F457964
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 516 | 316 | 511 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100111402|Ga0070714_1001114022 |
| Length | 188 |
| Sequence | MLSKTCTIEKMSSSFGDPTPITPAPMSTYTLSVNGQSHSVDVTPDTPLLWVLRDSLGLVGTKYGCGIGECGACTVHLDGAAKRACQTAISDVGRAEVTTIEGLDPAGKHPLQQAWCELDVPQCGYCQGGQIMTAAALLKSNPRPTDADIDRTMSGNLCRCASYYRIRAGIKRAAELTAGATPANGGQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 2 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 3 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 4 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 5 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 91 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 92 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 95 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 144 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 147 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 153 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 155 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 157 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 167 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 175 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 186 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 189 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 190 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 191 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 192 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 193 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 194 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 260 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 261 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 262 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 265 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 289 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 290 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 291 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 292 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 293 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 294 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 295 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 296 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 297 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 298 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 299 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 300 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 301 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 302 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 304 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 306 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 307 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 308 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 309 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 310 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 312 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 313 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 314 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 315 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.06 |
| Metatranscriptomes | 0.97 |
| Isolates | 0.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.2 |
| Nodule | 0 |
| Rhizoplane | 1.36 |
| Rhizosphere | 89.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10031117 | 3300003322 | Bacteria | 4104 |
| 2 | rootL2_10033961 | 3300003322 | Bacteria | 10305 |
| 3 | rootL2_10110047 | 3300003322 | Bacteria | 1664 |
| 4 | rootH1_10014934 | 3300003323 | Bacteria | 16432 |
| 5 | JGI25404J52841_10009761 | 3300003659 | Bacteria | 2057 |
| 6 | Ga0058863_10032759 | 3300004799 | Bacteria | 3240 |
| 7 | Ga0058861_10029376 | 3300004800 | Bacteria | 1266 |
| 8 | Ga0058862_12650850 | 3300004803 | Bacteria | 1066 |
| 9 | Ga0058862_12859001 | 3300004803 | Bacteria | 3318 |
| 10 | Ga0070683_100012825 | 3300005329 | Bacteria | 7294 |
| 11 | Ga0070683_100024987 | 3300005329 | Bacteria | 5358 |
| 12 | Ga0070683_100056927 | 3300005329 | Bacteria | 3631 |
| 13 | Ga0070683_100270691 | 3300005329 | Unclassified | 1616 |
| 14 | Ga0070683_100596360 | 3300005329 | Bacteria | 1057 |
| 15 | Ga0070683_100859276 | 3300005329 | Bacteria | 870 |
| 16 | Ga0070690_100149200 | 3300005330 | Bacteria | 1594 |
| 17 | Ga0070690_100251961 | 3300005330 | Bacteria | 1249 |
| 18 | Ga0070670_100008411 | 3300005331 | Bacteria | 8796 |
| 19 | Ga0068869_101024647 | 3300005334 | Bacteria | 720 |
| 20 | Ga0070666_10126744 | 3300005335 | Bacteria | 1772 |
| 21 | Ga0070680_100024507 | 3300005336 | Bacteria | 4821 |
| 22 | Ga0070680_100126717 | 3300005336 | Bacteria | 2134 |
| 23 | Ga0070680_100580343 | 3300005336 | Bacteria | 962 |
| 24 | Ga0070680_101512936 | 3300005336 | Bacteria | 581 |
| 25 | Ga0070682_100010752 | 3300005337 | Bacteria | 5205 |
| 26 | Ga0070660_100020159 | 3300005339 | Bacteria | 4896 |
| 27 | Ga0070689_100127275 | 3300005340 | Bacteria | 2039 |
| 28 | Ga0070689_101849991 | 3300005340 | Bacteria | 551 |
| 29 | Ga0070687_100813852 | 3300005343 | Bacteria | 663 |
| 30 | Ga0070661_100100903 | 3300005344 | Bacteria | 2146 |
| 31 | Ga0070661_100870557 | 3300005344 | Bacteria | 742 |
| 32 | Ga0070668_100944767 | 3300005347 | Bacteria | 772 |
| 33 | Ga0070675_100041543 | 3300005354 | Bacteria | 3756 |
| 34 | Ga0070671_100497776 | 3300005355 | Bacteria | 1048 |
| 35 | Ga0070674_101265397 | 3300005356 | Bacteria | 657 |
| 36 | Ga0070673_100007403 | 3300005364 | Bacteria | 7236 |
| 37 | Ga0070673_100286777 | 3300005364 | Bacteria | 1446 |
| 38 | Ga0070673_100623859 | 3300005364 | Bacteria | 985 |
| 39 | Ga0070688_100009049 | 3300005365 | Bacteria | 5430 |
| 40 | Ga0070667_100206137 | 3300005367 | Bacteria | 1746 |
| 41 | Ga0070667_100227566 | 3300005367 | Bacteria | 1662 |
| 42 | Ga0070709_10010971 | 3300005434 | Bacteria | 5032 |
| 43 | Ga0070714_100111402 | 3300005435 | Bacteria | 2424 |
| 44 | Ga0070705_100402208 | 3300005440 | Bacteria | 1014 |
| 45 | Ga0070708_100000494 | 3300005445 | Bacteria | 29731 |
| 46 | Ga0070708_100664938 | 3300005445 | Bacteria | 981 |
| 47 | Ga0070663_100387145 | 3300005455 | Bacteria | 1140 |
| 48 | Ga0070678_100732665 | 3300005456 | Bacteria | 893 |
| 49 | Ga0070678_101008026 | 3300005456 | Bacteria | 766 |
| 50 | Ga0070662_100019485 | 3300005457 | Bacteria | 4606 |
| 51 | Ga0070681_10004438 | 3300005458 | Bacteria | 13364 |
| 52 | Ga0070681_10029352 | 3300005458 | Bacteria | 5523 |
| 53 | Ga0070681_10061105 | 3300005458 | Bacteria | 3744 |
| 54 | Ga0070685_10621407 | 3300005466 | Bacteria | 780 |
| 55 | Ga0070706_100197676 | 3300005467 | Bacteria | 1878 |
| 56 | Ga0070679_100001857 | 3300005530 | Bacteria | 18992 |
| 57 | Ga0070679_100004565 | 3300005530 | Bacteria | 12789 |
| 58 | Ga0070679_100024072 | 3300005530 | Bacteria | 5965 |
| 59 | Ga0070679_100581990 | 3300005530 | Bacteria | 1063 |
| 60 | Ga0070684_100047868 | 3300005535 | Bacteria | 3707 |
| 61 | Ga0070684_100069700 | 3300005535 | Bacteria | 3092 |
| 62 | Ga0070684_100103639 | 3300005535 | Bacteria | 2545 |
| 63 | Ga0070684_100193321 | 3300005535 | Bacteria | 1852 |
| 64 | Ga0070684_100243311 | 3300005535 | Bacteria | 1644 |
| 65 | Ga0070684_100255050 | 3300005535 | Bacteria | 1603 |
| 66 | Ga0070684_100506800 | 3300005535 | Bacteria | 1118 |
| 67 | Ga0070686_100142072 | 3300005544 | Bacteria | 1672 |
| 68 | Ga0070695_100064459 | 3300005545 | Bacteria | 2384 |
| 69 | Ga0070696_100000289 | 3300005546 | Bacteria | 30405 |
| 70 | Ga0070693_100006910 | 3300005547 | Bacteria | 5518 |
| 71 | Ga0070665_100068008 | 3300005548 | Bacteria | 3572 |
| 72 | Ga0070665_100358276 | 3300005548 | Bacteria | 1464 |
| 73 | Ga0068855_100187902 | 3300005563 | Bacteria | 2332 |
| 74 | Ga0070664_100074197 | 3300005564 | Bacteria | 2920 |
| 75 | Ga0070664_100086790 | 3300005564 | Unclassified | 2704 |
| 76 | Ga0070664_100654097 | 3300005564 | Bacteria | 977 |
| 77 | Ga0070664_100827237 | 3300005564 | Bacteria | 866 |
| 78 | Ga0068856_100079040 | 3300005614 | Bacteria | 3261 |
| 79 | Ga0068856_100121434 | 3300005614 | Bacteria | 2614 |
| 80 | Ga0068856_101403008 | 3300005614 | Bacteria | 713 |
| 81 | Ga0070702_100008765 | 3300005615 | Bacteria | 4917 |
| 82 | Ga0070702_100541827 | 3300005615 | Bacteria | 862 |
| 83 | Ga0068852_100080241 | 3300005616 | Bacteria | 2892 |
| 84 | Ga0068859_100024088 | 3300005617 | Bacteria | 6108 |
| 85 | Ga0068859_101216077 | 3300005617 | Bacteria | 830 |
| 86 | Ga0068866_10863047 | 3300005718 | Bacteria | 634 |
| 87 | Ga0068860_100020204 | 3300005843 | Bacteria | 6455 |
| 88 | Ga0081540_1005479 | 3300005983 | Bacteria | 9470 |
| 89 | Ga0081540_1031094 | 3300005983 | Bacteria | 2944 |
| 90 | Ga0081540_1053744 | 3300005983 | Bacteria | 1973 |
| 91 | Ga0070717_10334111 | 3300006028 | Bacteria | 1352 |
| 92 | Ga0070716_100097312 | 3300006173 | Bacteria | 1796 |
| 93 | Ga0097621_100762020 | 3300006237 | Bacteria | 894 |
| 94 | Ga0097621_101054144 | 3300006237 | Bacteria | 762 |
| 95 | Ga0068871_100182402 | 3300006358 | Bacteria | 1804 |
| 96 | Ga0075430_100139716 | 3300006846 | Bacteria | 2017 |
| 97 | Ga0075431_100142684 | 3300006847 | Bacteria | 2469 |
| 98 | Ga0075433_10068524 | 3300006852 | Bacteria | 3115 |
| 99 | Ga0068865_100214398 | 3300006881 | Bacteria | 1502 |
| 100 | Ga0097620_100024088 | 3300006931 | Bacteria | 6108 |
| 101 | Ga0097620_101216076 | 3300006931 | Bacteria | 830 |
| 102 | Ga0075435_100506290 | 3300007076 | Bacteria | 1044 |
| 103 | Ga0105245_10014485 | 3300009098 | Bacteria | 6868 |
| 104 | Ga0105245_10306877 | 3300009098 | Bacteria | 1559 |
| 105 | Ga0105243_10286293 | 3300009148 | Bacteria | 1487 |
| 106 | Ga0105243_10761868 | 3300009148 | Bacteria | 950 |
| 107 | Ga0105241_10037359 | 3300009174 | Bacteria | 3658 |
| 108 | Ga0105241_11547553 | 3300009174 | Bacteria | 640 |
| 109 | Ga0105242_10296316 | 3300009176 | Bacteria | 1474 |
| 110 | Ga0105242_10334988 | 3300009176 | Bacteria | 1393 |
| 111 | Ga0105248_10021923 | 3300009177 | Bacteria | 7078 |
| 112 | Ga0105248_10536658 | 3300009177 | Bacteria | 1319 |
| 113 | Ga0105248_10730201 | 3300009177 | Bacteria | 1117 |
| 114 | Ga0105237_10262707 | 3300009545 | Bacteria | 1729 |
| 115 | Ga0105238_12389455 | 3300009551 | Bacteria | 564 |
| 116 | Ga0105249_10926245 | 3300009553 | Bacteria | 939 |
| 117 | Ga0099796_10024787 | 3300010159 | Bacteria | 1887 |
| 118 | Ga0105239_10687755 | 3300010375 | Bacteria | 1169 |
| 119 | Ga0105239_11681939 | 3300010375 | Bacteria | 734 |
| 120 | Ga0105246_10068452 | 3300011119 | Bacteria | 2490 |
| 121 | Ga0105246_10133341 | 3300011119 | Bacteria | 1858 |
| 122 | Ga0157373_10028569 | 3300013100 | Bacteria | 4023 |
| 123 | Ga0157373_10312598 | 3300013100 | Bacteria | 1117 |
| 124 | Ga0157370_10086558 | 3300013104 | Bacteria | 2944 |
| 125 | Ga0157370_10098753 | 3300013104 | Bacteria | 2737 |
| 126 | Ga0157370_10848312 | 3300013104 | Bacteria | 830 |
| 127 | Ga0157369_10234203 | 3300013105 | Bacteria | 1919 |
| 128 | Ga0157369_10598761 | 3300013105 | Bacteria | 1138 |
| 129 | Ga0157369_11605615 | 3300013105 | Bacteria | 661 |
| 130 | Ga0157374_10721824 | 3300013296 | Bacteria | 1010 |
| 131 | Ga0157378_11819558 | 3300013297 | Bacteria | 657 |
| 132 | Ga0157378_12591636 | 3300013297 | Bacteria | 559 |
| 133 | Ga0163162_10539488 | 3300013306 | Bacteria | 1295 |
| 134 | Ga0157372_10003395 | 3300013307 | Bacteria | 17187 |
| 135 | Ga0157372_10022621 | 3300013307 | Bacteria | 6804 |
| 136 | Ga0157372_10342487 | 3300013307 | Bacteria | 1741 |
| 137 | Ga0157372_10481173 | 3300013307 | Bacteria | 1447 |
| 138 | Ga0157372_10865043 | 3300013307 | Bacteria | 1049 |
| 139 | Ga0157372_10922411 | 3300013307 | Bacteria | 1013 |
| 140 | Ga0157375_10066711 | 3300013308 | Bacteria | 3594 |
| 141 | Ga0157375_10173212 | 3300013308 | Bacteria | 2306 |
| 142 | Ga0157375_10544698 | 3300013308 | Bacteria | 1322 |
| 143 | Ga0157375_11159260 | 3300013308 | Bacteria | 906 |
| 144 | Ga0163163_10041187 | 3300014325 | Bacteria | 4516 |
| 145 | Ga0163163_10709289 | 3300014325 | Bacteria | 1070 |
| 146 | Ga0163163_10853720 | 3300014325 | Bacteria | 974 |
| 147 | Ga0157380_10392505 | 3300014326 | Bacteria | 1314 |
| 148 | Ga0157377_10122357 | 3300014745 | Bacteria | 1579 |
| 149 | Ga0157376_10018950 | 3300014969 | Bacteria | 5291 |
| 150 | Ga0157376_10357491 | 3300014969 | Bacteria | 1400 |
| 151 | Ga0157376_10735482 | 3300014969 | Bacteria | 994 |
| 152 | Ga0182007_10162035 | 3300015262 | Bacteria | 765 |
| 153 | Ga0213873_10000314 | 3300021358 | Bacteria | 8243 |
| 154 | Ga0213872_10017536 | 3300021361 | Bacteria | 3307 |
| 155 | Ga0213872_10067832 | 3300021361 | Bacteria | 1610 |
| 156 | Ga0213874_10017392 | 3300021377 | Bacteria | 1928 |
| 157 | Ga0213876_10022155 | 3300021384 | Bacteria | 3360 |
| 158 | Ga0213871_10050474 | 3300021441 | Bacteria | 1138 |
| 159 | Ga0209564_1027065 | 3300025295 | Bacteria | 1873 |
| 160 | Ga0207692_10000427 | 3300025898 | Bacteria | 14774 |
| 161 | Ga0207642_10527748 | 3300025899 | Bacteria | 726 |
| 162 | Ga0207647_10170765 | 3300025904 | Bacteria | 1266 |
| 163 | Ga0207699_10000213 | 3300025906 | Bacteria | 34254 |
| 164 | Ga0207645_10150291 | 3300025907 | Bacteria | 1520 |
| 165 | Ga0207705_10756443 | 3300025909 | Bacteria | 755 |
| 166 | Ga0207707_10009363 | 3300025912 | Bacteria | 8496 |
| 167 | Ga0207707_10025736 | 3300025912 | Bacteria | 5147 |
| 168 | Ga0207707_10061052 | 3300025912 | Bacteria | 3280 |
| 169 | Ga0207707_10697642 | 3300025912 | Bacteria | 852 |
| 170 | Ga0207695_10101967 | 3300025913 | Bacteria | 2864 |
| 171 | Ga0207693_10010945 | 3300025915 | Bacteria | 7350 |
| 172 | Ga0207663_10012297 | 3300025916 | Bacteria | 4624 |
| 173 | Ga0207660_10043349 | 3300025917 | Bacteria | 3162 |
| 174 | Ga0207660_10139369 | 3300025917 | Bacteria | 1853 |
| 175 | Ga0207662_10262666 | 3300025918 | Bacteria | 1137 |
| 176 | Ga0207657_10023463 | 3300025919 | Bacteria | 5743 |
| 177 | Ga0207649_10018032 | 3300025920 | Bacteria | 4006 |
| 178 | Ga0207652_10005321 | 3300025921 | Bacteria | 10442 |
| 179 | Ga0207652_10006050 | 3300025921 | Bacteria | 9795 |
| 180 | Ga0207652_10049728 | 3300025921 | Bacteria | 3590 |
| 181 | Ga0207652_10232723 | 3300025921 | Bacteria | 1661 |
| 182 | Ga0207652_10321451 | 3300025921 | Bacteria | 1397 |
| 183 | Ga0207646_11666326 | 3300025922 | Bacteria | 549 |
| 184 | Ga0207694_10036296 | 3300025924 | Bacteria | 3782 |
| 185 | Ga0207650_10674122 | 3300025925 | Bacteria | 872 |
| 186 | Ga0207659_10302257 | 3300025926 | Unclassified | 1314 |
| 187 | Ga0207687_10017035 | 3300025927 | Bacteria | 4777 |
| 188 | Ga0207700_10099356 | 3300025928 | Bacteria | 2317 |
| 189 | Ga0207664_10003422 | 3300025929 | Bacteria | 10577 |
| 190 | Ga0207644_10745297 | 3300025931 | Bacteria | 818 |
| 191 | Ga0207644_11637912 | 3300025931 | Bacteria | 540 |
| 192 | Ga0207690_10973395 | 3300025932 | Bacteria | 705 |
| 193 | Ga0207706_10071082 | 3300025933 | Bacteria | 3060 |
| 194 | Ga0207706_10075649 | 3300025933 | Bacteria | 2961 |
| 195 | Ga0207686_10102656 | 3300025934 | Bacteria | 1912 |
| 196 | Ga0207686_10116904 | 3300025934 | Bacteria | 1808 |
| 197 | Ga0207670_10100351 | 3300025936 | Bacteria | 2066 |
| 198 | Ga0207665_10010201 | 3300025939 | Bacteria | 6168 |
| 199 | Ga0207665_10242088 | 3300025939 | Archaea | 1329 |
| 200 | Ga0207711_10207961 | 3300025941 | Bacteria | 1787 |
| 201 | Ga0207689_10045647 | 3300025942 | Bacteria | 3622 |
| 202 | Ga0207689_10216700 | 3300025942 | Bacteria | 1582 |
| 203 | Ga0207661_10005343 | 3300025944 | Bacteria | 9043 |
| 204 | Ga0207661_10014967 | 3300025944 | Bacteria | 5696 |
| 205 | Ga0207661_10122822 | 3300025944 | Bacteria | 2213 |
| 206 | Ga0207661_10249360 | 3300025944 | Bacteria | 1577 |
| 207 | Ga0207661_10328323 | 3300025944 | Bacteria | 1376 |
| 208 | Ga0207661_10379229 | 3300025944 | Bacteria | 1280 |
| 209 | Ga0207661_10515401 | 3300025944 | Bacteria | 1093 |
| 210 | Ga0207679_10059934 | 3300025945 | Bacteria | 2826 |
| 211 | Ga0207679_10818004 | 3300025945 | Bacteria | 850 |
| 212 | Ga0207667_10080584 | 3300025949 | Bacteria | 3373 |
| 213 | Ga0207651_10170950 | 3300025960 | Bacteria | 1714 |
| 214 | Ga0207668_10331808 | 3300025972 | Bacteria | 1266 |
| 215 | Ga0207668_11299626 | 3300025972 | Bacteria | 655 |
| 216 | Ga0207678_10251262 | 3300026067 | Bacteria | 1514 |
| 217 | Ga0207702_10077274 | 3300026078 | Bacteria | 2879 |
| 218 | Ga0207702_10410800 | 3300026078 | Unclassified | 1307 |
| 219 | Ga0207648_10082795 | 3300026089 | Bacteria | 2798 |
| 220 | Ga0207676_10123894 | 3300026095 | Bacteria | 2184 |
| 221 | Ga0207676_10369896 | 3300026095 | Bacteria | 1331 |
| 222 | Ga0207674_10001931 | 3300026116 | Bacteria | 26314 |
| 223 | Ga0207674_10161318 | 3300026116 | Bacteria | 2196 |
| 224 | Ga0207683_10292987 | 3300026121 | Bacteria | 1488 |
| 225 | Ga0207683_10419960 | 3300026121 | Bacteria | 1232 |
| 226 | Ga0207698_10542118 | 3300026142 | Bacteria | 1139 |
| 227 | Ga0207428_10141857 | 3300027907 | Bacteria | 1833 |
| 228 | Ga0268266_10047169 | 3300028379 | Bacteria | 3690 |
| 229 | Ga0268266_10266276 | 3300028379 | Bacteria | 1590 |
| 230 | Ga0268265_11410548 | 3300028380 | Bacteria | 699 |
| 231 | Ga0268264_10377173 | 3300028381 | Bacteria | 1357 |
| 232 | Ga0265337_1030410 | 3300028556 | Bacteria | 1608 |
| 233 | Ga0265326_10015744 | 3300028558 | Bacteria | 2191 |
| 234 | Ga0265319_1001014 | 3300028563 | Bacteria | 17548 |
| 235 | Ga0265319_1001685 | 3300028563 | Bacteria | 12765 |
| 236 | Ga0265319_1002881 | 3300028563 | Bacteria | 9188 |
| 237 | Ga0265319_1011749 | 3300028563 | Bacteria | 3566 |
| 238 | Ga0265319_1049898 | 3300028563 | Bacteria | 1384 |
| 239 | Ga0265334_10005729 | 3300028573 | Bacteria | 5415 |
| 240 | Ga0265334_10010638 | 3300028573 | Bacteria | 3884 |
| 241 | Ga0265318_10001158 | 3300028577 | Bacteria | 16360 |
| 242 | Ga0265318_10002409 | 3300028577 | Bacteria | 10004 |
| 243 | Ga0265318_10005763 | 3300028577 | Bacteria | 5788 |
| 244 | Ga0265318_10038052 | 3300028577 | Bacteria | 1841 |
| 245 | Ga0265322_10031570 | 3300028654 | Bacteria | 1512 |
| 246 | Ga0265336_10088368 | 3300028666 | Bacteria | 924 |
| 247 | Ga0265338_10007620 | 3300028800 | Bacteria | 13362 |
| 248 | Ga0265338_10082599 | 3300028800 | Bacteria | 2689 |
| 249 | Ga0265338_10086852 | 3300028800 | Bacteria | 2601 |
| 250 | Ga0265330_10003624 | 3300031235 | Bacteria | 8037 |
| 251 | Ga0265332_10036124 | 3300031238 | Bacteria | 2145 |
| 252 | Ga0265332_10216163 | 3300031238 | Bacteria | 795 |
| 253 | Ga0265328_10006874 | 3300031239 | Bacteria | 4779 |
| 254 | Ga0265328_10031108 | 3300031239 | Bacteria | 1985 |
| 255 | Ga0265328_10078547 | 3300031239 | Bacteria | 1216 |
| 256 | Ga0265320_10000575 | 3300031240 | Bacteria | 28210 |
| 257 | Ga0265320_10007360 | 3300031240 | Bacteria | 6834 |
| 258 | Ga0265320_10011301 | 3300031240 | Bacteria | 5260 |
| 259 | Ga0265320_10014274 | 3300031240 | Bacteria | 4528 |
| 260 | Ga0265320_10024753 | 3300031240 | Bacteria | 3168 |
| 261 | Ga0265320_10096682 | 3300031240 | Bacteria | 1363 |
| 262 | Ga0265325_10004359 | 3300031241 | Bacteria | 8957 |
| 263 | Ga0265329_10001559 | 3300031242 | Bacteria | 10975 |
| 264 | Ga0265340_10007496 | 3300031247 | Bacteria | 5923 |
| 265 | Ga0265340_10035080 | 3300031247 | Bacteria | 2492 |
| 266 | Ga0265339_10068859 | 3300031249 | Bacteria | 1890 |
| 267 | Ga0265331_10004592 | 3300031250 | Bacteria | 8586 |
| 268 | Ga0265331_10008083 | 3300031250 | Bacteria | 6009 |
| 269 | Ga0265331_10096038 | 3300031250 | Bacteria | 1367 |
| 270 | Ga0265316_10006913 | 3300031344 | Bacteria | 10763 |
| 271 | Ga0265316_10060798 | 3300031344 | Bacteria | 2936 |
| 272 | Ga0265316_10098940 | 3300031344 | Bacteria | 2219 |
| 273 | Ga0265316_10186991 | 3300031344 | Bacteria | 1540 |
| 274 | Ga0265316_10527086 | 3300031344 | Unclassified | 842 |
| 275 | Ga0265313_10001119 | 3300031595 | Bacteria | 25614 |
| 276 | Ga0265313_10003063 | 3300031595 | Bacteria | 13875 |
| 277 | Ga0265313_10004776 | 3300031595 | Bacteria | 10210 |
| 278 | Ga0265313_10006776 | 3300031595 | Bacteria | 8011 |
| 279 | Ga0265313_10021622 | 3300031595 | Bacteria | 3514 |
| 280 | Ga0265314_10010603 | 3300031711 | Bacteria | 7669 |
| 281 | Ga0265314_10521630 | 3300031711 | Bacteria | 622 |
| 282 | Ga0265342_10003518 | 3300031712 | Bacteria | 12809 |
| 283 | Ga0265342_10014230 | 3300031712 | Bacteria | 5289 |
| 284 | Ga0265342_10086331 | 3300031712 | Bacteria | 1804 |
| 285 | Ga0265342_10088050 | 3300031712 | Bacteria | 1783 |
| 286 | Ga0307409_100656861 | 3300031995 | Bacteria | 1043 |
| 287 | Ga0307416_101194964 | 3300032002 | Bacteria | 866 |
| 288 | Ga0307411_10789687 | 3300032005 | Bacteria | 835 |
| 289 | Ga0373926_0124741 | 3300035083 | Bacteria | 972 |
| 290 | Ga0373934_0044387 | 3300035086 | Bacteria | 1757 |
| 291 | Ga0373923_0003560 | 3300035111 | Bacteria | 5013 |
| 292 | Ga0373923_0184696 | 3300035111 | Bacteria | 959 |
| 293 | Ga0373945_0500040 | 3300035116 | Unclassified | 542 |
| 294 | Ga0373954_0061835 | 3300035118 | Bacteria | 1768 |
| 295 | Ga0373954_0107020 | 3300035118 | Bacteria | 1351 |
| 296 | Ga0373956_0004997 | 3300035119 | Bacteria | 5312 |
| 297 | Ga0373956_0022145 | 3300035119 | Bacteria | 2716 |
| 298 | Ga0373957_0135320 | 3300035120 | Bacteria | 1005 |
| 299 | Ga0373955_0001186 | 3300035172 | Bacteria | 11101 |
| 300 | Ga0373955_0007825 | 3300035172 | Bacteria | 4929 |
| 301 | Ga0373955_0033854 | 3300035172 | Bacteria | 2693 |
| 302 | Ga0373962_0193779 | 3300035242 | Bacteria | 685 |
| 303 | Ga0373924_0000442 | 3300035410 | Bacteria | 12714 |
| 304 | Ga0373924_0089787 | 3300035410 | Bacteria | 1314 |
| 305 | Ga0373931_0029518 | 3300035691 | Bacteria | 2816 |
| 306 | Ga0373935_0058419 | 3300035692 | Bacteria | 2464 |
| 307 | Ga0373935_1117030 | 3300035692 | Bacteria | 587 |
| 308 | Ga0373927_0215547 | 3300035695 | Bacteria | 1261 |
| 309 | Ga0373933_0000501 | 3300035724 | Bacteria | 24379 |
| 310 | Ga0373933_0027715 | 3300035724 | Bacteria | 3265 |
| 311 | Ga0373947_0096074 | 3300035725 | Bacteria | 1855 |
| 312 | Ga0373947_0565618 | 3300035725 | Bacteria | 774 |
| 313 | Ga0373937_0000649 | 3300036401 | Bacteria | 30519 |
| 314 | Ga0373937_0006774 | 3300036401 | Bacteria | 9891 |
| 315 | Ga0373937_0428729 | 3300036401 | Bacteria | 1255 |
| 316 | Ga0373925_0121458 | 3300037068 | Bacteria | 2028 |
| 317 | Ga0436364_1347693 | 3300037853 | Bacteria | 1106 |
| 318 | Ga0436365_0003491 | 3300039437 | Bacteria | 5126 |
| 319 | Ga0436365_1926543 | 3300039437 | Bacteria | 3906 |
| 320 | Ga0436360_0192702 | 3300039438 | Bacteria | 9450 |
| 321 | Ga0436360_1059052 | 3300039438 | Bacteria | 964 |
| 322 | Ga0436360_1344670 | 3300039438 | Bacteria | 2360 |
| 323 | Ga0436361_0090190 | 3300039447 | Bacteria | 1714 |
| 324 | Ga0436361_0900803 | 3300039447 | Bacteria | 1295 |
| 325 | Ga0436361_0900950 | 3300039447 | Bacteria | 2346 |
| 326 | Ga0436361_1179158 | 3300039447 | Bacteria | 4064 |
| 327 | Ga0436363_1318239 | 3300039450 | Bacteria | 3403 |
| 328 | Ga0436362_0105480 | 3300039453 | Bacteria | 14435 |
| 329 | Ga0436362_1208409 | 3300039453 | Bacteria | 750 |
| 330 | Ga0451807_1825705 | 3300041486 | Bacteria | 561 |
| 331 | Ga0450898_038793 | 3300042134 | Bacteria | 895 |
| 332 | Ga0439434_0171290 | 3300042435 | Bacteria | 724 |
| 333 | Ga0450916_038562 | 3300042530 | Bacteria | 720 |
| 334 | Ga0451577_0002349 | 3300042876 | Bacteria | 22746 |
| 335 | Ga0453684_0000534 | 3300044712 | Bacteria | 144649 |
| 336 | Ga0453684_0397407 | 3300044712 | Bacteria | 1544 |
| 337 | Ga0466957_0383343 | 3300044842 | Bacteria | 959 |
| 338 | Ga0451576_0000087 | 3300045051 | Bacteria | 234554 |
| 339 | Ga0451576_0006613 | 3300045051 | Bacteria | 14171 |
| 340 | Ga0451576_0096701 | 3300045051 | Bacteria | 3071 |
| 341 | Ga0466967_0892437 | 3300045976 | Bacteria | 884 |
| 342 | Ga0495629_0039594 | 3300046459 | Bacteria | 3317 |
| 343 | Ga0495629_0176785 | 3300046459 | Bacteria | 1480 |
| 344 | Ga0495629_0437856 | 3300046459 | Unclassified | 886 |
| 345 | Ga0495629_0495676 | 3300046459 | Bacteria | 824 |
| 346 | Ga0495651_0000045 | 3300046462 | Bacteria | 90367 |
| 347 | Ga0495651_0116316 | 3300046462 | Bacteria | 1970 |
| 348 | Ga0495653_0000093 | 3300046463 | Bacteria | 74824 |
| 349 | Ga0495580_0156548 | 3300046472 | Bacteria | 1577 |
| 350 | Ga0495582_0019325 | 3300046473 | Bacteria | 3725 |
| 351 | Ga0495639_0027462 | 3300046475 | Bacteria | 2520 |
| 352 | Ga0495639_0100441 | 3300046475 | Bacteria | 1365 |
| 353 | Ga0495662_0117476 | 3300046476 | Bacteria | 1305 |
| 354 | Ga0495664_0063602 | 3300046477 | Bacteria | 2199 |
| 355 | Ga0495594_0063626 | 3300046499 | Unclassified | 2044 |
| 356 | Ga0495594_0296993 | 3300046499 | Bacteria | 920 |
| 357 | Ga0495594_0382315 | 3300046499 | Bacteria | 801 |
| 358 | Ga0495608_0009509 | 3300046511 | Bacteria | 6791 |
| 359 | Ga0495608_0224645 | 3300046511 | Bacteria | 1177 |
| 360 | Ga0495618_0034143 | 3300046514 | Bacteria | 3189 |
| 361 | Ga0495618_0156092 | 3300046514 | Bacteria | 1456 |
| 362 | Ga0495620_0027451 | 3300046515 | Bacteria | 2663 |
| 363 | Ga0495628_0000568 | 3300046516 | Bacteria | 33938 |
| 364 | Ga0495628_0302667 | 3300046516 | Bacteria | 1183 |
| 365 | Ga0495630_0005102 | 3300046517 | Bacteria | 9234 |
| 366 | Ga0495630_0067126 | 3300046517 | Bacteria | 2696 |
| 367 | Ga0495630_0485383 | 3300046517 | Bacteria | 947 |
| 368 | Ga0495643_0006921 | 3300046522 | Bacteria | 7378 |
| 369 | Ga0495648_0131506 | 3300046524 | Bacteria | 1330 |
| 370 | Ga0495648_0414226 | 3300046524 | Bacteria | 599 |
| 371 | Ga0495666_0026970 | 3300046526 | Bacteria | 2828 |
| 372 | Ga0495642_0271760 | 3300046528 | Bacteria | 742 |
| 373 | Ga0495652_0000166 | 3300046529 | Bacteria | 75721 |
| 374 | Ga0495652_0085729 | 3300046529 | Bacteria | 2588 |
| 375 | Ga0495654_0070660 | 3300046530 | Bacteria | 1655 |
| 376 | Ga0495665_0018414 | 3300046531 | Bacteria | 3753 |
| 377 | Ga0495665_0100274 | 3300046531 | Bacteria | 1520 |
| 378 | Ga0495665_0654722 | 3300046531 | Bacteria | 523 |
| 379 | Ga0495586_0034625 | 3300046535 | Bacteria | 2713 |
| 380 | Ga0495586_0041267 | 3300046535 | Bacteria | 2485 |
| 381 | Ga0495586_0071502 | 3300046535 | Bacteria | 1896 |
| 382 | Ga0495587_0003696 | 3300046536 | Bacteria | 10179 |
| 383 | Ga0495609_0019944 | 3300046538 | Bacteria | 3100 |
| 384 | Ga0495609_0039159 | 3300046538 | Bacteria | 2135 |
| 385 | Ga0495597_0011191 | 3300046542 | Bacteria | 4353 |
| 386 | Ga0495597_0015635 | 3300046542 | Bacteria | 3591 |
| 387 | Ga0495645_0000218 | 3300046543 | Bacteria | 41357 |
| 388 | Ga0495645_0000833 | 3300046543 | Bacteria | 20988 |
| 389 | Ga0495622_0000742 | 3300046557 | Bacteria | 18318 |
| 390 | Ga0495667_0000788 | 3300046559 | Bacteria | 20352 |
| 391 | Ga0495667_0031759 | 3300046559 | Bacteria | 3541 |
| 392 | Ga0495634_0126343 | 3300046642 | Bacteria | 1634 |
| 393 | Ga0495634_0147095 | 3300046642 | Bacteria | 1492 |
| 394 | Ga0495611_0260891 | 3300046648 | Bacteria | 802 |
| 395 | Ga0495611_0353789 | 3300046648 | Bacteria | 674 |
| 396 | Ga0495625_0032162 | 3300046660 | Bacteria | 3895 |
| 397 | Ga0495625_0101921 | 3300046660 | Bacteria | 1971 |
| 398 | Ga0495635_0000043 | 3300046663 | Bacteria | 84495 |
| 399 | Ga0495657_0000172 | 3300046675 | Bacteria | 58377 |
| 400 | Ga0495599_0002832 | 3300046678 | Bacteria | 10102 |
| 401 | Ga0495599_0028469 | 3300046678 | Bacteria | 3502 |
| 402 | Ga0495623_0000120 | 3300046679 | Bacteria | 48263 |
| 403 | Ga0495623_0017600 | 3300046679 | Bacteria | 4614 |
| 404 | Ga0495646_0000732 | 3300046680 | Bacteria | 18243 |
| 405 | Ga0495647_0398115 | 3300046681 | Bacteria | 632 |
| 406 | Ga0495658_0278172 | 3300046683 | Unclassified | 1056 |
| 407 | Ga0495613_0012865 | 3300046689 | Bacteria | 6220 |
| 408 | Ga0495613_0388303 | 3300046689 | Bacteria | 954 |
| 409 | Ga0495600_0000093 | 3300046809 | Bacteria | 48851 |
| 410 | Ga0495600_0046252 | 3300046809 | Bacteria | 2840 |
| 411 | Ga0495581_0015761 | 3300047315 | Bacteria | 4389 |
| 412 | Ga0495581_0138697 | 3300047315 | Bacteria | 1418 |
| 413 | Ga0495581_0216599 | 3300047315 | Bacteria | 1119 |
| 414 | Ga0495581_0469207 | 3300047315 | Bacteria | 732 |
| 415 | Ga0495604_0000166 | 3300047317 | Bacteria | 57892 |
| 416 | Ga0495674_0000520 | 3300047319 | Bacteria | 35433 |
| 417 | Ga0495674_0005433 | 3300047319 | Bacteria | 12239 |
| 418 | Ga0495674_1076488 | 3300047319 | Bacteria | 613 |
| 419 | Ga0495672_0000630 | 3300047320 | Bacteria | 39369 |
| 420 | Ga0495672_0005815 | 3300047320 | Bacteria | 9682 |
| 421 | Ga0495672_0136607 | 3300047320 | Bacteria | 1285 |
| 422 | Ga0495680_0005857 | 3300047322 | Bacteria | 11504 |
| 423 | Ga0495687_069531 | 3300047443 | Bacteria | 1417 |
| 424 | Ga0495675_0003188 | 3300047444 | Bacteria | 9859 |
| 425 | Ga0495675_0007016 | 3300047444 | Bacteria | 6925 |
| 426 | Ga0495677_0225374 | 3300047445 | Bacteria | 731 |
| 427 | Ga0495679_009921 | 3300047446 | Bacteria | 3776 |
| 428 | Ga0495681_0063444 | 3300047470 | Bacteria | 1695 |
| 429 | Ga0495684_0000034 | 3300047471 | Bacteria | 111355 |
| 430 | Ga0495684_0067224 | 3300047471 | Bacteria | 2726 |
| 431 | Ga0495684_0166140 | 3300047471 | Unclassified | 1644 |
| 432 | Ga0495593_0127547 | 3300047673 | Bacteria | 1293 |
| 433 | Ga0495602_0000684 | 3300048088 | Bacteria | 31846 |
| 434 | Ga0495602_0834068 | 3300048088 | Bacteria | 617 |
| 435 | Ga0495614_0336647 | 3300048089 | Bacteria | 702 |
| 436 | Ga0495626_0016415 | 3300048091 | Bacteria | 3759 |
| 437 | Ga0496108_0450249 | 3300048911 | Bacteria | 1125 |
| 438 | Ga0496109_0111163 | 3300048912 | Bacteria | 2548 |
| 439 | Ga0496111_1009034 | 3300048914 | Bacteria | 596 |
| 440 | Ga0496112_0005535 | 3300048915 | Bacteria | 10944 |
| 441 | Ga0496113_0050543 | 3300048916 | Bacteria | 3100 |
| 442 | Ga0496115_1106998 | 3300048918 | Bacteria | 600 |
| 443 | Ga0496119_0004112 | 3300048922 | Bacteria | 14658 |
| 444 | Ga0496120_0243442 | 3300048923 | Bacteria | 848 |
| 445 | Ga0496125_0025606 | 3300048928 | Bacteria | 5399 |
| 446 | Ga0501308_033133 | 3300049128 | Bacteria | 701 |
| 447 | Ga0495682_0124141 | 3300049460 | Bacteria | 924 |
| 448 | Ga0501291_029558 | 3300049514 | Bacteria | 918 |
| 449 | Ga0501032_0001213 | 3300049569 | Bacteria | 20627 |
| 450 | Ga0501032_0013091 | 3300049569 | Bacteria | 5908 |
| 451 | Ga0501033_0003055 | 3300049570 | Bacteria | 13918 |
| 452 | Ga0501036_0791629 | 3300049572 | Bacteria | 781 |
| 453 | Ga0501036_1179783 | 3300049572 | Bacteria | 624 |
| 454 | Ga0501037_0021558 | 3300049573 | Bacteria | 4763 |
| 455 | Ga0501037_0030523 | 3300049573 | Bacteria | 3983 |
| 456 | Ga0501043_0105330 | 3300049579 | Bacteria | 2216 |
| 457 | Ga0501043_0245453 | 3300049579 | Bacteria | 1380 |
| 458 | Ga0501046_0004848 | 3300049580 | Bacteria | 12122 |
| 459 | Ga0501067_0000546 | 3300049583 | Bacteria | 20441 |
| 460 | Ga0501070_1052507 | 3300049586 | Bacteria | 629 |
| 461 | Ga0501072_0153559 | 3300049588 | Bacteria | 1836 |
| 462 | Ga0501073_0000004 | 3300049589 | Bacteria | 261794 |
| 463 | Ga0501077_0000008 | 3300049593 | Bacteria | 106496 |
| 464 | Ga0501230_057797 | 3300049667 | Bacteria | 781 |
| 465 | Ga0501080_0065118 | 3300049742 | Bacteria | 3391 |
| 466 | Ga0501083_0286745 | 3300049744 | Bacteria | 1071 |
| 467 | Ga0501035_1091396 | 3300049822 | Bacteria | 624 |
| 468 | Ga0501044_0007493 | 3300049823 | Bacteria | 12004 |
| 469 | Ga0501044_0050528 | 3300049823 | Bacteria | 4289 |
| 470 | Ga0501044_0773155 | 3300049823 | Bacteria | 841 |
| 471 | nmdc:mga05p37_98070_c1 | 3300050507 | Bacteria | 3610 |
| 472 | nmdc:mga09592_166276_c1 | 3300050508 | Bacteria | 1907 |
| 473 | nmdc:mga0qj67_118310_c1 | 3300050509 | Bacteria | 2142 |
| 474 | nmdc:mga0qj67_166645_c1 | 3300050509 | Bacteria | 1789 |
| 475 | nmdc:mga06r32_156416_c1 | 3300050510 | Bacteria | 2261 |
| 476 | nmdc:mga06r32_43798_c1 | 3300050510 | Bacteria | 4259 |
| 477 | nmdc:mga0a205_201001_c1 | 3300050515 | Bacteria | 1883 |
| 478 | Ga0495601_0043447 | 3300053077 | Bacteria | 2822 |
| 479 | Ga0495612_0000690 | 3300053078 | Bacteria | 13635 |
| 480 | Ga0500635_0000080 | 3300053080 | Bacteria | 63214 |
| 481 | Ga0500578_0155143 | 3300053086 | Bacteria | 1424 |
| 482 | Ga0500643_000276 | 3300053087 | Bacteria | 44463 |
| 483 | Ga0500647_0229388 | 3300053091 | Bacteria | 827 |
| 484 | Ga0500583_0051768 | 3300053092 | Bacteria | 1909 |
| 485 | Ga0500566_0095711 | 3300053094 | Bacteria | 1635 |
| 486 | Ga0500555_001650 | 3300053103 | Bacteria | 6740 |
| 487 | Ga0500556_0001835 | 3300053104 | Bacteria | 7755 |
| 488 | Ga0500569_002128 | 3300053109 | Bacteria | 3854 |
| 489 | Ga0500595_006120 | 3300053119 | Bacteria | 5157 |
| 490 | Ga0500597_184228 | 3300053120 | Bacteria | 884 |
| 491 | Ga0500607_198653 | 3300053121 | Bacteria | 865 |
| 492 | Ga0500608_060472 | 3300053122 | Bacteria | 1811 |
| 493 | Ga0500614_002135 | 3300053123 | Bacteria | 4509 |
| 494 | Ga0500618_000024 | 3300053125 | Bacteria | 152149 |
| 495 | Ga0500642_0042020 | 3300053130 | Bacteria | 1980 |
| 496 | Ga0500559_0003697 | 3300053136 | Bacteria | 7459 |
| 497 | Ga0500559_0013894 | 3300053136 | Bacteria | 3405 |
| 498 | Ga0500559_0155332 | 3300053136 | Bacteria | 1074 |
| 499 | Ga0500568_0006998 | 3300053139 | Bacteria | 5583 |
| 500 | Ga0500577_0325912 | 3300053142 | Bacteria | 671 |
| 501 | Ga0500590_011497 | 3300053148 | Bacteria | 4485 |
| 502 | Ga0500619_109727 | 3300053154 | Bacteria | 939 |
| 503 | Ga0500638_205536 | 3300053162 | Bacteria | 829 |
| 504 | Ga0500636_0005352 | 3300053177 | Bacteria | 7318 |
| 505 | Ga0500636_0093513 | 3300053177 | Bacteria | 1719 |
| 506 | Ga0500637_0032253 | 3300053178 | Bacteria | 2920 |
| 507 | Ga0500625_072625 | 3300053729 | Bacteria | 1526 |
| 508 | Ga0500596_000241 | 3300053735 | Bacteria | 9458 |
| 509 | Ga0500601_015292 | 3300053737 | Bacteria | 872 |
| 510 | Ga0500661_000098 | 3300055283 | Bacteria | 14033 |
| 511 | Ga0501082_0102568 | 3300060353 | Bacteria | 2475 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005330 | Ga0070690_100251961 | Ga0070690_1002519611 | 147 |
| 2 | 3300013307 | Ga0157372_10481173 | Ga0157372_104811731 | 147 |
| 3 | 3300025933 | Ga0207706_10075649 | Ga0207706_100756491 | 147 |
| 4 | iso_pu_bacteria | 2786546940 | 2788434762 | 147 |
| 5 | iso_pu_bacteria | 2919450847 | 2919455402 | 147 |
| 6 | 3300006846 | Ga0075430_100139716 | Ga0075430_1001397162 | 148 |
| 7 | 3300006847 | Ga0075431_100142684 | Ga0075431_1001426842 | 148 |
| 8 | 3300032005 | Ga0307411_10789687 | Ga0307411_107896872 | 148 |
| 9 | 3300037853 | Ga0436364_1347693 | Ga0436364_1347693_204_662 | 148 |
| 10 | 3300042134 | Ga0450898_038793 | Ga0450898_038793_138_617 | 148 |
| 11 | 3300042435 | Ga0439434_0171290 | Ga0439434_0171290_153_632 | 148 |
| 12 | 3300042530 | Ga0450916_038562 | Ga0450916_038562_27_506 | 148 |
| 13 | 3300046524 | Ga0495648_0131506 | Ga0495648_0131506_361_840 | 148 |
| 14 | 3300046538 | Ga0495609_0039159 | Ga0495609_0039159_763_1242 | 148 |
| 15 | 3300046542 | Ga0495597_0015635 | Ga0495597_0015635_525_1004 | 148 |
| 16 | 3300046681 | Ga0495647_0398115 | Ga0495647_0398115_31_489 | 148 |
| 17 | 3300047470 | Ga0495681_0063444 | Ga0495681_0063444_1166_1645 | 148 |
| 18 | 3300048091 | Ga0495626_0016415 | Ga0495626_0016415_3180_3659 | 148 |
| 19 | 3300049569 | Ga0501032_0001213 | Ga0501032_0001213_1364_1825 | 148 |
| 20 | 3300049572 | Ga0501036_0791629 | Ga0501036_0791629_195_656 | 148 |
| 21 | 3300049572 | Ga0501036_1179783 | Ga0501036_1179783_98_559 | 148 |
| 22 | 3300049573 | Ga0501037_0030523 | Ga0501037_0030523_3011_3472 | 148 |
| 23 | 3300049579 | Ga0501043_0105330 | Ga0501043_0105330_1532_1993 | 148 |
| 24 | 3300049583 | Ga0501067_0000546 | Ga0501067_0000546_9166_9627 | 148 |
| 25 | 3300049588 | Ga0501072_0153559 | Ga0501072_0153559_1292_1753 | 148 |
| 26 | 3300049589 | Ga0501073_0000004 | Ga0501073_0000004_86804_87265 | 148 |
| 27 | 3300049593 | Ga0501077_0000008 | Ga0501077_0000008_67989_68450 | 148 |
| 28 | 3300049742 | Ga0501080_0065118 | Ga0501080_0065118_835_1296 | 148 |
| 29 | 3300049744 | Ga0501083_0286745 | Ga0501083_0286745_462_923 | 148 |
| 30 | 3300049823 | Ga0501044_0050528 | Ga0501044_0050528_667_1128 | 148 |
| 31 | 3300050509 | nmdc:mga0qj67_118310_c1 | nmdc:mga0qj67_118310_c1_209_685 | 148 |
| 32 | 3300050510 | nmdc:mga06r32_156416_c1 | nmdc:mga06r32_156416_c1_876_1352 | 148 |
| 33 | 3300060353 | Ga0501082_0102568 | Ga0501082_0102568_821_1282 | 148 |
| 34 | 3300021377 | Ga0213874_10017392 | Ga0213874_100173922 | 149 |
| 35 | 3300039438 | Ga0436360_1344670 | Ga0436360_1344670_1281_1766 | 149 |
| 36 | 3300039447 | Ga0436361_1179158 | Ga0436361_1179158_2747_3232 | 149 |
| 37 | 3300039450 | Ga0436363_1318239 | Ga0436363_1318239_858_1343 | 149 |
| 38 | 3300039453 | Ga0436362_1208409 | Ga0436362_1208409_167_652 | 149 |
| 39 | 3300046528 | Ga0495642_0271760 | Ga0495642_0271760_181_669 | 149 |
| 40 | 3300047445 | Ga0495677_0225374 | Ga0495677_0225374_76_564 | 149 |
| 41 | iso_pu_bacteria | 2894510363 | 2894513719 | 149 |
| 42 | 3300003322 | rootL2_10033961 | rootL2_100339617 | 150 |
| 43 | 3300003323 | rootH1_10014934 | rootH1_1001493415 | 150 |
| 44 | 3300003659 | JGI25404J52841_10009761 | JGI25404J52841_100097612 | 150 |
| 45 | 3300005983 | Ga0081540_1005479 | Ga0081540_10054793 | 150 |
| 46 | 3300005983 | Ga0081540_1031094 | Ga0081540_10310942 | 150 |
| 47 | 3300005983 | Ga0081540_1053744 | Ga0081540_10537442 | 150 |
| 48 | 3300006852 | Ga0075433_10068524 | Ga0075433_100685242 | 150 |
| 49 | 3300010159 | Ga0099796_10024787 | Ga0099796_100247872 | 150 |
| 50 | 3300021358 | Ga0213873_10000314 | Ga0213873_100003143 | 150 |
| 51 | 3300021361 | Ga0213872_10017536 | Ga0213872_100175362 | 150 |
| 52 | 3300021361 | Ga0213872_10067832 | Ga0213872_100678322 | 150 |
| 53 | 3300021441 | Ga0213871_10050474 | Ga0213871_100504741 | 150 |
| 54 | 3300025295 | Ga0209564_1027065 | Ga0209564_10270652 | 150 |
| 55 | 3300025898 | Ga0207692_10000427 | Ga0207692_100004277 | 150 |
| 56 | 3300025906 | Ga0207699_10000213 | Ga0207699_1000021326 | 150 |
| 57 | 3300025915 | Ga0207693_10010945 | Ga0207693_100109456 | 150 |
| 58 | 3300025916 | Ga0207663_10012297 | Ga0207663_100122975 | 150 |
| 59 | 3300025928 | Ga0207700_10099356 | Ga0207700_100993562 | 150 |
| 60 | 3300025929 | Ga0207664_10003422 | Ga0207664_100034222 | 150 |
| 61 | 3300025939 | Ga0207665_10010201 | Ga0207665_100102013 | 150 |
| 62 | 3300026142 | Ga0207698_10542118 | Ga0207698_105421182 | 150 |
| 63 | 3300027907 | Ga0207428_10141857 | Ga0207428_101418572 | 150 |
| 64 | 3300028558 | Ga0265326_10015744 | Ga0265326_100157442 | 150 |
| 65 | 3300028563 | Ga0265319_1011749 | Ga0265319_10117492 | 150 |
| 66 | 3300028573 | Ga0265334_10005729 | Ga0265334_100057292 | 150 |
| 67 | 3300028577 | Ga0265318_10001158 | Ga0265318_100011588 | 150 |
| 68 | 3300028800 | Ga0265338_10082599 | Ga0265338_100825992 | 150 |
| 69 | 3300031235 | Ga0265330_10003624 | Ga0265330_100036244 | 150 |
| 70 | 3300031238 | Ga0265332_10036124 | Ga0265332_100361242 | 150 |
| 71 | 3300031239 | Ga0265328_10006874 | Ga0265328_100068744 | 150 |
| 72 | 3300031241 | Ga0265325_10004359 | Ga0265325_100043593 | 150 |
| 73 | 3300031242 | Ga0265329_10001559 | Ga0265329_100015596 | 150 |
| 74 | 3300031247 | Ga0265340_10007496 | Ga0265340_100074962 | 150 |
| 75 | 3300031250 | Ga0265331_10004592 | Ga0265331_100045923 | 150 |
| 76 | 3300031344 | Ga0265316_10006913 | Ga0265316_100069135 | 150 |
| 77 | 3300031595 | Ga0265313_10006776 | Ga0265313_100067768 | 150 |
| 78 | 3300031711 | Ga0265314_10010603 | Ga0265314_100106035 | 150 |
| 79 | 3300031712 | Ga0265342_10003518 | Ga0265342_100035185 | 150 |
| 80 | 3300039438 | Ga0436360_0192702 | Ga0436360_0192702_7722_8195 | 150 |
| 81 | 3300039438 | Ga0436360_1059052 | Ga0436360_1059052_332_805 | 150 |
| 82 | 3300039447 | Ga0436361_0090190 | Ga0436361_0090190_141_614 | 150 |
| 83 | 3300039447 | Ga0436361_0900803 | Ga0436361_0900803_796_1269 | 150 |
| 84 | 3300039447 | Ga0436361_0900950 | Ga0436361_0900950_1257_1730 | 150 |
| 85 | 3300039453 | Ga0436362_0105480 | Ga0436362_0105480_2737_3210 | 150 |
| 86 | 3300041486 | Ga0451807_1825705 | Ga0451807_1825705_79_546 | 150 |
| 87 | 3300046459 | Ga0495629_0176785 | Ga0495629_0176785_388_855 | 150 |
| 88 | 3300046499 | Ga0495594_0382315 | Ga0495594_0382315_155_622 | 150 |
| 89 | 3300046515 | Ga0495620_0027451 | Ga0495620_0027451_436_903 | 150 |
| 90 | 3300046522 | Ga0495643_0006921 | Ga0495643_0006921_3639_4106 | 150 |
| 91 | 3300046524 | Ga0495648_0414226 | Ga0495648_0414226_18_485 | 150 |
| 92 | 3300046530 | Ga0495654_0070660 | Ga0495654_0070660_285_752 | 150 |
| 93 | 3300046538 | Ga0495609_0019944 | Ga0495609_0019944_261_728 | 150 |
| 94 | 3300046542 | Ga0495597_0011191 | Ga0495597_0011191_2549_3016 | 150 |
| 95 | 3300046557 | Ga0495622_0000742 | Ga0495622_0000742_8593_9060 | 150 |
| 96 | 3300046648 | Ga0495611_0260891 | Ga0495611_0260891_226_690 | 150 |
| 97 | 3300046648 | Ga0495611_0353789 | Ga0495611_0353789_136_603 | 150 |
| 98 | 3300046660 | Ga0495625_0101921 | Ga0495625_0101921_1134_1601 | 150 |
| 99 | 3300047320 | Ga0495672_0000630 | Ga0495672_0000630_15235_15699 | 150 |
| 100 | 3300047443 | Ga0495687_069531 | Ga0495687_069531_52_519 | 150 |
| 101 | 3300047446 | Ga0495679_009921 | Ga0495679_009921_99_563 | 150 |
| 102 | 3300048089 | Ga0495614_0336647 | Ga0495614_0336647_153_620 | 150 |
| 103 | 3300048928 | Ga0496125_0025606 | Ga0496125_0025606_3759_4223 | 150 |
| 104 | 3300049460 | Ga0495682_0124141 | Ga0495682_0124141_203_670 | 150 |
| 105 | 3300050507 | nmdc:mga05p37_98070_c1 | nmdc:mga05p37_98070_c1_2171_2635 | 150 |
| 106 | 3300050508 | nmdc:mga09592_166276_c1 | nmdc:mga09592_166276_c1_539_1003 | 150 |
| 107 | 3300050509 | nmdc:mga0qj67_166645_c1 | nmdc:mga0qj67_166645_c1_657_1121 | 150 |
| 108 | 3300050510 | nmdc:mga06r32_43798_c1 | nmdc:mga06r32_43798_c1_3285_3749 | 150 |
| 109 | 3300050515 | nmdc:mga0a205_201001_c1 | nmdc:mga0a205_201001_c1_65_529 | 150 |
| 110 | 3300053080 | Ga0500635_0000080 | Ga0500635_0000080_27607_28074 | 150 |
| 111 | 3300053086 | Ga0500578_0155143 | Ga0500578_0155143_891_1358 | 150 |
| 112 | 3300053087 | Ga0500643_000276 | Ga0500643_000276_8839_9303 | 150 |
| 113 | 3300053091 | Ga0500647_0229388 | Ga0500647_0229388_137_604 | 150 |
| 114 | 3300053092 | Ga0500583_0051768 | Ga0500583_0051768_292_759 | 150 |
| 115 | 3300053094 | Ga0500566_0095711 | Ga0500566_0095711_999_1466 | 150 |
| 116 | 3300053104 | Ga0500556_0001835 | Ga0500556_0001835_5720_6184 | 150 |
| 117 | 3300053109 | Ga0500569_002128 | Ga0500569_002128_2554_3021 | 150 |
| 118 | 3300053119 | Ga0500595_006120 | Ga0500595_006120_4327_4794 | 150 |
| 119 | 3300053120 | Ga0500597_184228 | Ga0500597_184228_246_713 | 150 |
| 120 | 3300053121 | Ga0500607_198653 | Ga0500607_198653_384_851 | 150 |
| 121 | 3300053122 | Ga0500608_060472 | Ga0500608_060472_981_1448 | 150 |
| 122 | 3300053123 | Ga0500614_002135 | Ga0500614_002135_282_749 | 150 |
| 123 | 3300053125 | Ga0500618_000024 | Ga0500618_000024_58142_58606 | 150 |
| 124 | 3300053130 | Ga0500642_0042020 | Ga0500642_0042020_335_802 | 150 |
| 125 | 3300053136 | Ga0500559_0003697 | Ga0500559_0003697_4310_4774 | 150 |
| 126 | 3300053136 | Ga0500559_0013894 | Ga0500559_0013894_2691_3155 | 150 |
| 127 | 3300053136 | Ga0500559_0155332 | Ga0500559_0155332_343_810 | 150 |
| 128 | 3300053142 | Ga0500577_0325912 | Ga0500577_0325912_147_614 | 150 |
| 129 | 3300053148 | Ga0500590_011497 | Ga0500590_011497_285_752 | 150 |
| 130 | 3300053154 | Ga0500619_109727 | Ga0500619_109727_442_909 | 150 |
| 131 | 3300053162 | Ga0500638_205536 | Ga0500638_205536_267_734 | 150 |
| 132 | 3300053177 | Ga0500636_0005352 | Ga0500636_0005352_396_863 | 150 |
| 133 | 3300053177 | Ga0500636_0093513 | Ga0500636_0093513_126_593 | 150 |
| 134 | 3300053178 | Ga0500637_0032253 | Ga0500637_0032253_423_890 | 150 |
| 135 | 3300053729 | Ga0500625_072625 | Ga0500625_072625_180_647 | 150 |
| 136 | 3300053735 | Ga0500596_000241 | Ga0500596_000241_4933_5400 | 150 |
| 137 | 3300053737 | Ga0500601_015292 | Ga0500601_015292_209_676 | 150 |
| 138 | 3300055283 | Ga0500661_000098 | Ga0500661_000098_6131_6595 | 150 |
| 139 | iso_pu_bacteria | 2643221583 | 2643923250 | 150 |
| 140 | iso_pu_bacteria | 2884960567 | 2884962571 | 150 |
| 141 | 3300003322 | rootL2_10110047 | rootL2_101100473 | 151 |
| 142 | 3300004799 | Ga0058863_10032759 | Ga0058863_100327591 | 151 |
| 143 | 3300004800 | Ga0058861_10029376 | Ga0058861_100293761 | 151 |
| 144 | 3300004803 | Ga0058862_12650850 | Ga0058862_126508502 | 151 |
| 145 | 3300004803 | Ga0058862_12859001 | Ga0058862_128590012 | 151 |
| 146 | 3300005329 | Ga0070683_100012825 | Ga0070683_1000128252 | 151 |
| 147 | 3300005329 | Ga0070683_100056927 | Ga0070683_1000569272 | 151 |
| 148 | 3300005329 | Ga0070683_100270691 | Ga0070683_1002706912 | 151 |
| 149 | 3300005329 | Ga0070683_100859276 | Ga0070683_1008592762 | 151 |
| 150 | 3300005330 | Ga0070690_100149200 | Ga0070690_1001492002 | 151 |
| 151 | 3300005334 | Ga0068869_101024647 | Ga0068869_1010246471 | 151 |
| 152 | 3300005336 | Ga0070680_100126717 | Ga0070680_1001267172 | 151 |
| 153 | 3300005336 | Ga0070680_100580343 | Ga0070680_1005803431 | 151 |
| 154 | 3300005336 | Ga0070680_101512936 | Ga0070680_1015129361 | 151 |
| 155 | 3300005340 | Ga0070689_100127275 | Ga0070689_1001272752 | 151 |
| 156 | 3300005340 | Ga0070689_101849991 | Ga0070689_1018499911 | 151 |
| 157 | 3300005343 | Ga0070687_100813852 | Ga0070687_1008138521 | 151 |
| 158 | 3300005344 | Ga0070661_100870557 | Ga0070661_1008705571 | 151 |
| 159 | 3300005347 | Ga0070668_100944767 | Ga0070668_1009447672 | 151 |
| 160 | 3300005356 | Ga0070674_101265397 | Ga0070674_1012653971 | 151 |
| 161 | 3300005364 | Ga0070673_100007403 | Ga0070673_1000074034 | 151 |
| 162 | 3300005364 | Ga0070673_100623859 | Ga0070673_1006238592 | 151 |
| 163 | 3300005365 | Ga0070688_100009049 | Ga0070688_1000090493 | 151 |
| 164 | 3300005367 | Ga0070667_100227566 | Ga0070667_1002275663 | 151 |
| 165 | 3300005434 | Ga0070709_10010971 | Ga0070709_100109712 | 151 |
| 166 | 3300005435 | Ga0070714_100111402 | Ga0070714_1001114022 | 151 |
| 167 | 3300005445 | Ga0070708_100000494 | Ga0070708_1000004948 | 151 |
| 168 | 3300005445 | Ga0070708_100664938 | Ga0070708_1006649382 | 151 |
| 169 | 3300005456 | Ga0070678_101008026 | Ga0070678_1010080261 | 151 |
| 170 | 3300005458 | Ga0070681_10004438 | Ga0070681_100044387 | 151 |
| 171 | 3300005458 | Ga0070681_10029352 | Ga0070681_100293525 | 151 |
| 172 | 3300005466 | Ga0070685_10621407 | Ga0070685_106214071 | 151 |
| 173 | 3300005467 | Ga0070706_100197676 | Ga0070706_1001976761 | 151 |
| 174 | 3300005530 | Ga0070679_100001857 | Ga0070679_1000018572 | 151 |
| 175 | 3300005530 | Ga0070679_100004565 | Ga0070679_1000045657 | 151 |
| 176 | 3300005530 | Ga0070679_100024072 | Ga0070679_1000240721 | 151 |
| 177 | 3300005530 | Ga0070679_100581990 | Ga0070679_1005819902 | 151 |
| 178 | 3300005535 | Ga0070684_100069700 | Ga0070684_1000697002 | 151 |
| 179 | 3300005535 | Ga0070684_100193321 | Ga0070684_1001933212 | 151 |
| 180 | 3300005535 | Ga0070684_100243311 | Ga0070684_1002433112 | 151 |
| 181 | 3300005535 | Ga0070684_100255050 | Ga0070684_1002550502 | 151 |
| 182 | 3300005535 | Ga0070684_100506800 | Ga0070684_1005068002 | 151 |
| 183 | 3300005546 | Ga0070696_100000289 | Ga0070696_10000028926 | 151 |
| 184 | 3300005548 | Ga0070665_100068008 | Ga0070665_1000680081 | 151 |
| 185 | 3300005548 | Ga0070665_100358276 | Ga0070665_1003582761 | 151 |
| 186 | 3300005564 | Ga0070664_100086790 | Ga0070664_1000867902 | 151 |
| 187 | 3300005564 | Ga0070664_100654097 | Ga0070664_1006540972 | 151 |
| 188 | 3300005614 | Ga0068856_100121434 | Ga0068856_1001214343 | 151 |
| 189 | 3300005614 | Ga0068856_101403008 | Ga0068856_1014030082 | 151 |
| 190 | 3300005615 | Ga0070702_100541827 | Ga0070702_1005418272 | 151 |
| 191 | 3300005617 | Ga0068859_101216077 | Ga0068859_1012160771 | 151 |
| 192 | 3300005718 | Ga0068866_10863047 | Ga0068866_108630471 | 151 |
| 193 | 3300006173 | Ga0070716_100097312 | Ga0070716_1000973124 | 151 |
| 194 | 3300006237 | Ga0097621_100762020 | Ga0097621_1007620202 | 151 |
| 195 | 3300006881 | Ga0068865_100214398 | Ga0068865_1002143982 | 151 |
| 196 | 3300006931 | Ga0097620_101216076 | Ga0097620_1012160761 | 151 |
| 197 | 3300009098 | Ga0105245_10306877 | Ga0105245_103068772 | 151 |
| 198 | 3300009148 | Ga0105243_10761868 | Ga0105243_107618681 | 151 |
| 199 | 3300009174 | Ga0105241_11547553 | Ga0105241_115475531 | 151 |
| 200 | 3300009176 | Ga0105242_10296316 | Ga0105242_102963162 | 151 |
| 201 | 3300009176 | Ga0105242_10334988 | Ga0105242_103349881 | 151 |
| 202 | 3300009177 | Ga0105248_10730201 | Ga0105248_107302011 | 151 |
| 203 | 3300009545 | Ga0105237_10262707 | Ga0105237_102627072 | 151 |
| 204 | 3300010375 | Ga0105239_11681939 | Ga0105239_116819391 | 151 |
| 205 | 3300011119 | Ga0105246_10133341 | Ga0105246_101333412 | 151 |
| 206 | 3300013100 | Ga0157373_10312598 | Ga0157373_103125982 | 151 |
| 207 | 3300013104 | Ga0157370_10086558 | Ga0157370_100865582 | 151 |
| 208 | 3300013104 | Ga0157370_10098753 | Ga0157370_100987532 | 151 |
| 209 | 3300013104 | Ga0157370_10848312 | Ga0157370_108483121 | 151 |
| 210 | 3300013105 | Ga0157369_10234203 | Ga0157369_102342032 | 151 |
| 211 | 3300013105 | Ga0157369_10598761 | Ga0157369_105987612 | 151 |
| 212 | 3300013105 | Ga0157369_11605615 | Ga0157369_116056152 | 151 |
| 213 | 3300013296 | Ga0157374_10721824 | Ga0157374_107218242 | 151 |
| 214 | 3300013297 | Ga0157378_11819558 | Ga0157378_118195581 | 151 |
| 215 | 3300013297 | Ga0157378_12591636 | Ga0157378_125916361 | 151 |
| 216 | 3300013307 | Ga0157372_10003395 | Ga0157372_1000339513 | 151 |
| 217 | 3300013307 | Ga0157372_10022621 | Ga0157372_100226216 | 151 |
| 218 | 3300013307 | Ga0157372_10342487 | Ga0157372_103424873 | 151 |
| 219 | 3300013307 | Ga0157372_10865043 | Ga0157372_108650431 | 151 |
| 220 | 3300013307 | Ga0157372_10922411 | Ga0157372_109224112 | 151 |
| 221 | 3300013308 | Ga0157375_10173212 | Ga0157375_101732122 | 151 |
| 222 | 3300013308 | Ga0157375_10544698 | Ga0157375_105446982 | 151 |
| 223 | 3300014325 | Ga0163163_10853720 | Ga0163163_108537202 | 151 |
| 224 | 3300014326 | Ga0157380_10392505 | Ga0157380_103925052 | 151 |
| 225 | 3300014969 | Ga0157376_10357491 | Ga0157376_103574912 | 151 |
| 226 | 3300015262 | Ga0182007_10162035 | Ga0182007_101620351 | 151 |
| 227 | 3300021384 | Ga0213876_10022155 | Ga0213876_100221555 | 151 |
| 228 | 3300025899 | Ga0207642_10527748 | Ga0207642_105277482 | 151 |
| 229 | 3300025904 | Ga0207647_10170765 | Ga0207647_101707651 | 151 |
| 230 | 3300025907 | Ga0207645_10150291 | Ga0207645_101502912 | 151 |
| 231 | 3300025912 | Ga0207707_10009363 | Ga0207707_100093637 | 151 |
| 232 | 3300025912 | Ga0207707_10025736 | Ga0207707_100257363 | 151 |
| 233 | 3300025912 | Ga0207707_10697642 | Ga0207707_106976422 | 151 |
| 234 | 3300025913 | Ga0207695_10101967 | Ga0207695_101019673 | 151 |
| 235 | 3300025917 | Ga0207660_10139369 | Ga0207660_101393692 | 151 |
| 236 | 3300025918 | Ga0207662_10262666 | Ga0207662_102626662 | 151 |
| 237 | 3300025921 | Ga0207652_10005321 | Ga0207652_100053219 | 151 |
| 238 | 3300025921 | Ga0207652_10006050 | Ga0207652_100060508 | 151 |
| 239 | 3300025921 | Ga0207652_10049728 | Ga0207652_100497283 | 151 |
| 240 | 3300025921 | Ga0207652_10232723 | Ga0207652_102327232 | 151 |
| 241 | 3300025921 | Ga0207652_10321451 | Ga0207652_103214512 | 151 |
| 242 | 3300025922 | Ga0207646_11666326 | Ga0207646_116663261 | 151 |
| 243 | 3300025925 | Ga0207650_10674122 | Ga0207650_106741222 | 151 |
| 244 | 3300025926 | Ga0207659_10302257 | Ga0207659_103022572 | 151 |
| 245 | 3300025931 | Ga0207644_10745297 | Ga0207644_107452972 | 151 |
| 246 | 3300025931 | Ga0207644_11637912 | Ga0207644_116379121 | 151 |
| 247 | 3300025932 | Ga0207690_10973395 | Ga0207690_109733951 | 151 |
| 248 | 3300025934 | Ga0207686_10116904 | Ga0207686_101169042 | 151 |
| 249 | 3300025936 | Ga0207670_10100351 | Ga0207670_101003512 | 151 |
| 250 | 3300025939 | Ga0207665_10242088 | Ga0207665_102420882 | 151 |
| 251 | 3300025942 | Ga0207689_10216700 | Ga0207689_102167002 | 151 |
| 252 | 3300025944 | Ga0207661_10005343 | Ga0207661_100053432 | 151 |
| 253 | 3300025944 | Ga0207661_10014967 | Ga0207661_100149672 | 151 |
| 254 | 3300025944 | Ga0207661_10122822 | Ga0207661_101228222 | 151 |
| 255 | 3300025944 | Ga0207661_10379229 | Ga0207661_103792292 | 151 |
| 256 | 3300025944 | Ga0207661_10515401 | Ga0207661_105154012 | 151 |
| 257 | 3300025945 | Ga0207679_10818004 | Ga0207679_108180042 | 151 |
| 258 | 3300025960 | Ga0207651_10170950 | Ga0207651_101709502 | 151 |
| 259 | 3300025972 | Ga0207668_10331808 | Ga0207668_103318082 | 151 |
| 260 | 3300025972 | Ga0207668_11299626 | Ga0207668_112996261 | 151 |
| 261 | 3300026078 | Ga0207702_10410800 | Ga0207702_104108002 | 151 |
| 262 | 3300026089 | Ga0207648_10082795 | Ga0207648_100827952 | 151 |
| 263 | 3300026095 | Ga0207676_10369896 | Ga0207676_103698962 | 151 |
| 264 | 3300026116 | Ga0207674_10161318 | Ga0207674_101613182 | 151 |
| 265 | 3300026121 | Ga0207683_10292987 | Ga0207683_102929872 | 151 |
| 266 | 3300028379 | Ga0268266_10047169 | Ga0268266_100471693 | 151 |
| 267 | 3300028379 | Ga0268266_10266276 | Ga0268266_102662761 | 151 |
| 268 | 3300028556 | Ga0265337_1030410 | Ga0265337_10304102 | 151 |
| 269 | 3300028563 | Ga0265319_1001014 | Ga0265319_10010142 | 151 |
| 270 | 3300028563 | Ga0265319_1002881 | Ga0265319_10028813 | 151 |
| 271 | 3300028563 | Ga0265319_1049898 | Ga0265319_10498982 | 151 |
| 272 | 3300028573 | Ga0265334_10010638 | Ga0265334_100106383 | 151 |
| 273 | 3300028577 | Ga0265318_10002409 | Ga0265318_100024095 | 151 |
| 274 | 3300028577 | Ga0265318_10005763 | Ga0265318_100057632 | 151 |
| 275 | 3300028654 | Ga0265322_10031570 | Ga0265322_100315702 | 151 |
| 276 | 3300028800 | Ga0265338_10007620 | Ga0265338_100076206 | 151 |
| 277 | 3300028800 | Ga0265338_10086852 | Ga0265338_100868522 | 151 |
| 278 | 3300031238 | Ga0265332_10216163 | Ga0265332_102161631 | 151 |
| 279 | 3300031239 | Ga0265328_10031108 | Ga0265328_100311082 | 151 |
| 280 | 3300031239 | Ga0265328_10078547 | Ga0265328_100785472 | 151 |
| 281 | 3300031240 | Ga0265320_10000575 | Ga0265320_1000057515 | 151 |
| 282 | 3300031240 | Ga0265320_10011301 | Ga0265320_100113015 | 151 |
| 283 | 3300031240 | Ga0265320_10024753 | Ga0265320_100247531 | 151 |
| 284 | 3300031240 | Ga0265320_10096682 | Ga0265320_100966821 | 151 |
| 285 | 3300031247 | Ga0265340_10035080 | Ga0265340_100350802 | 151 |
| 286 | 3300031249 | Ga0265339_10068859 | Ga0265339_100688592 | 151 |
| 287 | 3300031250 | Ga0265331_10096038 | Ga0265331_100960382 | 151 |
| 288 | 3300031344 | Ga0265316_10060798 | Ga0265316_100607982 | 151 |
| 289 | 3300031344 | Ga0265316_10098940 | Ga0265316_100989402 | 151 |
| 290 | 3300031344 | Ga0265316_10186991 | Ga0265316_101869912 | 151 |
| 291 | 3300031595 | Ga0265313_10001119 | Ga0265313_100011195 | 151 |
| 292 | 3300031595 | Ga0265313_10003063 | Ga0265313_100030632 | 151 |
| 293 | 3300031595 | Ga0265313_10004776 | Ga0265313_100047767 | 151 |
| 294 | 3300031595 | Ga0265313_10021622 | Ga0265313_100216222 | 151 |
| 295 | 3300031711 | Ga0265314_10521630 | Ga0265314_105216301 | 151 |
| 296 | 3300031712 | Ga0265342_10014230 | Ga0265342_100142306 | 151 |
| 297 | 3300031712 | Ga0265342_10086331 | Ga0265342_100863312 | 151 |
| 298 | 3300031712 | Ga0265342_10088050 | Ga0265342_100880502 | 151 |
| 299 | 3300031995 | Ga0307409_100656861 | Ga0307409_1006568612 | 151 |
| 300 | 3300032002 | Ga0307416_101194964 | Ga0307416_1011949642 | 151 |
| 301 | 3300035083 | Ga0373926_0124741 | Ga0373926_0124741_329_820 | 151 |
| 302 | 3300035086 | Ga0373934_0044387 | Ga0373934_0044387_82_573 | 151 |
| 303 | 3300035111 | Ga0373923_0003560 | Ga0373923_0003560_3524_4015 | 151 |
| 304 | 3300035111 | Ga0373923_0184696 | Ga0373923_0184696_95_586 | 151 |
| 305 | 3300035116 | Ga0373945_0500040 | Ga0373945_0500040_25_516 | 151 |
| 306 | 3300035118 | Ga0373954_0061835 | Ga0373954_0061835_790_1281 | 151 |
| 307 | 3300035119 | Ga0373956_0004997 | Ga0373956_0004997_2651_3142 | 151 |
| 308 | 3300035119 | Ga0373956_0022145 | Ga0373956_0022145_1913_2404 | 151 |
| 309 | 3300035172 | Ga0373955_0001186 | Ga0373955_0001186_7297_7788 | 151 |
| 310 | 3300035172 | Ga0373955_0007825 | Ga0373955_0007825_3212_3703 | 151 |
| 311 | 3300035410 | Ga0373924_0000442 | Ga0373924_0000442_12052_12543 | 151 |
| 312 | 3300035410 | Ga0373924_0089787 | Ga0373924_0089787_466_957 | 151 |
| 313 | 3300035692 | Ga0373935_0058419 | Ga0373935_0058419_701_1192 | 151 |
| 314 | 3300035692 | Ga0373935_1117030 | Ga0373935_1117030_35_526 | 151 |
| 315 | 3300035695 | Ga0373927_0215547 | Ga0373927_0215547_577_1068 | 151 |
| 316 | 3300035724 | Ga0373933_0000501 | Ga0373933_0000501_18162_18653 | 151 |
| 317 | 3300035724 | Ga0373933_0027715 | Ga0373933_0027715_940_1431 | 151 |
| 318 | 3300035725 | Ga0373947_0096074 | Ga0373947_0096074_1243_1734 | 151 |
| 319 | 3300035725 | Ga0373947_0565618 | Ga0373947_0565618_212_703 | 151 |
| 320 | 3300036401 | Ga0373937_0000649 | Ga0373937_0000649_5028_5519 | 151 |
| 321 | 3300036401 | Ga0373937_0006774 | Ga0373937_0006774_4121_4612 | 151 |
| 322 | 3300037068 | Ga0373925_0121458 | Ga0373925_0121458_428_919 | 151 |
| 323 | 3300039437 | Ga0436365_0003491 | Ga0436365_0003491_3240_3731 | 151 |
| 324 | 3300039437 | Ga0436365_1926543 | Ga0436365_1926543_1013_1504 | 151 |
| 325 | 3300044842 | Ga0466957_0383343 | Ga0466957_0383343_102_578 | 151 |
| 326 | 3300045976 | Ga0466967_0892437 | Ga0466967_0892437_94_582 | 151 |
| 327 | 3300046459 | Ga0495629_0039594 | Ga0495629_0039594_383_874 | 151 |
| 328 | 3300046459 | Ga0495629_0437856 | Ga0495629_0437856_184_675 | 151 |
| 329 | 3300046459 | Ga0495629_0495676 | Ga0495629_0495676_136_627 | 151 |
| 330 | 3300046462 | Ga0495651_0000045 | Ga0495651_0000045_60150_60641 | 151 |
| 331 | 3300046462 | Ga0495651_0116316 | Ga0495651_0116316_754_1245 | 151 |
| 332 | 3300046463 | Ga0495653_0000093 | Ga0495653_0000093_51493_51984 | 151 |
| 333 | 3300046472 | Ga0495580_0156548 | Ga0495580_0156548_295_786 | 151 |
| 334 | 3300046473 | Ga0495582_0019325 | Ga0495582_0019325_1850_2341 | 151 |
| 335 | 3300046475 | Ga0495639_0027462 | Ga0495639_0027462_228_719 | 151 |
| 336 | 3300046475 | Ga0495639_0100441 | Ga0495639_0100441_538_1029 | 151 |
| 337 | 3300046476 | Ga0495662_0117476 | Ga0495662_0117476_142_633 | 151 |
| 338 | 3300046477 | Ga0495664_0063602 | Ga0495664_0063602_858_1349 | 151 |
| 339 | 3300046499 | Ga0495594_0063626 | Ga0495594_0063626_305_796 | 151 |
| 340 | 3300046499 | Ga0495594_0296993 | Ga0495594_0296993_297_788 | 151 |
| 341 | 3300046511 | Ga0495608_0009509 | Ga0495608_0009509_6121_6612 | 151 |
| 342 | 3300046511 | Ga0495608_0224645 | Ga0495608_0224645_362_853 | 151 |
| 343 | 3300046514 | Ga0495618_0034143 | Ga0495618_0034143_2143_2634 | 151 |
| 344 | 3300046514 | Ga0495618_0156092 | Ga0495618_0156092_524_1015 | 151 |
| 345 | 3300046516 | Ga0495628_0000568 | Ga0495628_0000568_746_1237 | 151 |
| 346 | 3300046516 | Ga0495628_0302667 | Ga0495628_0302667_564_1055 | 151 |
| 347 | 3300046517 | Ga0495630_0005102 | Ga0495630_0005102_6191_6682 | 151 |
| 348 | 3300046517 | Ga0495630_0067126 | Ga0495630_0067126_1105_1596 | 151 |
| 349 | 3300046517 | Ga0495630_0485383 | Ga0495630_0485383_111_602 | 151 |
| 350 | 3300046526 | Ga0495666_0026970 | Ga0495666_0026970_863_1354 | 151 |
| 351 | 3300046529 | Ga0495652_0000166 | Ga0495652_0000166_22934_23425 | 151 |
| 352 | 3300046529 | Ga0495652_0085729 | Ga0495652_0085729_803_1294 | 151 |
| 353 | 3300046531 | Ga0495665_0018414 | Ga0495665_0018414_1728_2219 | 151 |
| 354 | 3300046531 | Ga0495665_0100274 | Ga0495665_0100274_900_1391 | 151 |
| 355 | 3300046535 | Ga0495586_0034625 | Ga0495586_0034625_303_794 | 151 |
| 356 | 3300046535 | Ga0495586_0041267 | Ga0495586_0041267_229_720 | 151 |
| 357 | 3300046535 | Ga0495586_0071502 | Ga0495586_0071502_295_786 | 151 |
| 358 | 3300046536 | Ga0495587_0003696 | Ga0495587_0003696_7646_8137 | 151 |
| 359 | 3300046543 | Ga0495645_0000218 | Ga0495645_0000218_13695_14186 | 151 |
| 360 | 3300046543 | Ga0495645_0000833 | Ga0495645_0000833_9778_10269 | 151 |
| 361 | 3300046559 | Ga0495667_0000788 | Ga0495667_0000788_6898_7389 | 151 |
| 362 | 3300046559 | Ga0495667_0031759 | Ga0495667_0031759_1607_2098 | 151 |
| 363 | 3300046642 | Ga0495634_0126343 | Ga0495634_0126343_943_1434 | 151 |
| 364 | 3300046642 | Ga0495634_0147095 | Ga0495634_0147095_957_1448 | 151 |
| 365 | 3300046663 | Ga0495635_0000043 | Ga0495635_0000043_59004_59495 | 151 |
| 366 | 3300046675 | Ga0495657_0000172 | Ga0495657_0000172_27888_28379 | 151 |
| 367 | 3300046678 | Ga0495599_0002832 | Ga0495599_0002832_3391_3882 | 151 |
| 368 | 3300046678 | Ga0495599_0028469 | Ga0495599_0028469_2145_2636 | 151 |
| 369 | 3300046679 | Ga0495623_0000120 | Ga0495623_0000120_22881_23372 | 151 |
| 370 | 3300046679 | Ga0495623_0017600 | Ga0495623_0017600_2626_3117 | 151 |
| 371 | 3300046680 | Ga0495646_0000732 | Ga0495646_0000732_2466_2957 | 151 |
| 372 | 3300046683 | Ga0495658_0278172 | Ga0495658_0278172_233_724 | 151 |
| 373 | 3300046689 | Ga0495613_0012865 | Ga0495613_0012865_2295_2786 | 151 |
| 374 | 3300046689 | Ga0495613_0388303 | Ga0495613_0388303_42_533 | 151 |
| 375 | 3300046809 | Ga0495600_0000093 | Ga0495600_0000093_25558_26049 | 151 |
| 376 | 3300046809 | Ga0495600_0046252 | Ga0495600_0046252_798_1289 | 151 |
| 377 | 3300047315 | Ga0495581_0015761 | Ga0495581_0015761_2293_2784 | 151 |
| 378 | 3300047315 | Ga0495581_0138697 | Ga0495581_0138697_770_1261 | 151 |
| 379 | 3300047315 | Ga0495581_0216599 | Ga0495581_0216599_15_506 | 151 |
| 380 | 3300047315 | Ga0495581_0469207 | Ga0495581_0469207_86_577 | 151 |
| 381 | 3300047317 | Ga0495604_0000166 | Ga0495604_0000166_11233_11724 | 151 |
| 382 | 3300047319 | Ga0495674_0000520 | Ga0495674_0000520_22675_23166 | 151 |
| 383 | 3300047319 | Ga0495674_0005433 | Ga0495674_0005433_11621_12112 | 151 |
| 384 | 3300047319 | Ga0495674_1076488 | Ga0495674_1076488_56_547 | 151 |
| 385 | 3300047320 | Ga0495672_0005815 | Ga0495672_0005815_3114_3605 | 151 |
| 386 | 3300047320 | Ga0495672_0136607 | Ga0495672_0136607_576_1043 | 151 |
| 387 | 3300047322 | Ga0495680_0005857 | Ga0495680_0005857_6270_6761 | 151 |
| 388 | 3300047444 | Ga0495675_0003188 | Ga0495675_0003188_1446_1937 | 151 |
| 389 | 3300047444 | Ga0495675_0007016 | Ga0495675_0007016_332_823 | 151 |
| 390 | 3300047471 | Ga0495684_0000034 | Ga0495684_0000034_53249_53740 | 151 |
| 391 | 3300047471 | Ga0495684_0067224 | Ga0495684_0067224_1957_2448 | 151 |
| 392 | 3300047471 | Ga0495684_0166140 | Ga0495684_0166140_277_768 | 151 |
| 393 | 3300047673 | Ga0495593_0127547 | Ga0495593_0127547_686_1177 | 151 |
| 394 | 3300048088 | Ga0495602_0000684 | Ga0495602_0000684_2696_3187 | 151 |
| 395 | 3300048088 | Ga0495602_0834068 | Ga0495602_0834068_100_591 | 151 |
| 396 | 3300048918 | Ga0496115_1106998 | Ga0496115_1106998_61_552 | 151 |
| 397 | 3300048922 | Ga0496119_0004112 | Ga0496119_0004112_11211_11687 | 151 |
| 398 | 3300048923 | Ga0496120_0243442 | Ga0496120_0243442_327_803 | 151 |
| 399 | 3300049128 | Ga0501308_033133 | Ga0501308_033133_190_669 | 151 |
| 400 | 3300049514 | Ga0501291_029558 | Ga0501291_029558_182_673 | 151 |
| 401 | 3300049586 | Ga0501070_1052507 | Ga0501070_1052507_12_503 | 151 |
| 402 | 3300049667 | Ga0501230_057797 | Ga0501230_057797_230_721 | 151 |
| 403 | 3300049822 | Ga0501035_1091396 | Ga0501035_1091396_20_511 | 151 |
| 404 | 3300049823 | Ga0501044_0773155 | Ga0501044_0773155_175_693 | 151 |
| 405 | 3300053077 | Ga0495601_0043447 | Ga0495601_0043447_239_730 | 151 |
| 406 | 3300053078 | Ga0495612_0000690 | Ga0495612_0000690_10952_11443 | 151 |
| 407 | 3300053103 | Ga0500555_001650 | Ga0500555_001650_6086_6553 | 151 |
| 408 | 3300053139 | Ga0500568_0006998 | Ga0500568_0006998_407_874 | 151 |
| 409 | 3300005329 | Ga0070683_100024987 | Ga0070683_1000249872 | 152 |
| 410 | 3300005329 | Ga0070683_100596360 | Ga0070683_1005963602 | 152 |
| 411 | 3300005331 | Ga0070670_100008411 | Ga0070670_1000084117 | 152 |
| 412 | 3300005335 | Ga0070666_10126744 | Ga0070666_101267442 | 152 |
| 413 | 3300005336 | Ga0070680_100024507 | Ga0070680_1000245073 | 152 |
| 414 | 3300005337 | Ga0070682_100010752 | Ga0070682_1000107522 | 152 |
| 415 | 3300005339 | Ga0070660_100020159 | Ga0070660_1000201594 | 152 |
| 416 | 3300005344 | Ga0070661_100100903 | Ga0070661_1001009032 | 152 |
| 417 | 3300005354 | Ga0070675_100041543 | Ga0070675_1000415432 | 152 |
| 418 | 3300005355 | Ga0070671_100497776 | Ga0070671_1004977761 | 152 |
| 419 | 3300005364 | Ga0070673_100286777 | Ga0070673_1002867772 | 152 |
| 420 | 3300005367 | Ga0070667_100206137 | Ga0070667_1002061372 | 152 |
| 421 | 3300005440 | Ga0070705_100402208 | Ga0070705_1004022082 | 152 |
| 422 | 3300005455 | Ga0070663_100387145 | Ga0070663_1003871452 | 152 |
| 423 | 3300005456 | Ga0070678_100732665 | Ga0070678_1007326652 | 152 |
| 424 | 3300005457 | Ga0070662_100019485 | Ga0070662_1000194854 | 152 |
| 425 | 3300005458 | Ga0070681_10061105 | Ga0070681_100611054 | 152 |
| 426 | 3300005535 | Ga0070684_100047868 | Ga0070684_1000478683 | 152 |
| 427 | 3300005535 | Ga0070684_100103639 | Ga0070684_1001036393 | 152 |
| 428 | 3300005544 | Ga0070686_100142072 | Ga0070686_1001420722 | 152 |
| 429 | 3300005545 | Ga0070695_100064459 | Ga0070695_1000644592 | 152 |
| 430 | 3300005547 | Ga0070693_100006910 | Ga0070693_1000069104 | 152 |
| 431 | 3300005563 | Ga0068855_100187902 | Ga0068855_1001879022 | 152 |
| 432 | 3300005564 | Ga0070664_100074197 | Ga0070664_1000741973 | 152 |
| 433 | 3300005564 | Ga0070664_100827237 | Ga0070664_1008272371 | 152 |
| 434 | 3300005614 | Ga0068856_100079040 | Ga0068856_1000790402 | 152 |
| 435 | 3300005615 | Ga0070702_100008765 | Ga0070702_1000087652 | 152 |
| 436 | 3300005616 | Ga0068852_100080241 | Ga0068852_1000802411 | 152 |
| 437 | 3300005617 | Ga0068859_100024088 | Ga0068859_1000240883 | 152 |
| 438 | 3300005843 | Ga0068860_100020204 | Ga0068860_1000202043 | 152 |
| 439 | 3300006237 | Ga0097621_101054144 | Ga0097621_1010541441 | 152 |
| 440 | 3300006358 | Ga0068871_100182402 | Ga0068871_1001824022 | 152 |
| 441 | 3300006931 | Ga0097620_100024088 | Ga0097620_1000240883 | 152 |
| 442 | 3300007076 | Ga0075435_100506290 | Ga0075435_1005062902 | 152 |
| 443 | 3300009098 | Ga0105245_10014485 | Ga0105245_100144854 | 152 |
| 444 | 3300009148 | Ga0105243_10286293 | Ga0105243_102862932 | 152 |
| 445 | 3300009174 | Ga0105241_10037359 | Ga0105241_100373593 | 152 |
| 446 | 3300009177 | Ga0105248_10021923 | Ga0105248_100219233 | 152 |
| 447 | 3300009177 | Ga0105248_10536658 | Ga0105248_105366581 | 152 |
| 448 | 3300009551 | Ga0105238_12389455 | Ga0105238_123894551 | 152 |
| 449 | 3300010375 | Ga0105239_10687755 | Ga0105239_106877552 | 152 |
| 450 | 3300011119 | Ga0105246_10068452 | Ga0105246_100684523 | 152 |
| 451 | 3300013100 | Ga0157373_10028569 | Ga0157373_100285693 | 152 |
| 452 | 3300013306 | Ga0163162_10539488 | Ga0163162_105394882 | 152 |
| 453 | 3300013308 | Ga0157375_10066711 | Ga0157375_100667114 | 152 |
| 454 | 3300013308 | Ga0157375_11159260 | Ga0157375_111592602 | 152 |
| 455 | 3300014325 | Ga0163163_10041187 | Ga0163163_100411873 | 152 |
| 456 | 3300014325 | Ga0163163_10709289 | Ga0163163_107092892 | 152 |
| 457 | 3300014745 | Ga0157377_10122357 | Ga0157377_101223572 | 152 |
| 458 | 3300014969 | Ga0157376_10018950 | Ga0157376_100189503 | 152 |
| 459 | 3300014969 | Ga0157376_10735482 | Ga0157376_107354822 | 152 |
| 460 | 3300025909 | Ga0207705_10756443 | Ga0207705_107564431 | 152 |
| 461 | 3300025912 | Ga0207707_10061052 | Ga0207707_100610522 | 152 |
| 462 | 3300025917 | Ga0207660_10043349 | Ga0207660_100433492 | 152 |
| 463 | 3300025919 | Ga0207657_10023463 | Ga0207657_100234632 | 152 |
| 464 | 3300025920 | Ga0207649_10018032 | Ga0207649_100180323 | 152 |
| 465 | 3300025927 | Ga0207687_10017035 | Ga0207687_100170352 | 152 |
| 466 | 3300025933 | Ga0207706_10071082 | Ga0207706_100710822 | 152 |
| 467 | 3300025934 | Ga0207686_10102656 | Ga0207686_101026562 | 152 |
| 468 | 3300025941 | Ga0207711_10207961 | Ga0207711_102079612 | 152 |
| 469 | 3300025942 | Ga0207689_10045647 | Ga0207689_100456473 | 152 |
| 470 | 3300025944 | Ga0207661_10249360 | Ga0207661_102493602 | 152 |
| 471 | 3300025944 | Ga0207661_10328323 | Ga0207661_103283231 | 152 |
| 472 | 3300025945 | Ga0207679_10059934 | Ga0207679_100599342 | 152 |
| 473 | 3300025949 | Ga0207667_10080584 | Ga0207667_100805843 | 152 |
| 474 | 3300026067 | Ga0207678_10251262 | Ga0207678_102512622 | 152 |
| 475 | 3300026078 | Ga0207702_10077274 | Ga0207702_100772743 | 152 |
| 476 | 3300026095 | Ga0207676_10123894 | Ga0207676_101238941 | 152 |
| 477 | 3300026116 | Ga0207674_10001931 | Ga0207674_1000193110 | 152 |
| 478 | 3300026121 | Ga0207683_10419960 | Ga0207683_104199602 | 152 |
| 479 | 3300028380 | Ga0268265_11410548 | Ga0268265_114105482 | 152 |
| 480 | 3300028381 | Ga0268264_10377173 | Ga0268264_103771732 | 152 |
| 481 | 3300028666 | Ga0265336_10088368 | Ga0265336_100883681 | 152 |
| 482 | 3300031344 | Ga0265316_10527086 | Ga0265316_105270861 | 152 |
| 483 | 3300035118 | Ga0373954_0107020 | Ga0373954_0107020_521_979 | 152 |
| 484 | 3300035120 | Ga0373957_0135320 | Ga0373957_0135320_373_831 | 152 |
| 485 | 3300035172 | Ga0373955_0033854 | Ga0373955_0033854_540_998 | 152 |
| 486 | 3300035242 | Ga0373962_0193779 | Ga0373962_0193779_177_665 | 152 |
| 487 | 3300035691 | Ga0373931_0029518 | Ga0373931_0029518_414_914 | 152 |
| 488 | 3300036401 | Ga0373937_0428729 | Ga0373937_0428729_65_523 | 152 |
| 489 | 3300042876 | Ga0451577_0002349 | Ga0451577_0002349_12507_12980 | 152 |
| 490 | 3300044712 | Ga0453684_0000534 | Ga0453684_0000534_52897_53370 | 152 |
| 491 | 3300044712 | Ga0453684_0397407 | Ga0453684_0397407_1024_1497 | 152 |
| 492 | 3300046531 | Ga0495665_0654722 | Ga0495665_0654722_41_508 | 152 |
| 493 | 3300048911 | Ga0496108_0450249 | Ga0496108_0450249_515_1009 | 152 |
| 494 | 3300048912 | Ga0496109_0111163 | Ga0496109_0111163_385_879 | 152 |
| 495 | 3300048914 | Ga0496111_1009034 | Ga0496111_1009034_79_573 | 152 |
| 496 | 3300048915 | Ga0496112_0005535 | Ga0496112_0005535_6583_7077 | 152 |
| 497 | 3300048916 | Ga0496113_0050543 | Ga0496113_0050543_1035_1529 | 152 |
| 498 | 3300009553 | Ga0105249_10926245 | Ga0105249_109262452 | 153 |
| 499 | 3300025924 | Ga0207694_10036296 | Ga0207694_100362962 | 153 |
| 500 | 3300028563 | Ga0265319_1001685 | Ga0265319_100168513 | 153 |
| 501 | 3300028577 | Ga0265318_10038052 | Ga0265318_100380522 | 153 |
| 502 | 3300031240 | Ga0265320_10007360 | Ga0265320_100073606 | 153 |
| 503 | 3300031240 | Ga0265320_10014274 | Ga0265320_100142744 | 153 |
| 504 | 3300031250 | Ga0265331_10008083 | Ga0265331_100080832 | 153 |
| 505 | 3300045051 | Ga0451576_0000087 | Ga0451576_0000087_11022_11516 | 153 |
| 506 | 3300045051 | Ga0451576_0006613 | Ga0451576_0006613_3289_3783 | 153 |
| 507 | 3300045051 | Ga0451576_0096701 | Ga0451576_0096701_720_1226 | 153 |
| 508 | 3300046660 | Ga0495625_0032162 | Ga0495625_0032162_1383_1871 | 153 |
| 509 | 3300049569 | Ga0501032_0013091 | Ga0501032_0013091_1881_2405 | 153 |
| 510 | 3300049570 | Ga0501033_0003055 | Ga0501033_0003055_6022_6546 | 153 |
| 511 | 3300049573 | Ga0501037_0021558 | Ga0501037_0021558_1396_1920 | 153 |
| 512 | 3300049579 | Ga0501043_0245453 | Ga0501043_0245453_26_550 | 153 |
| 513 | 3300049580 | Ga0501046_0004848 | Ga0501046_0004848_7626_8150 | 153 |
| 514 | 3300049823 | Ga0501044_0007493 | Ga0501044_0007493_10778_11302 | 153 |
| 515 | 3300006028 | Ga0070717_10334111 | Ga0070717_103341112 | 154 |
| 516 | 3300003322 | rootL2_10031117 | rootL2_100311172 | 155 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.9851 | 1 | 149 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9646 | 1 | 149 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9576 | 1 | 149 |
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.956 | 1 | 149 |
| 1dgj-assembly1.cif.gz_A | crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 | 0.9542 | 2 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.971 | 1 | 73 | 3.10.20.30 |
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9709 | 1 | 75 | 3.10.20.30 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9684 | 83 | 149 | 1.10.150.120 |
| 1sb3F01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9636 | 1 | 75 | 3.10.20.30 |
| 3hrdH02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9617 | 84 | 149 | 1.10.150.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5QJI1-F1-model_v4 | (2Fe-2S)-binding protein | 0.9965 | 1 | 149 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A7V9BKS3-F1-model_v4 | (2Fe-2S)-binding protein | 0.9961 | 1 | 149 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A2G5QP78-F1-model_v4 | (2Fe-2S)-binding protein | 0.9952 | 3 | 149 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A349TGJ4-F1-model_v4 | (2Fe-2S)-binding protein | 0.9952 | 1 | 141 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A7X0JUW7-F1-model_v4 | Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) | 0.9949 | 1 | 149 |
GO:0046872
GO:0047121 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar