F457930

General Info

Members Datasets Scaffolds Average Seq Length
515 261 1030 233

Family's Representative Sequence

Representative Sequence 3300053178|Ga0500637_0013264|Ga0500637_0013264_3303_4070
Length 255
Sequence MAAGSNEKSRPPLMSATAPGADASSAQRQFRYYDFIMAAYVCVLLCANLIGPAKLSTVRVPVFGDVTFLAGVLFFPISYVFGDVLTEVYGYARDRRVVWAGFGALAFASFMAAVVVHLPPATNWKDQSAVDTIFGNTPRIILGSITAFWSGSFVNSYVLAKMKIWTQGRWLWTRTIGSTLCGELVDSAIFYTIAFYGLWPVDQLIAVLFTQYVLKSTWEIVATPLTYKVVGFLKRKESEDFYDRATNFTPFSLKT

Samples

Sample ID Description Type Environment
1 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
256 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
257 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
258 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
259 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
260 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
261 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.58
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0.19
Rhizoplane 4.85
Rhizosphere 84.66
Stem 0
Stem Tuber 0
Unclassified 7.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500637_0013264 3300053178 Bacteria 4317
2 rootH1_10172240 3300003316 Unclassified 1346
3 rootH1_10318854 3300003323 Bacteria 1326
4 Ga0065707_10083043 3300005295 Bacteria 10704
5 Ga0070658_10000547 3300005327 Bacteria 32575
6 Ga0070683_100148294 3300005329 Bacteria 2224
7 Ga0070690_100039753 3300005330 Bacteria 2973
8 Ga0070670_100033604 3300005331 Bacteria 4417
9 Ga0070670_100308222 3300005331 Bacteria 1385
10 Ga0070666_10010472 3300005335 Bacteria 5803
11 Ga0070666_10028306 3300005335 Bacteria 3676
12 Ga0070680_100005294 3300005336 Bacteria 9761
13 Ga0070680_100016607 3300005336 Bacteria 5793
14 Ga0070680_100056162 3300005336 Bacteria 3218
15 Ga0070682_100100571 3300005337 Bacteria 1908
16 Ga0068868_100003004 3300005338 Bacteria 11727
17 Ga0070660_100232638 3300005339 Unclassified 1500
18 Ga0070661_100021618 3300005344 Bacteria 4598
19 Ga0070675_100289231 3300005354 Bacteria 1442
20 Ga0070671_100000199 3300005355 Bacteria 40241
21 Ga0070671_100010893 3300005355 Bacteria 7302
22 Ga0070671_100533157 3300005355 Bacteria 1011
23 Ga0070673_100161018 3300005364 Bacteria 1909
24 Ga0070667_100000069 3300005367 Bacteria 126807
25 Ga0070667_100004680 3300005367 Bacteria 11487
26 Ga0070667_100012032 3300005367 Bacteria 7162
27 Ga0070667_100050279 3300005367 Bacteria 3513
28 Ga0070667_100313066 3300005367 Bacteria 1415
29 Ga0070709_10000986 3300005434 Bacteria 15746
30 Ga0070709_10101605 3300005434 Bacteria 1916
31 Ga0070709_10189511 3300005434 Bacteria 1450
32 Ga0070714_100005208 3300005435 Bacteria 9896
33 Ga0070714_100216354 3300005435 Bacteria 1759
34 Ga0070714_100235041 3300005435 Bacteria 1690
35 Ga0070713_100002662 3300005436 Bacteria 11640
36 Ga0070713_100029679 3300005436 Bacteria 4333
37 Ga0070713_100216741 3300005436 Bacteria 1735
38 Ga0070713_100481725 3300005436 Bacteria 1169
39 Ga0070710_10012975 3300005437 Bacteria 4156
40 Ga0070710_10451029 3300005437 Bacteria 872
41 Ga0070711_100000649 3300005439 Bacteria 18137
42 Ga0070711_100124324 3300005439 Bacteria 1913
43 Ga0070705_100403395 3300005440 Bacteria 1013
44 Ga0070678_100051360 3300005456 Bacteria 2988
45 Ga0070662_100021488 3300005457 Bacteria 4407
46 Ga0070662_100116405 3300005457 Bacteria 2043
47 Ga0070681_10001618 3300005458 Bacteria 20059
48 Ga0070681_10002712 3300005458 Bacteria 16300
49 Ga0070681_10016827 3300005458 Bacteria 7302
50 Ga0070681_10017608 3300005458 Bacteria 7141
51 Ga0070681_10066376 3300005458 Bacteria 3577
52 Ga0070681_10119294 3300005458 Bacteria 2574
53 Ga0070681_10120157 3300005458 Bacteria 2563
54 Ga0070681_10154498 3300005458 Bacteria 2220
55 Ga0070681_10410151 3300005458 Unclassified 1266
56 Ga0070685_10078657 3300005466 Bacteria 1972
57 Ga0070679_100004670 3300005530 Bacteria 12639
58 Ga0070679_100011264 3300005530 Bacteria 8524
59 Ga0070679_100042103 3300005530 Bacteria 4548
60 Ga0070679_100181141 3300005530 Bacteria 2079
61 Ga0070679_100295438 3300005530 Bacteria 1571
62 Ga0070697_100150041 3300005536 Bacteria 1964
63 Ga0068853_100002295 3300005539 Bacteria 14297
64 Ga0068853_100007799 3300005539 Bacteria 8584
65 Ga0068853_100077837 3300005539 Unclassified 2898
66 Ga0068853_100197453 3300005539 Bacteria 1830
67 Ga0068853_100359937 3300005539 Bacteria 1355
68 Ga0070686_100109309 3300005544 Unclassified 1881
69 Ga0070695_100030241 3300005545 Bacteria 3371
70 Ga0070695_100059795 3300005545 Bacteria 2468
71 Ga0070696_100000233 3300005546 Bacteria 33711
72 Ga0070693_100599201 3300005547 Bacteria 795
73 Ga0070665_100002460 3300005548 Bacteria 20415
74 Ga0070665_100012162 3300005548 Bacteria 8677
75 Ga0070665_100138108 3300005548 Bacteria 2440
76 Ga0070665_100238596 3300005548 Bacteria 1819
77 Ga0070665_100596548 3300005548 Bacteria 1117
78 Ga0068855_100000592 3300005563 Bacteria 44394
79 Ga0068855_100004608 3300005563 Bacteria 16829
80 Ga0068855_100220388 3300005563 Bacteria 2128
81 Ga0068855_100301393 3300005563 Bacteria 1775
82 Ga0070664_100002024 3300005564 Bacteria 16250
83 Ga0070664_100013450 3300005564 Bacteria 6664
84 Ga0068857_100034436 3300005577 Bacteria 4480
85 Ga0068857_100321171 3300005577 Bacteria 1430
86 Ga0068854_100105587 3300005578 Bacteria 2118
87 Ga0068856_100046028 3300005614 Bacteria 4297
88 Ga0068852_100341005 3300005616 Bacteria 1460
89 Ga0068852_100432356 3300005616 Bacteria 1300
90 Ga0068852_100443987 3300005616 Bacteria 1283
91 Ga0068859_100002486 3300005617 Bacteria 18754
92 Ga0068859_100063169 3300005617 Bacteria 3734
93 Ga0068859_100072520 3300005617 Bacteria 3480
94 Ga0068859_100385853 3300005617 Bacteria 1496
95 Ga0068864_100079163 3300005618 Bacteria 2877
96 Ga0068864_100308824 3300005618 Bacteria 1482
97 Ga0068864_100423801 3300005618 Bacteria 1268
98 Ga0068866_10007506 3300005718 Bacteria 4567
99 Ga0068861_100430065 3300005719 Bacteria 1178
100 Ga0068851_10360481 3300005834 Bacteria 848
101 Ga0068863_100016434 3300005841 Bacteria 7099
102 Ga0068863_100081510 3300005841 Bacteria 3065
103 Ga0068863_100086151 3300005841 Bacteria 2976
104 Ga0068863_100231147 3300005841 Bacteria 1784
105 Ga0068863_100865186 3300005841 Unclassified 903
106 Ga0068858_100000285 3300005842 Bacteria 54696
107 Ga0068858_100005143 3300005842 Bacteria 12816
108 Ga0068858_100012491 3300005842 Bacteria 8010
109 Ga0068858_100101833 3300005842 Bacteria 2679
110 Ga0068860_100001390 3300005843 Bacteria 26246
111 Ga0068860_100005786 3300005843 Bacteria 12457
112 Ga0068860_100012863 3300005843 Bacteria 8226
113 Ga0068862_100033959 3300005844 Bacteria 4315
114 Ga0068862_100152003 3300005844 Bacteria 2061
115 Ga0068862_100788189 3300005844 Unclassified 927
116 Ga0070715_10000239 3300006163 Bacteria 13132
117 Ga0070716_100014146 3300006173 Bacteria 4083
118 Ga0070716_100015412 3300006173 Bacteria 3927
119 Ga0070716_100129708 3300006173 Bacteria 1592
120 Ga0070712_100000751 3300006175 Bacteria 19153
121 Ga0070712_100054077 3300006175 Bacteria 2805
122 Ga0097621_100244832 3300006237 Unclassified 1568
123 Ga0068871_100128773 3300006358 Bacteria 2144
124 Ga0075434_100207272 3300006871 Bacteria 1981
125 Ga0068865_100033036 3300006881 Bacteria 3462
126 Ga0097620_100002486 3300006931 Bacteria 18754
127 Ga0097620_100063167 3300006931 Bacteria 3734
128 Ga0097620_100072519 3300006931 Bacteria 3480
129 Ga0097620_100385829 3300006931 Bacteria 1496
130 Ga0099795_10011101 3300007788 Bacteria 2678
131 Ga0105251_10007536 3300009011 Bacteria 6686
132 Ga0105250_10154128 3300009092 Unclassified 957
133 Ga0105240_10014082 3300009093 Bacteria 10929
134 Ga0105240_10024226 3300009093 Bacteria 8008
135 Ga0105240_10044583 3300009093 Bacteria 5635
136 Ga0105240_10049421 3300009093 Bacteria 5308
137 Ga0105240_10060987 3300009093 Bacteria 4701
138 Ga0105240_10085366 3300009093 Bacteria 3867
139 Ga0105240_10096276 3300009093 Bacteria 3607
140 Ga0105240_10097222 3300009093 Bacteria 3588
141 Ga0105240_10252307 3300009093 Bacteria 2040
142 Ga0105240_10286210 3300009093 Bacteria 1891
143 Ga0105240_11000919 3300009093 Bacteria 894
144 Ga0105245_10017497 3300009098 Bacteria 6254
145 Ga0105247_10000072 3300009101 Bacteria 113959
146 Ga0105247_10010957 3300009101 Bacteria 5474
147 Ga0105247_10072899 3300009101 Bacteria 2150
148 Ga0105247_10167367 3300009101 Bacteria 1459
149 Ga0105241_10004905 3300009174 Bacteria 9868
150 Ga0105241_10162684 3300009174 Bacteria 1836
151 Ga0105241_10758046 3300009174 Bacteria 891
152 Ga0105242_10001357 3300009176 Bacteria 19306
153 Ga0105242_10044453 3300009176 Bacteria 3598
154 Ga0105248_10024681 3300009177 Bacteria 6685
155 Ga0105248_10156395 3300009177 Bacteria 2573
156 Ga0105248_10283034 3300009177 Bacteria 1867
157 Ga0105237_10041800 3300009545 Bacteria 4622
158 Ga0105237_10055385 3300009545 Bacteria 3972
159 Ga0105237_10160215 3300009545 Bacteria 2248
160 Ga0105237_10165993 3300009545 Bacteria 2207
161 Ga0105237_10214698 3300009545 Bacteria 1924
162 Ga0105237_10237202 3300009545 Bacteria 1825
163 Ga0105238_10001369 3300009551 Bacteria 24451
164 Ga0105238_10074591 3300009551 Bacteria 3385
165 Ga0105238_10121155 3300009551 Bacteria 2595
166 Ga0105238_10556983 3300009551 Bacteria 1151
167 Ga0105249_10123348 3300009553 Bacteria 2464
168 Ga0105249_10127726 3300009553 Bacteria 2423
169 Ga0105249_10138848 3300009553 Bacteria 2328
170 Ga0105249_10355709 3300009553 Bacteria 1485
171 Ga0105249_10598732 3300009553 Bacteria 1157
172 Ga0099796_10008949 3300010159 Bacteria 2689
173 Ga0099796_10009133 3300010159 Bacteria 2671
174 Ga0105239_10108339 3300010375 Bacteria 3078
175 Ga0105239_10119087 3300010375 Bacteria 2930
176 Ga0105239_10213673 3300010375 Bacteria 2162
177 Ga0105239_11093170 3300010375 Bacteria 918
178 Ga0105246_10124287 3300011119 Bacteria 1917
179 Ga0157373_10035286 3300013100 Bacteria 3591
180 Ga0157370_10001792 3300013104 Bacteria 26474
181 Ga0157370_10169615 3300013104 Unclassified 2029
182 Ga0157369_10008374 3300013105 Bacteria 11859
183 Ga0157369_10020588 3300013105 Bacteria 7374
184 Ga0157369_10248168 3300013105 Bacteria 1858
185 Ga0157369_10402517 3300013105 Unclassified 1420
186 Ga0157369_10911709 3300013105 Bacteria 901
187 Ga0157374_10024555 3300013296 Bacteria 5405
188 Ga0157374_10143663 3300013296 Bacteria 2317
189 Ga0157378_10014547 3300013297 Bacteria 6890
190 Ga0163162_10080654 3300013306 Bacteria 3322
191 Ga0163162_10151550 3300013306 Unclassified 2437
192 Ga0163162_10229947 3300013306 Bacteria 1985
193 Ga0163162_10457560 3300013306 Bacteria 1408
194 Ga0157375_10096475 3300013308 Bacteria 3029
195 Ga0157375_10391035 3300013308 Bacteria 1557
196 Ga0163163_10043200 3300014325 Bacteria 4418
197 Ga0163163_10080037 3300014325 Bacteria 3267
198 Ga0163163_10249199 3300014325 Bacteria 1826
199 Ga0163163_10251471 3300014325 Bacteria 1818
200 Ga0163163_10872868 3300014325 Bacteria 963
201 Ga0157377_10210600 3300014745 Bacteria 1239
202 Ga0157379_10002427 3300014968 Bacteria 15597
203 Ga0157379_10157471 3300014968 Bacteria 2049
204 Ga0157379_10283657 3300014968 Bacteria 1507
205 Ga0157376_10534142 3300014969 Bacteria 1158
206 Ga0213873_10027418 3300021358 Bacteria 1389
207 Ga0213874_10007878 3300021377 Bacteria 2574
208 Ga0213876_10093751 3300021384 Bacteria 1591
209 Ga0213876_10110787 3300021384 Bacteria 1457
210 Ga0207656_10062917 3300025321 Unclassified 1632
211 Ga0207692_10061923 3300025898 Bacteria 1941
212 Ga0207642_10005524 3300025899 Bacteria 4130
213 Ga0207710_10000238 3300025900 Bacteria 47168
214 Ga0207710_10011690 3300025900 Bacteria 3692
215 Ga0207688_10157665 3300025901 Bacteria 1344
216 Ga0207680_10015552 3300025903 Unclassified 3973
217 Ga0207680_10018594 3300025903 Bacteria 3698
218 Ga0207680_10060528 3300025903 Bacteria 2305
219 Ga0207699_10002835 3300025906 Bacteria 8210
220 Ga0207699_10052276 3300025906 Bacteria 2418
221 Ga0207705_10003787 3300025909 Bacteria 11520
222 Ga0207654_10018236 3300025911 Bacteria 3679
223 Ga0207654_10323801 3300025911 Bacteria 1054
224 Ga0207654_10392955 3300025911 Bacteria 963
225 Ga0207707_10000411 3300025912 Bacteria 44888
226 Ga0207707_10009225 3300025912 Bacteria 8562
227 Ga0207707_10037473 3300025912 Bacteria 4238
228 Ga0207707_10101983 3300025912 Bacteria 2508
229 Ga0207707_10508912 3300025912 Bacteria 1026
230 Ga0207695_10007491 3300025913 Bacteria 13865
231 Ga0207695_10043261 3300025913 Bacteria 4800
232 Ga0207695_10044022 3300025913 Bacteria 4752
233 Ga0207695_10047312 3300025913 Bacteria 4553
234 Ga0207695_10089287 3300025913 Bacteria 3099
235 Ga0207695_10091540 3300025913 Bacteria 3055
236 Ga0207695_10238573 3300025913 Bacteria 1720
237 Ga0207695_10374491 3300025913 Bacteria 1310
238 Ga0207695_10395213 3300025913 Bacteria 1267
239 Ga0207695_10524458 3300025913 Bacteria 1066
240 Ga0207671_10073699 3300025914 Bacteria 2550
241 Ga0207671_10311797 3300025914 Bacteria 1244
242 Ga0207693_10000161 3300025915 Bacteria 61727
243 Ga0207693_10038794 3300025915 Bacteria 3750
244 Ga0207663_10015294 3300025916 Bacteria 4231
245 Ga0207663_10036946 3300025916 Bacteria 2941
246 Ga0207663_10173553 3300025916 Bacteria 1533
247 Ga0207660_10005790 3300025917 Bacteria 8023
248 Ga0207660_10095700 3300025917 Bacteria 2210
249 Ga0207657_10089443 3300025919 Bacteria 2572
250 Ga0207652_10005406 3300025921 Bacteria 10365
251 Ga0207652_10034482 3300025921 Bacteria 4265
252 Ga0207652_10040082 3300025921 Bacteria 3977
253 Ga0207652_10151656 3300025921 Bacteria 2075
254 Ga0207694_10016981 3300025924 Bacteria 5497
255 Ga0207694_10019306 3300025924 Bacteria 5153
256 Ga0207694_10081266 3300025924 Bacteria 2545
257 Ga0207694_10209384 3300025924 Unclassified 1588
258 Ga0207694_10502874 3300025924 Bacteria 1015
259 Ga0207694_10511297 3300025924 Bacteria 1006
260 Ga0207659_10369824 3300025926 Bacteria 1193
261 Ga0207687_10056552 3300025927 Bacteria 2753
262 Ga0207700_10010500 3300025928 Bacteria 5848
263 Ga0207700_10011997 3300025928 Bacteria 5561
264 Ga0207700_10184670 3300025928 Bacteria 1748
265 Ga0207700_10212562 3300025928 Bacteria 1636
266 Ga0207664_10185910 3300025929 Bacteria 1786
267 Ga0207644_10004142 3300025931 Bacteria 9403
268 Ga0207644_10302045 3300025931 Bacteria 1290
269 Ga0207644_10480932 3300025931 Unclassified 1023
270 Ga0207690_10081363 3300025932 Bacteria 2263
271 Ga0207706_10231017 3300025933 Bacteria 1618
272 Ga0207686_10012371 3300025934 Bacteria 4692
273 Ga0207686_10266948 3300025934 Bacteria 1257
274 Ga0207686_10484394 3300025934 Bacteria 957
275 Ga0207670_10010211 3300025936 Bacteria 5399
276 Ga0207704_10117860 3300025938 Bacteria 1809
277 Ga0207665_10013204 3300025939 Bacteria 5432
278 Ga0207665_10015339 3300025939 Bacteria 5031
279 Ga0207665_10410189 3300025939 Bacteria 1033
280 Ga0207711_10058578 3300025941 Bacteria 3315
281 Ga0207711_10071438 3300025941 Bacteria 3011
282 Ga0207661_10103487 3300025944 Bacteria 2396
283 Ga0207661_10203090 3300025944 Bacteria 1743
284 Ga0207679_10015619 3300025945 Bacteria 5024
285 Ga0207679_10151861 3300025945 Unclassified 1886
286 Ga0207667_10012498 3300025949 Bacteria 9775
287 Ga0207667_10045762 3300025949 Bacteria 4633
288 Ga0207667_10184786 3300025949 Bacteria 2140
289 Ga0207667_10604637 3300025949 Bacteria 1105
290 Ga0207651_10333301 3300025960 Bacteria 1272
291 Ga0207712_10080295 3300025961 Bacteria 2372
292 Ga0207712_10110678 3300025961 Unclassified 2060
293 Ga0207712_10143993 3300025961 Bacteria 1833
294 Ga0207658_10000038 3300025986 Bacteria 145669
295 Ga0207658_10070283 3300025986 Bacteria 2648
296 Ga0207658_10073432 3300025986 Bacteria 2596
297 Ga0207658_10130178 3300025986 Bacteria 2020
298 Ga0207677_10139594 3300026023 Bacteria 1853
299 Ga0207703_10000605 3300026035 Bacteria 36427
300 Ga0207703_10000754 3300026035 Bacteria 31947
301 Ga0207639_10022623 3300026041 Bacteria 4529
302 Ga0207639_10120224 3300026041 Unclassified 2157
303 Ga0207639_10264184 3300026041 Bacteria 1507
304 Ga0207639_10460345 3300026041 Bacteria 1156
305 Ga0207678_10627293 3300026067 Bacteria 943
306 Ga0207702_10094289 3300026078 Bacteria 2627
307 Ga0207702_10187066 3300026078 Bacteria 1910
308 Ga0207641_10000083 3300026088 Bacteria 134703
309 Ga0207641_10007436 3300026088 Bacteria 9113
310 Ga0207641_10091759 3300026088 Bacteria 2659
311 Ga0207641_10113790 3300026088 Bacteria 2403
312 Ga0207676_10037279 3300026095 Bacteria 3704
313 Ga0207676_10310065 3300026095 Unclassified 1444
314 Ga0207676_10636925 3300026095 Unclassified 1027
315 Ga0207676_10735490 3300026095 Bacteria 958
316 Ga0207674_10017178 3300026116 Bacteria 7897
317 Ga0207674_10288644 3300026116 Bacteria 1589
318 Ga0207675_100211102 3300026118 Unclassified 1867
319 Ga0207683_10002925 3300026121 Bacteria 14881
320 Ga0207683_10341977 3300026121 Unclassified 1372
321 Ga0207698_10143352 3300026142 Bacteria 2062
322 Ga0209282_1000048 3300027666 Bacteria 111312
323 Ga0268266_10004881 3300028379 Bacteria 12720
324 Ga0268266_10108106 3300028379 Bacteria 2460
325 Ga0268266_10172365 3300028379 Bacteria 1964
326 Ga0268265_10036855 3300028380 Bacteria 3585
327 Ga0268265_10497682 3300028380 Bacteria 1148
328 Ga0268264_10000122 3300028381 Bacteria 189690
329 Ga0268264_10073145 3300028381 Unclassified 2908
330 Ga0265319_1003256 3300028563 Bacteria 8545
331 Ga0265334_10000783 3300028573 Bacteria 15888
332 Ga0265318_10000270 3300028577 Bacteria 44032
333 Ga0265338_10000908 3300028800 Bacteria 49878
334 Ga0265338_10038982 3300028800 Bacteria 4491
335 Ga0265338_10049953 3300028800 Bacteria 3785
336 Ga0307511_10000519 3300030521 Bacteria 41413
337 Ga0307511_10031086 3300030521 Bacteria 4778
338 Ga0265762_1020903 3300030760 Bacteria 1205
339 Ga0265760_10006363 3300031090 Bacteria 3378
340 Ga0265760_10023643 3300031090 Unclassified 1786
341 Ga0265330_10006183 3300031235 Bacteria 5927
342 Ga0265330_10210951 3300031235 Bacteria 820
343 Ga0265332_10002881 3300031238 Bacteria 8502
344 Ga0265328_10006797 3300031239 Bacteria 4810
345 Ga0265320_10031924 3300031240 Bacteria 2701
346 Ga0265325_10001369 3300031241 Bacteria 17208
347 Ga0265329_10013346 3300031242 Bacteria 2931
348 Ga0265340_10001829 3300031247 Bacteria 12159
349 Ga0265340_10018843 3300031247 Bacteria 3557
350 Ga0265339_10011088 3300031249 Bacteria 5565
351 Ga0265339_10118631 3300031249 Bacteria 1362
352 Ga0265331_10009402 3300031250 Bacteria 5486
353 Ga0265327_10103801 3300031251 Unclassified 1367
354 Ga0265316_10008294 3300031344 Bacteria 9651
355 Ga0307509_10000001 3300031507 Bacteria 629324
356 Ga0307408_100622058 3300031548 Bacteria 962
357 Ga0265313_10002084 3300031595 Bacteria 17870
358 Ga0265314_10097362 3300031711 Bacteria 1900
359 Ga0265342_10002903 3300031712 Bacteria 14458
360 Ga0307516_10002208 3300031730 Bacteria 26358
361 Ga0307405_10134929 3300031731 Bacteria 1712
362 Ga0307413_10048890 3300031824 Bacteria 2531
363 Ga0307410_10008017 3300031852 Bacteria 5826
364 Ga0307410_10032832 3300031852 Bacteria 3346
365 Ga0307410_10033002 3300031852 Unclassified 3339
366 Ga0307406_10027106 3300031901 Bacteria 3449
367 Ga0307406_10355896 3300031901 Bacteria 1146
368 Ga0307407_10017706 3300031903 Bacteria 3583
369 Ga0307412_10020830 3300031911 Bacteria 3997
370 Ga0307409_100000356 3300031995 Bacteria 19078
371 Ga0307409_100292940 3300031995 Unclassified 1510
372 Ga0307414_10056028 3300032004 Bacteria 2763
373 Ga0307414_10084890 3300032004 Bacteria 2331
374 Ga0307411_10006059 3300032005 Bacteria 6011
375 Ga0307411_10030516 3300032005 Bacteria 3305
376 Ga0307411_10082409 3300032005 Bacteria 2218
377 Ga0307415_100033941 3300032126 Unclassified 3317
378 Ga0307510_10000013 3300033180 Bacteria 274569
379 Ga0373936_0017786 3300035113 Bacteria 2739
380 Ga0373953_0136743 3300035117 Bacteria 1047
381 Ga0373955_0035877 3300035172 Bacteria 2629
382 Ga0373955_0058555 3300035172 Bacteria 2120
383 Ga0373935_0324629 3300035692 Bacteria 1093
384 Ga0373933_0060350 3300035724 Bacteria 2286
385 Ga0373933_0603161 3300035724 Bacteria 721
386 Ga0373937_0005526 3300036401 Bacteria 10838
387 Ga0373937_0043643 3300036401 Bacteria 4094
388 Ga0373925_0054851 3300037068 Bacteria 2982
389 Ga0373925_0224708 3300037068 Bacteria 1500
390 Ga0395900_0813295 3300037418 Unclassified 862
391 Ga0395898_0013420 3300037466 Bacteria 8439
392 Ga0395905_1059260 3300037471 Unclassified 714
393 Ga0436365_0041046 3300039437 Bacteria 2443
394 Ga0436365_0654174 3300039437 Bacteria 8534
395 Ga0436365_1776384 3300039437 Bacteria 4806
396 Ga0436360_0095064 3300039438 Bacteria 1122
397 Ga0436361_0643956 3300039447 Bacteria 1719
398 Ga0436363_0398788 3300039450 Bacteria 9929
399 Ga0436363_0640180 3300039450 Bacteria 9406
400 Ga0436363_0744495 3300039450 Bacteria 894
401 Ga0436363_1588902 3300039450 Bacteria 2178
402 Ga0436362_0756794 3300039453 Bacteria 1410
403 Ga0451577_0026927 3300042876 Bacteria 5205
404 Ga0451577_0028852 3300042876 Bacteria 5018
405 Ga0466969_0002181 3300044656 Bacteria 10461
406 Ga0466969_0004908 3300044656 Bacteria 7125
407 Ga0453683_0074790 3300044673 Bacteria 2121
408 Ga0453683_0129756 3300044673 Bacteria 1588
409 Ga0466966_0015501 3300044684 Bacteria 5038
410 Ga0466961_0000883 3300044693 Bacteria 18652
411 Ga0466961_0042763 3300044693 Bacteria 2904
412 Ga0466964_0001017 3300044706 Bacteria 9319
413 Ga0453684_0142663 3300044712 Bacteria 2857
414 Ga0466971_0015284 3300044719 Bacteria 3377
415 Ga0466970_0001756 3300044765 Bacteria 10459
416 Ga0466957_0000555 3300044842 Bacteria 18825
417 Ga0466959_0000561 3300045049 Bacteria 21601
418 Ga0466959_0012373 3300045049 Bacteria 6164
419 Ga0466959_0052795 3300045049 Bacteria 2975
420 Ga0466959_0074097 3300045049 Bacteria 2462
421 Ga0466958_0129169 3300045836 Bacteria 1586
422 Ga0495580_0013461 3300046472 Bacteria 6239
423 Ga0495580_0028584 3300046472 Bacteria 4052
424 Ga0495582_0354006 3300046473 Bacteria 846
425 Ga0495605_0004939 3300046474 Bacteria 7791
426 Ga0495596_0006299 3300046500 Bacteria 5485
427 Ga0495607_0014138 3300046501 Bacteria 5208
428 Ga0495583_0008086 3300046506 Bacteria 6484
429 Ga0495610_0003749 3300046512 Bacteria 11632
430 Ga0495616_0010536 3300046513 Bacteria 5347
431 Ga0495618_0033195 3300046514 Bacteria 3236
432 Ga0495630_0086457 3300046517 Bacteria 2368
433 Ga0495630_0225345 3300046517 Bacteria 1431
434 Ga0495643_0035857 3300046522 Bacteria 2729
435 Ga0495652_0546507 3300046529 Bacteria 797
436 Ga0495668_0004686 3300046616 Bacteria 9599
437 Ga0495611_0181309 3300046648 Unclassified 984
438 Ga0495661_0024022 3300046665 Bacteria 3949
439 Ga0495623_0359631 3300046679 Bacteria 791
440 Ga0495669_0033086 3300046684 Bacteria 2275
441 Ga0495671_0002656 3300046692 Bacteria 11224
442 Ga0495671_0094010 3300046692 Bacteria 1467
443 Ga0495649_0020169 3300046694 Bacteria 3740
444 Ga0495649_0077675 3300046694 Bacteria 1777
445 Ga0495649_0371357 3300046694 Bacteria 721
446 Ga0495604_0026945 3300047317 Bacteria 4572
447 Ga0495674_0650761 3300047319 Bacteria 831
448 Ga0495672_0026130 3300047320 Bacteria 3728
449 Ga0495687_140187 3300047443 Unclassified 842
450 Ga0495602_0011818 3300048088 Bacteria 9016
451 Ga0496100_0052554 3300048903 Bacteria 2649
452 Ga0496100_0149501 3300048903 Bacteria 1664
453 Ga0496102_0012705 3300048905 Bacteria 7294
454 Ga0496102_0095871 3300048905 Bacteria 2750
455 Ga0496102_0162387 3300048905 Bacteria 2102
456 Ga0496102_0262188 3300048905 Unclassified 1629
457 Ga0496103_0048989 3300048906 Bacteria 2612
458 Ga0496104_0038244 3300048907 Bacteria 4489
459 Ga0496104_0047261 3300048907 Bacteria 4056
460 Ga0496105_0016416 3300048908 Bacteria 5912
461 Ga0496105_0025716 3300048908 Bacteria 4794
462 Ga0496106_0005765 3300048909 Bacteria 9158
463 Ga0496106_0154031 3300048909 Bacteria 1814
464 Ga0496106_0516825 3300048909 Bacteria 959
465 Ga0496107_0016395 3300048910 Bacteria 5201
466 Ga0496108_0031433 3300048911 Bacteria 4405
467 Ga0496109_0043447 3300048912 Bacteria 4073
468 Ga0496109_0267254 3300048912 Unclassified 1611
469 Ga0496110_0119998 3300048913 Bacteria 2368
470 Ga0496111_0138066 3300048914 Bacteria 1806
471 Ga0496112_0048810 3300048915 Bacteria 4148
472 Ga0496112_0574636 3300048915 Unclassified 1060
473 Ga0496114_0067118 3300048917 Bacteria 3008
474 Ga0496115_0019186 3300048918 Bacteria 5260
475 Ga0496115_0216419 3300048918 Bacteria 1581
476 Ga0496116_0008195 3300048919 Bacteria 9113
477 Ga0496116_0098775 3300048919 Unclassified 1751
478 Ga0496117_0001448 3300048920 Bacteria 34207
479 Ga0496118_0000028 3300048921 Bacteria 366490
480 Ga0496119_0006996 3300048922 Bacteria 10276
481 Ga0496119_0014332 3300048922 Bacteria 6215
482 Ga0496119_0043873 3300048922 Bacteria 2821
483 Ga0496120_0000930 3300048923 Bacteria 40517
484 Ga0496120_0009373 3300048923 Bacteria 6956
485 Ga0496120_0022795 3300048923 Bacteria 3934
486 Ga0496121_0000808 3300048924 Bacteria 57011
487 Ga0496121_0057967 3300048924 Bacteria 3206
488 Ga0496121_0086434 3300048924 Bacteria 2464
489 Ga0496122_0005665 3300048925 Bacteria 14746
490 Ga0496123_0006518 3300048926 Bacteria 11284
491 Ga0496124_0181785 3300048927 Unclassified 1617
492 Ga0496125_0000936 3300048928 Bacteria 45858
493 Ga0496125_0003776 3300048928 Bacteria 18018
494 Ga0496125_0004532 3300048928 Bacteria 15960
495 Ga0496125_0108056 3300048928 Bacteria 2025
496 Ga0496126_0005881 3300048929 Bacteria 13833
497 Ga0496126_0025325 3300048929 Bacteria 5710
498 Ga0496126_0216523 3300048929 Bacteria 1611
499 Ga0496126_0234813 3300048929 Bacteria 1535
500 Ga0496126_0350528 3300048929 Bacteria 1207
501 Ga0501072_0250521 3300049588 Unclassified 1410
502 nmdc:mga0n895_335419_c1 3300050512 Bacteria 1532
503 nmdc:mga08x19_150260_c1 3300050514 Bacteria 1577
504 Ga0495612_0144924 3300053078 Bacteria 1032
505 Ga0500556_0000540 3300053104 Bacteria 25527
506 Ga0500558_151348 3300053106 Bacteria 861
507 Ga0500618_001110 3300053125 Bacteria 13191
508 Ga0500559_0051111 3300053136 Bacteria 1825
509 Ga0500559_0272247 3300053136 Bacteria 797
510 Ga0500624_039535 3300053157 Bacteria 843
511 Ga0500639_090697 3300053163 Bacteria 1523
512 Ga0500637_0056244 3300053178 Bacteria 2248
513 Ga0500637_0160481 3300053178 Bacteria 1296
514 Ga0500637_0270166 3300053178 Unclassified 940
515 2904438196 2904434214 Bacteria 6230908
516 Ga0500637_0013264
517 rootH1_10172240
518 rootH1_10318854
519 Ga0065707_10083043
520 Ga0070658_10000547
521 Ga0070683_100148294
522 Ga0070690_100039753
523 Ga0070670_100033604
524 Ga0070670_100308222
525 Ga0070666_10010472
526 Ga0070666_10028306
527 Ga0070680_100005294
528 Ga0070680_100016607
529 Ga0070680_100056162
530 Ga0070682_100100571
531 Ga0068868_100003004
532 Ga0070660_100232638
533 Ga0070661_100021618
534 Ga0070675_100289231
535 Ga0070671_100000199
536 Ga0070671_100010893
537 Ga0070671_100533157
538 Ga0070673_100161018
539 Ga0070667_100000069
540 Ga0070667_100004680
541 Ga0070667_100012032
542 Ga0070667_100050279
543 Ga0070667_100313066
544 Ga0070709_10000986
545 Ga0070709_10101605
546 Ga0070709_10189511
547 Ga0070714_100005208
548 Ga0070714_100216354
549 Ga0070714_100235041
550 Ga0070713_100002662
551 Ga0070713_100029679
552 Ga0070713_100216741
553 Ga0070713_100481725
554 Ga0070710_10012975
555 Ga0070710_10451029
556 Ga0070711_100000649
557 Ga0070711_100124324
558 Ga0070705_100403395
559 Ga0070678_100051360
560 Ga0070662_100021488
561 Ga0070662_100116405
562 Ga0070681_10001618
563 Ga0070681_10002712
564 Ga0070681_10016827
565 Ga0070681_10017608
566 Ga0070681_10066376
567 Ga0070681_10119294
568 Ga0070681_10120157
569 Ga0070681_10154498
570 Ga0070681_10410151
571 Ga0070685_10078657
572 Ga0070679_100004670
573 Ga0070679_100011264
574 Ga0070679_100042103
575 Ga0070679_100181141
576 Ga0070679_100295438
577 Ga0070697_100150041
578 Ga0068853_100002295
579 Ga0068853_100007799
580 Ga0068853_100077837
581 Ga0068853_100197453
582 Ga0068853_100359937
583 Ga0070686_100109309
584 Ga0070695_100030241
585 Ga0070695_100059795
586 Ga0070696_100000233
587 Ga0070693_100599201
588 Ga0070665_100002460
589 Ga0070665_100012162
590 Ga0070665_100138108
591 Ga0070665_100238596
592 Ga0070665_100596548
593 Ga0068855_100000592
594 Ga0068855_100004608
595 Ga0068855_100220388
596 Ga0068855_100301393
597 Ga0070664_100002024
598 Ga0070664_100013450
599 Ga0068857_100034436
600 Ga0068857_100321171
601 Ga0068854_100105587
602 Ga0068856_100046028
603 Ga0068852_100341005
604 Ga0068852_100432356
605 Ga0068852_100443987
606 Ga0068859_100002486
607 Ga0068859_100063169
608 Ga0068859_100072520
609 Ga0068859_100385853
610 Ga0068864_100079163
611 Ga0068864_100308824
612 Ga0068864_100423801
613 Ga0068866_10007506
614 Ga0068861_100430065
615 Ga0068851_10360481
616 Ga0068863_100016434
617 Ga0068863_100081510
618 Ga0068863_100086151
619 Ga0068863_100231147
620 Ga0068863_100865186
621 Ga0068858_100000285
622 Ga0068858_100005143
623 Ga0068858_100012491
624 Ga0068858_100101833
625 Ga0068860_100001390
626 Ga0068860_100005786
627 Ga0068860_100012863
628 Ga0068862_100033959
629 Ga0068862_100152003
630 Ga0068862_100788189
631 Ga0070715_10000239
632 Ga0070716_100014146
633 Ga0070716_100015412
634 Ga0070716_100129708
635 Ga0070712_100000751
636 Ga0070712_100054077
637 Ga0097621_100244832
638 Ga0068871_100128773
639 Ga0075434_100207272
640 Ga0068865_100033036
641 Ga0097620_100002486
642 Ga0097620_100063167
643 Ga0097620_100072519
644 Ga0097620_100385829
645 Ga0099795_10011101
646 Ga0105251_10007536
647 Ga0105250_10154128
648 Ga0105240_10014082
649 Ga0105240_10024226
650 Ga0105240_10044583
651 Ga0105240_10049421
652 Ga0105240_10060987
653 Ga0105240_10085366
654 Ga0105240_10096276
655 Ga0105240_10097222
656 Ga0105240_10252307
657 Ga0105240_10286210
658 Ga0105240_11000919
659 Ga0105245_10017497
660 Ga0105247_10000072
661 Ga0105247_10010957
662 Ga0105247_10072899
663 Ga0105247_10167367
664 Ga0105241_10004905
665 Ga0105241_10162684
666 Ga0105241_10758046
667 Ga0105242_10001357
668 Ga0105242_10044453
669 Ga0105248_10024681
670 Ga0105248_10156395
671 Ga0105248_10283034
672 Ga0105237_10041800
673 Ga0105237_10055385
674 Ga0105237_10160215
675 Ga0105237_10165993
676 Ga0105237_10214698
677 Ga0105237_10237202
678 Ga0105238_10001369
679 Ga0105238_10074591
680 Ga0105238_10121155
681 Ga0105238_10556983
682 Ga0105249_10123348
683 Ga0105249_10127726
684 Ga0105249_10138848
685 Ga0105249_10355709
686 Ga0105249_10598732
687 Ga0099796_10008949
688 Ga0099796_10009133
689 Ga0105239_10108339
690 Ga0105239_10119087
691 Ga0105239_10213673
692 Ga0105239_11093170
693 Ga0105246_10124287
694 Ga0157373_10035286
695 Ga0157370_10001792
696 Ga0157370_10169615
697 Ga0157369_10008374
698 Ga0157369_10020588
699 Ga0157369_10248168
700 Ga0157369_10402517
701 Ga0157369_10911709
702 Ga0157374_10024555
703 Ga0157374_10143663
704 Ga0157378_10014547
705 Ga0163162_10080654
706 Ga0163162_10151550
707 Ga0163162_10229947
708 Ga0163162_10457560
709 Ga0157375_10096475
710 Ga0157375_10391035
711 Ga0163163_10043200
712 Ga0163163_10080037
713 Ga0163163_10249199
714 Ga0163163_10251471
715 Ga0163163_10872868
716 Ga0157377_10210600
717 Ga0157379_10002427
718 Ga0157379_10157471
719 Ga0157379_10283657
720 Ga0157376_10534142
721 Ga0213873_10027418
722 Ga0213874_10007878
723 Ga0213876_10093751
724 Ga0213876_10110787
725 Ga0207656_10062917
726 Ga0207692_10061923
727 Ga0207642_10005524
728 Ga0207710_10000238
729 Ga0207710_10011690
730 Ga0207688_10157665
731 Ga0207680_10015552
732 Ga0207680_10018594
733 Ga0207680_10060528
734 Ga0207699_10002835
735 Ga0207699_10052276
736 Ga0207705_10003787
737 Ga0207654_10018236
738 Ga0207654_10323801
739 Ga0207654_10392955
740 Ga0207707_10000411
741 Ga0207707_10009225
742 Ga0207707_10037473
743 Ga0207707_10101983
744 Ga0207707_10508912
745 Ga0207695_10007491
746 Ga0207695_10043261
747 Ga0207695_10044022
748 Ga0207695_10047312
749 Ga0207695_10089287
750 Ga0207695_10091540
751 Ga0207695_10238573
752 Ga0207695_10374491
753 Ga0207695_10395213
754 Ga0207695_10524458
755 Ga0207671_10073699
756 Ga0207671_10311797
757 Ga0207693_10000161
758 Ga0207693_10038794
759 Ga0207663_10015294
760 Ga0207663_10036946
761 Ga0207663_10173553
762 Ga0207660_10005790
763 Ga0207660_10095700
764 Ga0207657_10089443
765 Ga0207652_10005406
766 Ga0207652_10034482
767 Ga0207652_10040082
768 Ga0207652_10151656
769 Ga0207694_10016981
770 Ga0207694_10019306
771 Ga0207694_10081266
772 Ga0207694_10209384
773 Ga0207694_10502874
774 Ga0207694_10511297
775 Ga0207659_10369824
776 Ga0207687_10056552
777 Ga0207700_10010500
778 Ga0207700_10011997
779 Ga0207700_10184670
780 Ga0207700_10212562
781 Ga0207664_10185910
782 Ga0207644_10004142
783 Ga0207644_10302045
784 Ga0207644_10480932
785 Ga0207690_10081363
786 Ga0207706_10231017
787 Ga0207686_10012371
788 Ga0207686_10266948
789 Ga0207686_10484394
790 Ga0207670_10010211
791 Ga0207704_10117860
792 Ga0207665_10013204
793 Ga0207665_10015339
794 Ga0207665_10410189
795 Ga0207711_10058578
796 Ga0207711_10071438
797 Ga0207661_10103487
798 Ga0207661_10203090
799 Ga0207679_10015619
800 Ga0207679_10151861
801 Ga0207667_10012498
802 Ga0207667_10045762
803 Ga0207667_10184786
804 Ga0207667_10604637
805 Ga0207651_10333301
806 Ga0207712_10080295
807 Ga0207712_10110678
808 Ga0207712_10143993
809 Ga0207658_10000038
810 Ga0207658_10070283
811 Ga0207658_10073432
812 Ga0207658_10130178
813 Ga0207677_10139594
814 Ga0207703_10000605
815 Ga0207703_10000754
816 Ga0207639_10022623
817 Ga0207639_10120224
818 Ga0207639_10264184
819 Ga0207639_10460345
820 Ga0207678_10627293
821 Ga0207702_10094289
822 Ga0207702_10187066
823 Ga0207641_10000083
824 Ga0207641_10007436
825 Ga0207641_10091759
826 Ga0207641_10113790
827 Ga0207676_10037279
828 Ga0207676_10310065
829 Ga0207676_10636925
830 Ga0207676_10735490
831 Ga0207674_10017178
832 Ga0207674_10288644
833 Ga0207675_100211102
834 Ga0207683_10002925
835 Ga0207683_10341977
836 Ga0207698_10143352
837 Ga0209282_1000048
838 Ga0268266_10004881
839 Ga0268266_10108106
840 Ga0268266_10172365
841 Ga0268265_10036855
842 Ga0268265_10497682
843 Ga0268264_10000122
844 Ga0268264_10073145
845 Ga0265319_1003256
846 Ga0265334_10000783
847 Ga0265318_10000270
848 Ga0265338_10000908
849 Ga0265338_10038982
850 Ga0265338_10049953
851 Ga0307511_10000519
852 Ga0307511_10031086
853 Ga0265762_1020903
854 Ga0265760_10006363
855 Ga0265760_10023643
856 Ga0265330_10006183
857 Ga0265330_10210951
858 Ga0265332_10002881
859 Ga0265328_10006797
860 Ga0265320_10031924
861 Ga0265325_10001369
862 Ga0265329_10013346
863 Ga0265340_10001829
864 Ga0265340_10018843
865 Ga0265339_10011088
866 Ga0265339_10118631
867 Ga0265331_10009402
868 Ga0265327_10103801
869 Ga0265316_10008294
870 Ga0307509_10000001
871 Ga0307408_100622058
872 Ga0265313_10002084
873 Ga0265314_10097362
874 Ga0265342_10002903
875 Ga0307516_10002208
876 Ga0307405_10134929
877 Ga0307413_10048890
878 Ga0307410_10008017
879 Ga0307410_10032832
880 Ga0307410_10033002
881 Ga0307406_10027106
882 Ga0307406_10355896
883 Ga0307407_10017706
884 Ga0307412_10020830
885 Ga0307409_100000356
886 Ga0307409_100292940
887 Ga0307414_10056028
888 Ga0307414_10084890
889 Ga0307411_10006059
890 Ga0307411_10030516
891 Ga0307411_10082409
892 Ga0307415_100033941
893 Ga0307510_10000013
894 Ga0373936_0017786
895 Ga0373953_0136743
896 Ga0373955_0035877
897 Ga0373955_0058555
898 Ga0373935_0324629
899 Ga0373933_0060350
900 Ga0373933_0603161
901 Ga0373937_0005526
902 Ga0373937_0043643
903 Ga0373925_0054851
904 Ga0373925_0224708
905 Ga0395900_0813295
906 Ga0395898_0013420
907 Ga0395905_1059260
908 Ga0436365_0041046
909 Ga0436365_0654174
910 Ga0436365_1776384
911 Ga0436360_0095064
912 Ga0436361_0643956
913 Ga0436363_0398788
914 Ga0436363_0640180
915 Ga0436363_0744495
916 Ga0436363_1588902
917 Ga0436362_0756794
918 Ga0451577_0026927
919 Ga0451577_0028852
920 Ga0466969_0002181
921 Ga0466969_0004908
922 Ga0453683_0074790
923 Ga0453683_0129756
924 Ga0466966_0015501
925 Ga0466961_0000883
926 Ga0466961_0042763
927 Ga0466964_0001017
928 Ga0453684_0142663
929 Ga0466971_0015284
930 Ga0466970_0001756
931 Ga0466957_0000555
932 Ga0466959_0000561
933 Ga0466959_0012373
934 Ga0466959_0052795
935 Ga0466959_0074097
936 Ga0466958_0129169
937 Ga0495580_0013461
938 Ga0495580_0028584
939 Ga0495582_0354006
940 Ga0495605_0004939
941 Ga0495596_0006299
942 Ga0495607_0014138
943 Ga0495583_0008086
944 Ga0495610_0003749
945 Ga0495616_0010536
946 Ga0495618_0033195
947 Ga0495630_0086457
948 Ga0495630_0225345
949 Ga0495643_0035857
950 Ga0495652_0546507
951 Ga0495668_0004686
952 Ga0495611_0181309
953 Ga0495661_0024022
954 Ga0495623_0359631
955 Ga0495669_0033086
956 Ga0495671_0002656
957 Ga0495671_0094010
958 Ga0495649_0020169
959 Ga0495649_0077675
960 Ga0495649_0371357
961 Ga0495604_0026945
962 Ga0495674_0650761
963 Ga0495672_0026130
964 Ga0495687_140187
965 Ga0495602_0011818
966 Ga0496100_0052554
967 Ga0496100_0149501
968 Ga0496102_0012705
969 Ga0496102_0095871
970 Ga0496102_0162387
971 Ga0496102_0262188
972 Ga0496103_0048989
973 Ga0496104_0038244
974 Ga0496104_0047261
975 Ga0496105_0016416
976 Ga0496105_0025716
977 Ga0496106_0005765
978 Ga0496106_0154031
979 Ga0496106_0516825
980 Ga0496107_0016395
981 Ga0496108_0031433
982 Ga0496109_0043447
983 Ga0496109_0267254
984 Ga0496110_0119998
985 Ga0496111_0138066
986 Ga0496112_0048810
987 Ga0496112_0574636
988 Ga0496114_0067118
989 Ga0496115_0019186
990 Ga0496115_0216419
991 Ga0496116_0008195
992 Ga0496116_0098775
993 Ga0496117_0001448
994 Ga0496118_0000028
995 Ga0496119_0006996
996 Ga0496119_0014332
997 Ga0496119_0043873
998 Ga0496120_0000930
999 Ga0496120_0009373
1000 Ga0496120_0022795
1001 Ga0496121_0000808
1002 Ga0496121_0057967
1003 Ga0496121_0086434
1004 Ga0496122_0005665
1005 Ga0496123_0006518
1006 Ga0496124_0181785
1007 Ga0496125_0000936
1008 Ga0496125_0003776
1009 Ga0496125_0004532
1010 Ga0496125_0108056
1011 Ga0496126_0005881
1012 Ga0496126_0025325
1013 Ga0496126_0216523
1014 Ga0496126_0234813
1015 Ga0496126_0350528
1016 Ga0501072_0250521
1017 nmdc:mga0n895_335419_c1
1018 nmdc:mga08x19_150260_c1
1019 Ga0495612_0144924
1020 Ga0500556_0000540
1021 Ga0500558_151348
1022 Ga0500618_001110
1023 Ga0500559_0051111
1024 Ga0500559_0272247
1025 Ga0500624_039535
1026 Ga0500639_090697
1027 Ga0500637_0056244
1028 Ga0500637_0160481
1029 Ga0500637_0270166
1030 2904438196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02592

Vut_1

Putative vitamin uptake transporter

69

229

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5edl-assembly1.cif.gz_A crystal structure of an s-component of ecf transporter 0.5687 11 215
5edl-assembly1.cif.gz_A crystal structure of an s-component of ecf transporter 0.5001 11 215
4rfs-assembly1.cif.gz_S structure of a pantothenate energy coupling factor transporter 0.4917 10 217
4rfs-assembly1.cif.gz_S structure of a pantothenate energy coupling factor transporter 0.4587 10 217
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.3933 10 216
ID Description Score Start End Superfamily
af_Q2FYK0_57_218_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7581 49 208 1.10.1760.20
af_Q2FYK0_57_218_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7429 49 208 1.10.1760.20
af_P37619_43_201_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6489 49 212 1.10.1760.20
af_P37619_43_201_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6359 49 212 1.10.1760.20
5ajiF01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.517 120 212 1.10.287.1260
ID Description Score Start End GO Terms
AF-A0A3M1SL91-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.9858 6 235 GO:0005886
GO:0022857
GO:1990397
AF-A0A3M2D398-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.985 6 235 GO:0005886
GO:0022857
GO:1990397
AF-A0A2V8RID3-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.9838 4 235 GO:0005886
GO:0022857
GO:1990397
AF-A0A2V7TRP8-F1-model_v4 Queuosine precursor transporter 0.9819 2 235 GO:0016020
GO:1990397
AF-A0A031JI26-F1-model_v4 deleted 0.9804 5 232

Map