Ga0495623_0017600_2626_3117 151
371 3300046680 Ga0495646_0000732 Ga0495646_0000732_2466_2957 151
372 3300046683 Ga0495658_0278172 Ga0495658_0278172_233_724 151
373 3300046689 Ga0495613_0012865 Ga0495613_0012865_2295_2786 151
374 3300046689 Ga0495613_0388303 Ga0495613_0388303_42_533 151
375 3300046809 Ga0495600_0000093 Ga0495600_0000093_25558_26049 151
376 3300046809 Ga0495600_0046252 Ga0495600_0046252_798_1289 151
377 3300047315 Ga0495581_0015761 Ga0495581_0015761_2293_2784 151
378 3300047315 Ga0495581_0138697 Ga0495581_0138697_770_1261 151
379 3300047315 Ga0495581_0216599 Ga0495581_0216599_15_506 151
380 3300047315 Ga0495581_0469207 Ga0495581_0469207_86_577 151
381 3300047317 Ga0495604_0000166 Ga0495604_0000166_11233_11724 151
382 3300047319 Ga0495674_0000520 Ga0495674_0000520_22675_23166 151
383 3300047319 Ga0495674_0005433 Ga0495674_0005433_11621_12112 151
384 3300047319 Ga0495674_1076488 Ga0495674_1076488_56_547 151
385 3300047320 Ga0495672_0005815 Ga0495672_0005815_3114_3605 151
386 3300047320 Ga0495672_0136607 Ga0495672_0136607_576_1043 151
387 3300047322 Ga0495680_0005857 Ga0495680_0005857_6270_6761 151
388 3300047444 Ga0495675_0003188 Ga0495675_0003188_1446_1937 151
389 3300047444 Ga0495675_0007016 Ga0495675_0007016_332_823 151
390 3300047471 Ga0495684_0000034 Ga0495684_0000034_53249_53740 151
391 3300047471 Ga0495684_0067224 Ga0495684_0067224_1957_2448 151
392 3300047471 Ga0495684_0166140 Ga0495684_0166140_277_768 151
393 3300047673 Ga0495593_0127547 Ga0495593_0127547_686_1177 151
394 3300048088 Ga0495602_0000684 Ga0495602_0000684_2696_3187 151
395 3300048088 Ga0495602_0834068 Ga0495602_0834068_100_591 151
396 3300048918 Ga0496115_1106998 Ga0496115_1106998_61_552 151
397 3300048922 Ga0496119_0004112 Ga0496119_0004112_11211_11687 151
398 3300048923 Ga0496120_0243442 Ga0496120_0243442_327_803 151
399 3300049128 Ga0501308_033133 Ga0501308_033133_190_669 151
400 3300049514 Ga0501291_029558 Ga0501291_029558_182_673 151
401 3300049586 Ga0501070_1052507 Ga0501070_1052507_12_503 151
402 3300049667 Ga0501230_057797 Ga0501230_057797_230_721 151
403 3300049822 Ga0501035_1091396 Ga0501035_1091396_20_511 151
404 3300049823 Ga0501044_0773155 Ga0501044_0773155_175_693 151
405 3300053077 Ga0495601_0043447 Ga0495601_0043447_239_730 151
406 3300053078 Ga0495612_0000690 Ga0495612_0000690_10952_11443 151
407 3300053103 Ga0500555_001650 Ga0500555_001650_6086_6553 151
408 3300053139 Ga0500568_0006998 Ga0500568_0006998_407_874 151
409 3300005329 Ga0070683_100024987 Ga0070683_1000249872 152
410 3300005329 Ga0070683_100596360 Ga0070683_1005963602 152
411 3300005331 Ga0070670_100008411 Ga0070670_1000084117 152
412 3300005335 Ga0070666_10126744 Ga0070666_101267442 152
413 3300005336 Ga0070680_100024507 Ga0070680_1000245073 152
414 3300005337 Ga0070682_100010752 Ga0070682_1000107522 152
415 3300005339 Ga0070660_100020159 Ga0070660_1000201594 152
416 3300005344 Ga0070661_100100903 Ga0070661_1001009032 152
417 3300005354 Ga0070675_100041543 Ga0070675_1000415432 152
418 3300005355 Ga0070671_100497776 Ga0070671_1004977761 152
419 3300005364 Ga0070673_100286777 Ga0070673_1002867772 152
420 3300005367 Ga0070667_100206137 Ga0070667_1002061372 152
421 3300005440 Ga0070705_100402208 Ga0070705_1004022082 152
422 3300005455 Ga0070663_100387145 Ga0070663_1003871452 152
423 3300005456 Ga0070678_100732665 Ga0070678_1007326652 152
424 3300005457 Ga0070662_100019485 Ga0070662_1000194854 152
425 3300005458 Ga0070681_10061105 Ga0070681_100611054 152
426 3300005535 Ga0070684_100047868 Ga0070684_1000478683 152
427 3300005535 Ga0070684_100103639 Ga0070684_1001036393 152
428 3300005544 Ga0070686_100142072 Ga0070686_1001420722 152
429 3300005545 Ga0070695_100064459 Ga0070695_1000644592 152
430 3300005547 Ga0070693_100006910 Ga0070693_1000069104 152
431 3300005563 Ga0068855_100187902 Ga0068855_1001879022 152
432 3300005564 Ga0070664_100074197 Ga0070664_1000741973 152
433 3300005564 Ga0070664_100827237 Ga0070664_1008272371 152
434 3300005614 Ga0068856_100079040 Ga0068856_1000790402 152
435 3300005615 Ga0070702_100008765 Ga0070702_1000087652 152
436 3300005616 Ga0068852_100080241 Ga0068852_1000802411 152
437 3300005617 Ga0068859_100024088 Ga0068859_1000240883 152
438 3300005843 Ga0068860_100020204 Ga0068860_1000202043 152
439 3300006237 Ga0097621_101054144 Ga0097621_1010541441 152
440 3300006358 Ga0068871_100182402 Ga0068871_1001824022 152
441 3300006931 Ga0097620_100024088 Ga0097620_1000240883 152
442 3300007076 Ga0075435_100506290 Ga0075435_1005062902 152
443 3300009098 Ga0105245_10014485 Ga0105245_100144854 152
444 3300009148 Ga0105243_10286293 Ga0105243_102862932 152
445 3300009174 Ga0105241_10037359 Ga0105241_100373593 152
446 3300009177 Ga0105248_10021923 Ga0105248_100219233 152
447 3300009177 Ga0105248_10536658 Ga0105248_105366581 152
448 3300009551 Ga0105238_12389455 Ga0105238_123894551 152
449 3300010375 Ga0105239_10687755 Ga0105239_106877552 152
450 3300011119 Ga0105246_10068452 Ga0105246_100684523 152
451 3300013100 Ga0157373_10028569 Ga0157373_100285693 152
452 3300013306 Ga0163162_10539488 Ga0163162_105394882 152
453 3300013308 Ga0157375_10066711 Ga0157375_100667114 152
454 3300013308 Ga0157375_11159260 Ga0157375_111592602 152
455 3300014325 Ga0163163_10041187 Ga0163163_100411873 152
456 3300014325 Ga0163163_10709289 Ga0163163_107092892 152
457 3300014745 Ga0157377_10122357 Ga0157377_101223572 152
458 3300014969 Ga0157376_10018950 Ga0157376_100189503 152
459 3300014969 Ga0157376_10735482 Ga0157376_107354822 152
460 3300025909 Ga0207705_10756443 Ga0207705_107564431 152
461 3300025912 Ga0207707_10061052 Ga0207707_100610522 152
462 3300025917 Ga0207660_10043349 Ga0207660_100433492 152
463 3300025919 Ga0207657_10023463 Ga0207657_100234632 152
464 3300025920 Ga0207649_10018032 Ga0207649_100180323 152
465 3300025927 Ga0207687_10017035 Ga0207687_100170352 152
466 3300025933 Ga0207706_10071082 Ga0207706_100710822 152
467 3300025934 Ga0207686_10102656 Ga0207686_101026562 152
468 3300025941 Ga0207711_10207961 Ga0207711_102079612 152
469 3300025942 Ga0207689_10045647 Ga0207689_100456473 152
470 3300025944 Ga0207661_10249360 Ga0207661_102493602 152
471 3300025944 Ga0207661_10328323 Ga0207661_103283231 152
472 3300025945 Ga0207679_10059934 Ga0207679_100599342 152
473 3300025949 Ga0207667_10080584 Ga0207667_100805843 152
474 3300026067 Ga0207678_10251262 Ga0207678_102512622 152
475 3300026078 Ga0207702_10077274 Ga0207702_100772743 152
476 3300026095 Ga0207676_10123894 Ga0207676_101238941 152
477 3300026116 Ga0207674_10001931 Ga0207674_1000193110 152
478 3300026121 Ga0207683_10419960 Ga0207683_104199602 152
479 3300028380 Ga0268265_11410548 Ga0268265_114105482 152
480 3300028381 Ga0268264_10377173 Ga0268264_103771732 152
481 3300028666 Ga0265336_10088368 Ga0265336_100883681 152
482 3300031344 Ga0265316_10527086 Ga0265316_105270861 152
483 3300035118 Ga0373954_0107020 Ga0373954_0107020_521_979 152
484 3300035120 Ga0373957_0135320 Ga0373957_0135320_373_831 152
485 3300035172 Ga0373955_0033854 Ga0373955_0033854_540_998 152
486 3300035242 Ga0373962_0193779 Ga0373962_0193779_177_665 152
487 3300035691 Ga0373931_0029518 Ga0373931_0029518_414_914 152
488 3300036401 Ga0373937_0428729 Ga0373937_0428729_65_523 152
489 3300042876 Ga0451577_0002349 Ga0451577_0002349_12507_12980 152
490 3300044712 Ga0453684_0000534 Ga0453684_0000534_52897_53370 152
491 3300044712 Ga0453684_0397407 Ga0453684_0397407_1024_1497 152
492 3300046531 Ga0495665_0654722 Ga0495665_0654722_41_508 152
493 3300048911 Ga0496108_0450249 Ga0496108_0450249_515_1009 152
494 3300048912 Ga0496109_0111163 Ga0496109_0111163_385_879 152
495 3300048914 Ga0496111_1009034 Ga0496111_1009034_79_573 152
496 3300048915 Ga0496112_0005535 Ga0496112_0005535_6583_7077 152
497 3300048916 Ga0496113_0050543 Ga0496113_0050543_1035_1529 152
498 3300009553 Ga0105249_10926245 Ga0105249_109262452 153
499 3300025924 Ga0207694_10036296 Ga0207694_100362962 153
500 3300028563 Ga0265319_1001685 Ga0265319_100168513 153
501 3300028577 Ga0265318_10038052 Ga0265318_100380522 153
502 3300031240 Ga0265320_10007360 Ga0265320_100073606 153
503 3300031240 Ga0265320_10014274 Ga0265320_100142744 153
504 3300031250 Ga0265331_10008083 Ga0265331_100080832 153
505 3300045051 Ga0451576_0000087 Ga0451576_0000087_11022_11516 153
506 3300045051 Ga0451576_0006613 Ga0451576_0006613_3289_3783 153
507 3300045051 Ga0451576_0096701 Ga0451576_0096701_720_1226 153
508 3300046660 Ga0495625_0032162 Ga0495625_0032162_1383_1871 153
509 3300049569 Ga0501032_0013091 Ga0501032_0013091_1881_2405 153
510 3300049570 Ga0501033_0003055 Ga0501033_0003055_6022_6546 153
511 3300049573 Ga0501037_0021558 Ga0501037_0021558_1396_1920 153
512 3300049579 Ga0501043_0245453 Ga0501043_0245453_26_550 153
513 3300049580 Ga0501046_0004848 Ga0501046_0004848_7626_8150 153
514 3300049823 Ga0501044_0007493 Ga0501044_0007493_10778_11302 153
515 3300006028 Ga0070717_10334111 Ga0070717_103341112 154
516 3300003322 rootL2_10031117 rootL2_100311172 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

99

171

0.94

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

26

113

0.83

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

31

98

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9851 1 149
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9646 1 149
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9576 1 149
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.956 1 149
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9542 2 149
ID Description Score Start End Superfamily
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.971 1 73 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9709 1 75 3.10.20.30
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9684 83 149 1.10.150.120
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9636 1 75 3.10.20.30
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9617 84 149 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A7Y5QJI1-F1-model_v4 (2Fe-2S)-binding protein 0.9965 1 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A7V9BKS3-F1-model_v4 (2Fe-2S)-binding protein 0.9961 1 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A2G5QP78-F1-model_v4 (2Fe-2S)-binding protein 0.9952 3 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A349TGJ4-F1-model_v4 (2Fe-2S)-binding protein 0.9952 1 141 GO:0016491
GO:0046872
GO:0051537
AF-A0A7X0JUW7-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) 0.9949 1 149 GO:0046872
GO:0047121
GO:0051537

Feature Viewer

pLDDT pTM Quality
93.66 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map