F457922
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 515 | 294 | 1030 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300049823|Ga0501044_0100406|Ga0501044_0100406_1045_2112 |
| Length | 346 |
| Sequence | LFLFQFPFQPGFKNFSFAADGTVEGLVLILMSAQVKFACVFPGQGSQSIGMMTGYGSFPVVRQTFAEASDVLKQDLWGMVCDGPADTLNLTVNTQPLMLAAGVAVYRAWQTLGEVRPAFMAGHSLGEYTALVASEALSFADALPLVRFRAEIMQQAVPEGVGAMAAILGLDDDVVRSICQEVTEASDGESLEPANFNSPGQVVVAGHKDAVVRGMEAARSKGAKRTVILPMSIPSHCSLMKPAAEKMRQQLAQVTLRSPKIPLLHNADVEQHEDAESIKEILVRQLFNPVRWTEIIRFISGAGIHHVVECGPGKVLSGLNKRIDANLQSLALTDDAALGHAAALAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 171 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 179 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 180 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 181 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 182 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 183 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 184 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 185 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 186 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 187 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 188 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 189 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 190 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 191 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 192 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 193 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 194 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 195 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 196 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 197 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 198 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 199 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 200 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 201 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 202 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 203 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 204 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 205 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 206 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 207 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 222 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 260 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 261 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 262 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 263 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 264 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 269 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 270 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 271 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 272 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 273 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 274 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 275 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 276 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 279 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 280 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 281 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 282 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 283 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 284 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 285 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 286 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 287 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 288 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 289 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 290 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 291 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 292 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 293 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 294 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.89 |
| Metatranscriptomes | 0 |
| Isolates | 3.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.12 |
| Nodule | 0.58 |
| Rhizoplane | 0.78 |
| Rhizosphere | 77.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501044_0100406 | 3300049823 | Bacteria | 2912 |
| 2 | JGI25155J39150_1000041 | 3300002704 | Bacteria | 88843 |
| 3 | JGI25154J39366_1000532 | 3300002738 | Bacteria | 19092 |
| 4 | JGI25157J39369_1000021 | 3300002741 | Bacteria | 163907 |
| 5 | JGI25150J39212_1008690 | 3300002774 | Bacteria | 1975 |
| 6 | JGI25159J45721_1002903 | 3300002987 | Bacteria | 6257 |
| 7 | JGI25159J45721_1002920 | 3300002987 | Bacteria | 6229 |
| 8 | JGI25151J46595_10000203 | 3300003187 | Bacteria | 73276 |
| 9 | JGI25151J46595_10005774 | 3300003187 | Bacteria | 6339 |
| 10 | JGI25151J46595_10006188 | 3300003187 | Bacteria | 6059 |
| 11 | rootH1_10016625 | 3300003316 | Bacteria | 2189 |
| 12 | rootH1_10040961 | 3300003316 | Bacteria | 3027 |
| 13 | rootH2_10040300 | 3300003320 | Bacteria | 2961 |
| 14 | rootH1_10042792 | 3300003323 | Bacteria | 1952 |
| 15 | rootH1_10066965 | 3300003323 | Bacteria | 13543 |
| 16 | JGI25160J50197_1000784 | 3300003354 | Bacteria | 17048 |
| 17 | JGI25161J50226_1000042 | 3300003374 | Bacteria | 123841 |
| 18 | Ga0055539_1001038 | 3300003752 | Bacteria | 5950 |
| 19 | Ga0055539_1004990 | 3300003752 | Bacteria | 1743 |
| 20 | Ga0055533_1000033 | 3300003756 | Bacteria | 265716 |
| 21 | Ga0055525_1001031 | 3300003759 | Bacteria | 7289 |
| 22 | Ga0055526_1013276 | 3300003771 | Bacteria | 3499 |
| 23 | Ga0055537_1000897 | 3300003773 | Bacteria | 14118 |
| 24 | Ga0055524_1000260 | 3300003775 | Bacteria | 53486 |
| 25 | Ga0055536_1006790 | 3300003781 | Bacteria | 5239 |
| 26 | Ga0055534_1002028 | 3300003784 | Bacteria | 7345 |
| 27 | Ga0055528_1001244 | 3300003790 | Bacteria | 16187 |
| 28 | Ga0055530_10004910 | 3300003791 | Bacteria | 6631 |
| 29 | Ga0055540_1000010 | 3300003792 | Bacteria | 290865 |
| 30 | Ga0055531_10008678 | 3300003794 | Bacteria | 5313 |
| 31 | Ga0055531_10014544 | 3300003794 | Bacteria | 3536 |
| 32 | Ga0055543_1000279 | 3300004625 | Bacteria | 37669 |
| 33 | Ga0065165_1006407 | 3300005262 | Bacteria | 6184 |
| 34 | Ga0065707_10212760 | 3300005295 | Bacteria | 1258 |
| 35 | Ga0070658_10004301 | 3300005327 | Bacteria | 11639 |
| 36 | Ga0070658_10064261 | 3300005327 | Bacteria | 2993 |
| 37 | Ga0070658_10300157 | 3300005327 | Bacteria | 1369 |
| 38 | Ga0070690_100000845 | 3300005330 | Bacteria | 15537 |
| 39 | Ga0068869_100002558 | 3300005334 | Bacteria | 10978 |
| 40 | Ga0068869_100059314 | 3300005334 | Bacteria | 2801 |
| 41 | Ga0068869_100079578 | 3300005334 | Bacteria | 2443 |
| 42 | Ga0070680_100060160 | 3300005336 | Bacteria | 3108 |
| 43 | Ga0070680_100238078 | 3300005336 | Bacteria | 1538 |
| 44 | Ga0070660_100038465 | 3300005339 | Bacteria | 3632 |
| 45 | Ga0070660_100201471 | 3300005339 | Bacteria | 1614 |
| 46 | Ga0070660_100223664 | 3300005339 | Bacteria | 1530 |
| 47 | Ga0070689_100004467 | 3300005340 | Bacteria | 9455 |
| 48 | Ga0070661_100315318 | 3300005344 | Bacteria | 1220 |
| 49 | Ga0070692_10019632 | 3300005345 | Bacteria | 3264 |
| 50 | Ga0070668_100007129 | 3300005347 | Bacteria | 8283 |
| 51 | Ga0070668_100018023 | 3300005347 | Bacteria | 5297 |
| 52 | Ga0070669_100025721 | 3300005353 | Bacteria | 4228 |
| 53 | Ga0070673_100289278 | 3300005364 | Bacteria | 1439 |
| 54 | Ga0070673_100326907 | 3300005364 | Bacteria | 1356 |
| 55 | Ga0070673_100432415 | 3300005364 | Bacteria | 1182 |
| 56 | Ga0070688_100155194 | 3300005365 | Bacteria | 1568 |
| 57 | Ga0070710_10030300 | 3300005437 | Bacteria | 2910 |
| 58 | Ga0070700_100000846 | 3300005441 | Bacteria | 15113 |
| 59 | Ga0070700_100078022 | 3300005441 | Bacteria | 2131 |
| 60 | Ga0070700_100186838 | 3300005441 | Bacteria | 1446 |
| 61 | Ga0070694_100118275 | 3300005444 | Bacteria | 1898 |
| 62 | Ga0070694_100236823 | 3300005444 | Bacteria | 1375 |
| 63 | Ga0070663_100063775 | 3300005455 | Bacteria | 2662 |
| 64 | Ga0070678_100016566 | 3300005456 | Bacteria | 4720 |
| 65 | Ga0070678_100142623 | 3300005456 | Bacteria | 1919 |
| 66 | Ga0070681_10217992 | 3300005458 | Bacteria | 1824 |
| 67 | Ga0068867_100012057 | 3300005459 | Bacteria | 6106 |
| 68 | Ga0068867_100029458 | 3300005459 | Bacteria | 3955 |
| 69 | Ga0068853_100086990 | 3300005539 | Bacteria | 2741 |
| 70 | Ga0070686_100001455 | 3300005544 | Bacteria | 13358 |
| 71 | Ga0070695_100056225 | 3300005545 | Bacteria | 2539 |
| 72 | Ga0070696_100086516 | 3300005546 | Bacteria | 2225 |
| 73 | Ga0070693_100037034 | 3300005547 | Bacteria | 2717 |
| 74 | Ga0070665_100072404 | 3300005548 | Bacteria | 3454 |
| 75 | Ga0070704_100003101 | 3300005549 | Bacteria | 9470 |
| 76 | Ga0068855_100000854 | 3300005563 | Bacteria | 37817 |
| 77 | Ga0068855_100001935 | 3300005563 | Bacteria | 25716 |
| 78 | Ga0068857_100035333 | 3300005577 | Bacteria | 4426 |
| 79 | Ga0068857_100428262 | 3300005577 | Bacteria | 1234 |
| 80 | Ga0068854_100005269 | 3300005578 | Bacteria | 8160 |
| 81 | Ga0068854_100067827 | 3300005578 | Bacteria | 2600 |
| 82 | Ga0068856_100002812 | 3300005614 | Bacteria | 17820 |
| 83 | Ga0068856_100145271 | 3300005614 | Bacteria | 2380 |
| 84 | Ga0070702_100001220 | 3300005615 | Bacteria | 10400 |
| 85 | Ga0068859_100007107 | 3300005617 | Bacteria | 11361 |
| 86 | Ga0068859_100772820 | 3300005617 | Bacteria | 1049 |
| 87 | Ga0068866_10000235 | 3300005718 | Bacteria | 26083 |
| 88 | Ga0068866_10036970 | 3300005718 | Bacteria | 2395 |
| 89 | Ga0068861_100032646 | 3300005719 | Bacteria | 3834 |
| 90 | Ga0068861_100047909 | 3300005719 | Bacteria | 3228 |
| 91 | Ga0068870_10005533 | 3300005840 | Bacteria | 5515 |
| 92 | Ga0068863_100085641 | 3300005841 | Bacteria | 2986 |
| 93 | Ga0068863_100278337 | 3300005841 | Bacteria | 1621 |
| 94 | Ga0068858_100002549 | 3300005842 | Bacteria | 18376 |
| 95 | Ga0068860_100009873 | 3300005843 | Bacteria | 9463 |
| 96 | Ga0068860_100011681 | 3300005843 | Bacteria | 8657 |
| 97 | Ga0068860_100194861 | 3300005843 | Bacteria | 1962 |
| 98 | Ga0068862_100005397 | 3300005844 | Bacteria | 10689 |
| 99 | Ga0068862_100035873 | 3300005844 | Bacteria | 4201 |
| 100 | Ga0068862_100137531 | 3300005844 | Bacteria | 2166 |
| 101 | Ga0068862_100146870 | 3300005844 | Bacteria | 2096 |
| 102 | Ga0075365_10036287 | 3300006038 | Bacteria | 3193 |
| 103 | Ga0075365_10092291 | 3300006038 | Bacteria | 2064 |
| 104 | Ga0075432_10013163 | 3300006058 | Bacteria | 2810 |
| 105 | Ga0075362_10032027 | 3300006177 | Bacteria | 2279 |
| 106 | Ga0075367_10016611 | 3300006178 | Bacteria | 4021 |
| 107 | Ga0075366_10250647 | 3300006195 | Bacteria | 1080 |
| 108 | Ga0075370_10037855 | 3300006353 | Unclassified | 2713 |
| 109 | Ga0068871_100057290 | 3300006358 | Bacteria | 3170 |
| 110 | Ga0075428_100148162 | 3300006844 | Bacteria | 2550 |
| 111 | Ga0075430_100039430 | 3300006846 | Bacteria | 3999 |
| 112 | Ga0075431_100299598 | 3300006847 | Bacteria | 1624 |
| 113 | Ga0068865_100000229 | 3300006881 | Bacteria | 31243 |
| 114 | Ga0068865_100162223 | 3300006881 | Bacteria | 1706 |
| 115 | Ga0097620_100007107 | 3300006931 | Bacteria | 11361 |
| 116 | Ga0097620_100772783 | 3300006931 | Bacteria | 1049 |
| 117 | Ga0105240_10103450 | 3300009093 | Bacteria | 3460 |
| 118 | Ga0105240_10251666 | 3300009093 | Bacteria | 2043 |
| 119 | Ga0105240_10350446 | 3300009093 | Bacteria | 1675 |
| 120 | Ga0111539_10323826 | 3300009094 | Bacteria | 1794 |
| 121 | Ga0105245_10000613 | 3300009098 | Bacteria | 32290 |
| 122 | Ga0105243_10004808 | 3300009148 | Bacteria | 10615 |
| 123 | Ga0105242_10000678 | 3300009176 | Bacteria | 26735 |
| 124 | Ga0105248_10104615 | 3300009177 | Bacteria | 3191 |
| 125 | Ga0105237_10067786 | 3300009545 | Bacteria | 3562 |
| 126 | Ga0105237_10158056 | 3300009545 | Bacteria | 2264 |
| 127 | Ga0105249_10008913 | 3300009553 | Bacteria | 8762 |
| 128 | Ga0105249_10012098 | 3300009553 | Bacteria | 7597 |
| 129 | Ga0105239_10088857 | 3300010375 | Bacteria | 3407 |
| 130 | Ga0157326_1001451 | 3300012513 | Bacteria | 2623 |
| 131 | Ga0157370_10003417 | 3300013104 | Bacteria | 18643 |
| 132 | Ga0157370_10010884 | 3300013104 | Bacteria | 9553 |
| 133 | Ga0157370_10021458 | 3300013104 | Bacteria | 6436 |
| 134 | Ga0157369_10024680 | 3300013105 | Bacteria | 6682 |
| 135 | Ga0157369_10242406 | 3300013105 | Bacteria | 1883 |
| 136 | Ga0157374_10174958 | 3300013296 | Bacteria | 2095 |
| 137 | Ga0157378_10001171 | 3300013297 | Bacteria | 23874 |
| 138 | Ga0157378_10114889 | 3300013297 | Bacteria | 2473 |
| 139 | Ga0163162_10130796 | 3300013306 | Bacteria | 2618 |
| 140 | Ga0157375_10320144 | 3300013308 | Bacteria | 1715 |
| 141 | Ga0163163_10428270 | 3300014325 | Bacteria | 1382 |
| 142 | Ga0157380_10001394 | 3300014326 | Bacteria | 15775 |
| 143 | Ga0157380_10018325 | 3300014326 | Bacteria | 5195 |
| 144 | Ga0157380_10033173 | 3300014326 | Bacteria | 3976 |
| 145 | Ga0182008_10005703 | 3300014497 | Bacteria | 7048 |
| 146 | Ga0157379_10110312 | 3300014968 | Bacteria | 2471 |
| 147 | Ga0157379_10124390 | 3300014968 | Bacteria | 2320 |
| 148 | Ga0182006_1033026 | 3300015261 | Bacteria | 2076 |
| 149 | Ga0182007_10008951 | 3300015262 | Bacteria | 4077 |
| 150 | Ga0182005_1023964 | 3300015265 | Bacteria | 1668 |
| 151 | Ga0209674_100064 | 3300025226 | Bacteria | 265769 |
| 152 | Ga0209563_100126 | 3300025230 | Bacteria | 113122 |
| 153 | Ga0207427_101069 | 3300025231 | Bacteria | 11289 |
| 154 | Ga0207425_1003810 | 3300025245 | Bacteria | 4705 |
| 155 | Ga0209646_1000060 | 3300025246 | Bacteria | 256386 |
| 156 | Ga0209026_1000049 | 3300025250 | Bacteria | 255273 |
| 157 | Ga0209677_100099 | 3300025253 | Bacteria | 92370 |
| 158 | Ga0209677_100229 | 3300025253 | Bacteria | 39781 |
| 159 | Ga0209759_1000069 | 3300025256 | Bacteria | 182437 |
| 160 | Ga0209565_1000462 | 3300025263 | Bacteria | 30996 |
| 161 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 162 | Ga0209130_1000216 | 3300025284 | Bacteria | 75536 |
| 163 | Ga0209130_1001740 | 3300025284 | Bacteria | 12994 |
| 164 | Ga0209675_1000400 | 3300025291 | Bacteria | 35775 |
| 165 | Ga0209675_1015447 | 3300025291 | Bacteria | 2266 |
| 166 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 167 | Ga0209676_1005634 | 3300025292 | Bacteria | 6458 |
| 168 | Ga0209025_1007550 | 3300025294 | Bacteria | 8068 |
| 169 | Ga0209025_1010246 | 3300025294 | Bacteria | 6378 |
| 170 | Ga0209025_1014775 | 3300025294 | Bacteria | 4771 |
| 171 | Ga0209564_1002817 | 3300025295 | Bacteria | 12908 |
| 172 | Ga0209564_1004210 | 3300025295 | Bacteria | 8969 |
| 173 | Ga0209564_1007216 | 3300025295 | Bacteria | 5783 |
| 174 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 175 | Ga0209050_1009272 | 3300025298 | Bacteria | 5067 |
| 176 | Ga0209050_1009597 | 3300025298 | Bacteria | 4926 |
| 177 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 178 | Ga0207426_1000117 | 3300025302 | Bacteria | 224652 |
| 179 | Ga0207426_1016077 | 3300025302 | Bacteria | 2697 |
| 180 | Ga0207426_1050062 | 3300025302 | Bacteria | 1247 |
| 181 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 182 | Ga0209051_1000244 | 3300025303 | Bacteria | 91505 |
| 183 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 184 | Ga0209257_1000144 | 3300025304 | Bacteria | 197078 |
| 185 | Ga0209257_1007579 | 3300025304 | Bacteria | 6507 |
| 186 | Ga0207656_10110882 | 3300025321 | Bacteria | 1268 |
| 187 | Ga0207682_10049321 | 3300025893 | Bacteria | 1738 |
| 188 | Ga0207642_10001272 | 3300025899 | Bacteria | 7804 |
| 189 | Ga0207645_10043971 | 3300025907 | Bacteria | 2859 |
| 190 | Ga0207643_10006831 | 3300025908 | Bacteria | 6125 |
| 191 | Ga0207705_10003399 | 3300025909 | Bacteria | 12102 |
| 192 | Ga0207705_10097678 | 3300025909 | Bacteria | 2157 |
| 193 | Ga0207695_10124438 | 3300025913 | Bacteria | 2542 |
| 194 | Ga0207660_10059979 | 3300025917 | Bacteria | 2733 |
| 195 | Ga0207662_10049408 | 3300025918 | Bacteria | 2495 |
| 196 | Ga0207657_10005722 | 3300025919 | Bacteria | 12970 |
| 197 | Ga0207657_10098414 | 3300025919 | Bacteria | 2431 |
| 198 | Ga0207681_10009331 | 3300025923 | Bacteria | 5995 |
| 199 | Ga0207681_10046474 | 3300025923 | Bacteria | 2920 |
| 200 | Ga0207644_10043818 | 3300025931 | Bacteria | 3176 |
| 201 | Ga0207686_10005352 | 3300025934 | Bacteria | 6883 |
| 202 | Ga0207670_10004995 | 3300025936 | Bacteria | 7226 |
| 203 | Ga0207704_10000551 | 3300025938 | Bacteria | 16714 |
| 204 | Ga0207704_10005451 | 3300025938 | Bacteria | 5867 |
| 205 | Ga0207691_10046386 | 3300025940 | Bacteria | 3994 |
| 206 | Ga0207711_10089600 | 3300025941 | Bacteria | 2703 |
| 207 | Ga0207711_10127666 | 3300025941 | Bacteria | 2276 |
| 208 | Ga0207689_10000136 | 3300025942 | Bacteria | 62820 |
| 209 | Ga0207689_10073835 | 3300025942 | Bacteria | 2802 |
| 210 | Ga0207689_10087023 | 3300025942 | Bacteria | 2567 |
| 211 | Ga0207661_10019127 | 3300025944 | Bacteria | 5100 |
| 212 | Ga0207667_10002571 | 3300025949 | Bacteria | 22570 |
| 213 | Ga0207667_10016348 | 3300025949 | Bacteria | 8388 |
| 214 | Ga0207651_10097155 | 3300025960 | Bacteria | 2174 |
| 215 | Ga0207651_10169124 | 3300025960 | Bacteria | 1722 |
| 216 | Ga0207651_10261477 | 3300025960 | Bacteria | 1421 |
| 217 | Ga0207712_10057615 | 3300025961 | Bacteria | 2742 |
| 218 | Ga0207712_10074836 | 3300025961 | Bacteria | 2446 |
| 219 | Ga0207668_10084965 | 3300025972 | Bacteria | 2307 |
| 220 | Ga0207703_10055397 | 3300026035 | Bacteria | 3226 |
| 221 | Ga0207639_10060757 | 3300026041 | Bacteria | 2916 |
| 222 | Ga0207708_10001168 | 3300026075 | Bacteria | 19751 |
| 223 | Ga0207708_10004098 | 3300026075 | Bacteria | 10723 |
| 224 | Ga0207708_10201765 | 3300026075 | Bacteria | 1587 |
| 225 | Ga0207702_10002287 | 3300026078 | Bacteria | 18385 |
| 226 | Ga0207641_10078085 | 3300026088 | Bacteria | 2867 |
| 227 | Ga0207641_10092410 | 3300026088 | Bacteria | 2650 |
| 228 | Ga0207641_10138084 | 3300026088 | Bacteria | 2196 |
| 229 | Ga0207648_10000485 | 3300026089 | Bacteria | 44215 |
| 230 | Ga0207648_10004350 | 3300026089 | Bacteria | 14571 |
| 231 | Ga0207675_100000213 | 3300026118 | Bacteria | 54289 |
| 232 | Ga0207675_100011315 | 3300026118 | Bacteria | 8351 |
| 233 | Ga0207675_100111779 | 3300026118 | Bacteria | 2578 |
| 234 | Ga0207675_100466884 | 3300026118 | Bacteria | 1253 |
| 235 | Ga0207683_10023921 | 3300026121 | Bacteria | 5256 |
| 236 | Ga0207683_10028497 | 3300026121 | Bacteria | 4829 |
| 237 | Ga0207683_10092410 | 3300026121 | Bacteria | 2696 |
| 238 | Ga0207698_10166304 | 3300026142 | Bacteria | 1936 |
| 239 | Ga0209967_1002053 | 3300027364 | Bacteria | 2598 |
| 240 | Ga0268265_10006043 | 3300028380 | Bacteria | 8229 |
| 241 | Ga0268265_10010425 | 3300028380 | Bacteria | 6275 |
| 242 | Ga0268264_10032820 | 3300028381 | Bacteria | 4260 |
| 243 | Ga0268264_10089122 | 3300028381 | Bacteria | 2656 |
| 244 | Ga0268264_10159489 | 3300028381 | Bacteria | 2030 |
| 245 | Ga0268264_10317730 | 3300028381 | Bacteria | 1471 |
| 246 | Ga0265330_10027152 | 3300031235 | Bacteria | 2587 |
| 247 | Ga0265332_10038204 | 3300031238 | Bacteria | 2080 |
| 248 | Ga0265331_10032470 | 3300031250 | Bacteria | 2587 |
| 249 | Ga0307513_10000020 | 3300031456 | Bacteria | 228745 |
| 250 | Ga0307408_100000663 | 3300031548 | Bacteria | 28685 |
| 251 | Ga0307408_100129220 | 3300031548 | Bacteria | 1969 |
| 252 | Ga0316575_10002071 | 3300031665 | Bacteria | 6684 |
| 253 | Ga0265314_10010145 | 3300031711 | Bacteria | 7893 |
| 254 | Ga0265342_10054163 | 3300031712 | Bacteria | 2385 |
| 255 | Ga0307516_10004689 | 3300031730 | Bacteria | 16729 |
| 256 | Ga0307516_10034258 | 3300031730 | Bacteria | 5105 |
| 257 | Ga0307413_10089072 | 3300031824 | Bacteria | 2004 |
| 258 | Ga0307406_10032915 | 3300031901 | Bacteria | 3168 |
| 259 | Ga0307411_10250562 | 3300032005 | Bacteria | 1392 |
| 260 | Ga0373934_0003709 | 3300035086 | Bacteria | 5622 |
| 261 | Ga0316582_0014186 | 3300036647 | Bacteria | 4513 |
| 262 | Ga0316584_0009401 | 3300036712 | Bacteria | 6786 |
| 263 | Ga0395899_0007775 | 3300037312 | Bacteria | 8268 |
| 264 | Ga0395899_0029114 | 3300037312 | Bacteria | 4153 |
| 265 | Ga0395899_0182292 | 3300037312 | Bacteria | 1473 |
| 266 | Ga0395900_0018346 | 3300037418 | Bacteria | 7137 |
| 267 | Ga0395900_0044296 | 3300037418 | Bacteria | 4585 |
| 268 | Ga0395900_0101488 | 3300037418 | Bacteria | 2955 |
| 269 | Ga0395900_0116640 | 3300037418 | Bacteria | 2740 |
| 270 | Ga0395900_0218458 | 3300037418 | Bacteria | 1922 |
| 271 | Ga0395898_0087849 | 3300037466 | Bacteria | 2994 |
| 272 | Ga0395905_0020754 | 3300037471 | Bacteria | 6220 |
| 273 | Ga0395905_0038486 | 3300037471 | Bacteria | 4488 |
| 274 | Ga0395905_0091419 | 3300037471 | Bacteria | 2853 |
| 275 | Ga0395905_0118442 | 3300037471 | Bacteria | 2489 |
| 276 | Ga0316581_0001344 | 3300037588 | Bacteria | 5463 |
| 277 | Ga0395901_0000106 | 3300038443 | Bacteria | 114313 |
| 278 | Ga0395901_0010702 | 3300038443 | Bacteria | 9299 |
| 279 | Ga0395901_0204039 | 3300038443 | Bacteria | 2072 |
| 280 | Ga0395901_0414245 | 3300038443 | Bacteria | 1383 |
| 281 | Ga0400490_31124 | 3300038726 | Bacteria | 15244 |
| 282 | Ga0400487_36792 | 3300039110 | Bacteria | 1780 |
| 283 | Ga0439436_0000303 | 3300041404 | Bacteria | 11979 |
| 284 | Ga0439461_0010328 | 3300041410 | Bacteria | 1711 |
| 285 | Ga0439466_0021036 | 3300041411 | Bacteria | 2318 |
| 286 | Ga0439465_0000048 | 3300041413 | Bacteria | 25346 |
| 287 | Ga0451853_1767617 | 3300041512 | Bacteria | 1099 |
| 288 | Ga0439431_0000579 | 3300041997 | Bacteria | 7786 |
| 289 | Ga0439433_0000329 | 3300041999 | Bacteria | 8358 |
| 290 | Ga0439445_0000168 | 3300042004 | Bacteria | 11631 |
| 291 | Ga0439432_000367 | 3300042006 | Bacteria | 16615 |
| 292 | Ga0439449_0000231 | 3300042007 | Bacteria | 20096 |
| 293 | Ga0439452_004237 | 3300042010 | Bacteria | 4853 |
| 294 | Ga0439457_008861 | 3300042014 | Bacteria | 2359 |
| 295 | Ga0439446_0000246 | 3300042156 | Bacteria | 10064 |
| 296 | Ga0439446_0019764 | 3300042156 | Bacteria | 1894 |
| 297 | Ga0439458_0030004 | 3300042157 | Bacteria | 1293 |
| 298 | Ga0439434_0001283 | 3300042435 | Bacteria | 7237 |
| 299 | Ga0439435_0000951 | 3300042436 | Bacteria | 5034 |
| 300 | Ga0439460_0002488 | 3300042461 | Bacteria | 4445 |
| 301 | Ga0450893_0005650 | 3300042532 | Bacteria | 2013 |
| 302 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 303 | Ga0451577_0022821 | 3300042876 | Bacteria | 5713 |
| 304 | Ga0451577_0275502 | 3300042876 | Bacteria | 1524 |
| 305 | Ga0466969_0007002 | 3300044656 | Bacteria | 5999 |
| 306 | Ga0466969_0044833 | 3300044656 | Bacteria | 2198 |
| 307 | Ga0453683_0000003 | 3300044673 | Bacteria | 942572 |
| 308 | Ga0466966_0002275 | 3300044684 | Bacteria | 12510 |
| 309 | Ga0466966_0097189 | 3300044684 | Bacteria | 1824 |
| 310 | Ga0466961_0014688 | 3300044693 | Bacteria | 5031 |
| 311 | Ga0466961_0226496 | 3300044693 | Bacteria | 1151 |
| 312 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 313 | Ga0453684_0000221 | 3300044712 | Bacteria | 249908 |
| 314 | Ga0453684_0199405 | 3300044712 | Bacteria | 2334 |
| 315 | Ga0466968_0097218 | 3300044735 | Bacteria | 1311 |
| 316 | Ga0466959_0019212 | 3300045049 | Bacteria | 5024 |
| 317 | Ga0451576_0000004 | 3300045051 | Bacteria | 1312238 |
| 318 | Ga0451576_0016175 | 3300045051 | Bacteria | 8242 |
| 319 | Ga0495592_0007645 | 3300046454 | Bacteria | 8092 |
| 320 | Ga0495603_0064578 | 3300046455 | Bacteria | 2158 |
| 321 | Ga0495651_0162131 | 3300046462 | Bacteria | 1601 |
| 322 | Ga0495653_0038748 | 3300046463 | Bacteria | 3739 |
| 323 | Ga0495585_0003401 | 3300046492 | Bacteria | 10774 |
| 324 | Ga0495585_0021515 | 3300046492 | Bacteria | 3702 |
| 325 | Ga0495607_0039868 | 3300046501 | Bacteria | 2802 |
| 326 | Ga0495606_0008218 | 3300046507 | Bacteria | 9122 |
| 327 | Ga0495637_0023448 | 3300046520 | Bacteria | 2805 |
| 328 | Ga0495637_0025557 | 3300046520 | Bacteria | 2660 |
| 329 | Ga0495637_0030350 | 3300046520 | Bacteria | 2399 |
| 330 | Ga0495643_0115262 | 3300046522 | Bacteria | 1362 |
| 331 | Ga0495656_0004741 | 3300046615 | Bacteria | 4674 |
| 332 | Ga0495656_0038229 | 3300046615 | Bacteria | 1986 |
| 333 | Ga0495661_0000028 | 3300046665 | Bacteria | 182191 |
| 334 | Ga0495588_0171611 | 3300046674 | Bacteria | 1147 |
| 335 | Ga0495649_0018805 | 3300046694 | Bacteria | 3881 |
| 336 | Ga0495683_0000216 | 3300047323 | Bacteria | 54311 |
| 337 | Ga0496105_0340688 | 3300048908 | Bacteria | 1199 |
| 338 | Ga0496111_0031335 | 3300048914 | Bacteria | 3787 |
| 339 | Ga0496113_0477391 | 3300048916 | Bacteria | 1002 |
| 340 | Ga0496114_0008446 | 3300048917 | Bacteria | 8158 |
| 341 | Ga0495678_034477 | 3300049459 | Bacteria | 2082 |
| 342 | Ga0501031_0003738 | 3300049568 | Bacteria | 9794 |
| 343 | Ga0501031_0008819 | 3300049568 | Bacteria | 6557 |
| 344 | Ga0501032_0000513 | 3300049569 | Bacteria | 31489 |
| 345 | Ga0501032_0003360 | 3300049569 | Bacteria | 12282 |
| 346 | Ga0501032_0018637 | 3300049569 | Bacteria | 4859 |
| 347 | Ga0501032_0083014 | 3300049569 | Bacteria | 2131 |
| 348 | Ga0501032_0204804 | 3300049569 | Unclassified | 1287 |
| 349 | Ga0501032_0243782 | 3300049569 | Unclassified | 1167 |
| 350 | Ga0501033_0000642 | 3300049570 | Bacteria | 32324 |
| 351 | Ga0501033_0001649 | 3300049570 | Bacteria | 19561 |
| 352 | Ga0501033_0003123 | 3300049570 | Bacteria | 13759 |
| 353 | Ga0501033_0009527 | 3300049570 | Bacteria | 7474 |
| 354 | Ga0501033_0034503 | 3300049570 | Bacteria | 3794 |
| 355 | Ga0501033_0061751 | 3300049570 | Bacteria | 2761 |
| 356 | Ga0501034_0004519 | 3300049571 | Bacteria | 15470 |
| 357 | Ga0501034_0004851 | 3300049571 | Bacteria | 14846 |
| 358 | Ga0501034_0052607 | 3300049571 | Bacteria | 4102 |
| 359 | Ga0501034_0135696 | 3300049571 | Bacteria | 2441 |
| 360 | Ga0501034_0209060 | 3300049571 | Bacteria | 1907 |
| 361 | Ga0501034_0284578 | 3300049571 | Bacteria | 1592 |
| 362 | Ga0501036_0005883 | 3300049572 | Bacteria | 9936 |
| 363 | Ga0501036_0032543 | 3300049572 | Bacteria | 4406 |
| 364 | Ga0501036_0046589 | 3300049572 | Bacteria | 3672 |
| 365 | Ga0501036_0081356 | 3300049572 | Bacteria | 2737 |
| 366 | Ga0501036_0101880 | 3300049572 | Bacteria | 2429 |
| 367 | Ga0501036_0104306 | 3300049572 | Bacteria | 2397 |
| 368 | Ga0501037_0016812 | 3300049573 | Bacteria | 5382 |
| 369 | Ga0501037_0046452 | 3300049573 | Bacteria | 3184 |
| 370 | Ga0501037_0108638 | 3300049573 | Bacteria | 1999 |
| 371 | Ga0501038_0001864 | 3300049574 | Bacteria | 19473 |
| 372 | Ga0501038_0003563 | 3300049574 | Bacteria | 14485 |
| 373 | Ga0501038_0008871 | 3300049574 | Bacteria | 9229 |
| 374 | Ga0501038_0012706 | 3300049574 | Bacteria | 7694 |
| 375 | Ga0501038_0036219 | 3300049574 | Bacteria | 4331 |
| 376 | Ga0501038_0103301 | 3300049574 | Bacteria | 2370 |
| 377 | Ga0501038_0159415 | 3300049574 | Bacteria | 1835 |
| 378 | Ga0501038_0246458 | 3300049574 | Bacteria | 1417 |
| 379 | Ga0501039_0004141 | 3300049575 | Bacteria | 10912 |
| 380 | Ga0501039_0027918 | 3300049575 | Bacteria | 4341 |
| 381 | Ga0501039_0045464 | 3300049575 | Bacteria | 3392 |
| 382 | Ga0501039_0435636 | 3300049575 | Bacteria | 1029 |
| 383 | Ga0501040_0006982 | 3300049576 | Bacteria | 7317 |
| 384 | Ga0501041_0003873 | 3300049577 | Bacteria | 8613 |
| 385 | Ga0501041_0008410 | 3300049577 | Bacteria | 6069 |
| 386 | Ga0501042_0000414 | 3300049578 | Bacteria | 21617 |
| 387 | Ga0501042_0019177 | 3300049578 | Bacteria | 4746 |
| 388 | Ga0501043_0015183 | 3300049579 | Bacteria | 6030 |
| 389 | Ga0501043_0033195 | 3300049579 | Bacteria | 4059 |
| 390 | Ga0501043_0049398 | 3300049579 | Bacteria | 3307 |
| 391 | Ga0501043_0063547 | 3300049579 | Bacteria | 2899 |
| 392 | Ga0501043_0087319 | 3300049579 | Bacteria | 2451 |
| 393 | Ga0501043_0151427 | 3300049579 | Bacteria | 1815 |
| 394 | Ga0501043_0228093 | 3300049579 | Bacteria | 1439 |
| 395 | Ga0501046_0003766 | 3300049580 | Bacteria | 13882 |
| 396 | Ga0501046_0005744 | 3300049580 | Bacteria | 11070 |
| 397 | Ga0501046_0006547 | 3300049580 | Bacteria | 10300 |
| 398 | Ga0501046_0015457 | 3300049580 | Bacteria | 6411 |
| 399 | Ga0501046_0172715 | 3300049580 | Bacteria | 1621 |
| 400 | Ga0501046_0349191 | 3300049580 | Bacteria | 1074 |
| 401 | Ga0501046_0374500 | 3300049580 | Bacteria | 1031 |
| 402 | Ga0501047_0002389 | 3300049581 | Bacteria | 17950 |
| 403 | Ga0501047_0026382 | 3300049581 | Bacteria | 5590 |
| 404 | Ga0501047_0134179 | 3300049581 | Bacteria | 2356 |
| 405 | Ga0501047_0152038 | 3300049581 | Bacteria | 2190 |
| 406 | Ga0501048_0004042 | 3300049582 | Bacteria | 11161 |
| 407 | Ga0501048_0144003 | 3300049582 | Bacteria | 1685 |
| 408 | Ga0501048_0161837 | 3300049582 | Bacteria | 1584 |
| 409 | Ga0501067_0022921 | 3300049583 | Bacteria | 3458 |
| 410 | Ga0501067_0137567 | 3300049583 | Bacteria | 1360 |
| 411 | Ga0501068_0001118 | 3300049584 | Bacteria | 14194 |
| 412 | Ga0501068_0003049 | 3300049584 | Bacteria | 8948 |
| 413 | Ga0501069_0111690 | 3300049585 | Bacteria | 1557 |
| 414 | Ga0501070_0092078 | 3300049586 | Bacteria | 2509 |
| 415 | Ga0501070_0154857 | 3300049586 | Bacteria | 1890 |
| 416 | Ga0501071_0063001 | 3300049587 | Bacteria | 2688 |
| 417 | Ga0501072_0001234 | 3300049588 | Bacteria | 19087 |
| 418 | Ga0501072_0006891 | 3300049588 | Bacteria | 8628 |
| 419 | Ga0501072_0115192 | 3300049588 | Bacteria | 2140 |
| 420 | Ga0501073_0000651 | 3300049589 | Bacteria | 24370 |
| 421 | Ga0501073_0011761 | 3300049589 | Bacteria | 6390 |
| 422 | Ga0501073_0196885 | 3300049589 | Bacteria | 1393 |
| 423 | Ga0501074_0080899 | 3300049590 | Bacteria | 2330 |
| 424 | Ga0501074_0276115 | 3300049590 | Bacteria | 1195 |
| 425 | Ga0501075_0001487 | 3300049591 | Bacteria | 15267 |
| 426 | Ga0501075_0082241 | 3300049591 | Bacteria | 2439 |
| 427 | Ga0501076_0000390 | 3300049592 | Bacteria | 27421 |
| 428 | Ga0501076_0014479 | 3300049592 | Bacteria | 5943 |
| 429 | Ga0501077_0041715 | 3300049593 | Bacteria | 2920 |
| 430 | Ga0501077_0076293 | 3300049593 | Bacteria | 2123 |
| 431 | Ga0501079_0000671 | 3300049741 | Bacteria | 22952 |
| 432 | Ga0501079_0005364 | 3300049741 | Bacteria | 9549 |
| 433 | Ga0501079_0042012 | 3300049741 | Bacteria | 3531 |
| 434 | Ga0501079_0103831 | 3300049741 | Bacteria | 2205 |
| 435 | Ga0501080_0000604 | 3300049742 | Bacteria | 28440 |
| 436 | Ga0501080_0001385 | 3300049742 | Bacteria | 20314 |
| 437 | Ga0501080_0052868 | 3300049742 | Bacteria | 3781 |
| 438 | Ga0501080_0070964 | 3300049742 | Bacteria | 3239 |
| 439 | Ga0501080_0142327 | 3300049742 | Bacteria | 2217 |
| 440 | Ga0501081_0021037 | 3300049743 | Bacteria | 4353 |
| 441 | Ga0501081_0067666 | 3300049743 | Bacteria | 2486 |
| 442 | Ga0501083_0011296 | 3300049744 | Bacteria | 6264 |
| 443 | Ga0501083_0174303 | 3300049744 | Bacteria | 1406 |
| 444 | Ga0501263_007765 | 3300049760 | Bacteria | 1267 |
| 445 | Ga0501035_0000924 | 3300049822 | Bacteria | 31097 |
| 446 | Ga0501035_0003294 | 3300049822 | Bacteria | 15480 |
| 447 | Ga0501035_0012426 | 3300049822 | Bacteria | 7870 |
| 448 | Ga0501035_0015998 | 3300049822 | Bacteria | 6922 |
| 449 | Ga0501035_0040431 | 3300049822 | Bacteria | 4213 |
| 450 | Ga0501035_0049991 | 3300049822 | Bacteria | 3748 |
| 451 | Ga0501035_0205689 | 3300049822 | Bacteria | 1686 |
| 452 | Ga0501035_0226067 | 3300049822 | Bacteria | 1596 |
| 453 | Ga0501035_0433964 | 3300049822 | Bacteria | 1089 |
| 454 | Ga0501044_0016769 | 3300049823 | Bacteria | 7861 |
| 455 | Ga0501044_0036876 | 3300049823 | Bacteria | 5113 |
| 456 | Ga0501044_0107000 | 3300049823 | Bacteria | 2808 |
| 457 | Ga0501044_0134960 | 3300049823 | Bacteria | 2459 |
| 458 | Ga0501044_0163262 | 3300049823 | Bacteria | 2203 |
| 459 | Ga0501044_0193810 | 3300049823 | Bacteria | 1993 |
| 460 | Ga0501044_0456159 | 3300049823 | Bacteria | 1184 |
| 461 | Ga0501045_0015455 | 3300049824 | Bacteria | 5416 |
| 462 | Ga0501045_0017009 | 3300049824 | Bacteria | 5164 |
| 463 | Ga0501045_0245007 | 3300049824 | Bacteria | 1334 |
| 464 | nmdc:mga03683_137738_c1 | 3300050489 | Bacteria | 1095 |
| 465 | nmdc:mga03683_138159_c1 | 3300050489 | Bacteria | 1094 |
| 466 | nmdc:mga03n38_139258_c1 | 3300050490 | Bacteria | 1210 |
| 467 | nmdc:mga03n38_97943_c1 | 3300050490 | Bacteria | 1409 |
| 468 | nmdc:mga0yw44_163702_c1 | 3300050492 | Bacteria | 1457 |
| 469 | nmdc:mga0yw44_81635_c1 | 3300050492 | Bacteria | 2027 |
| 470 | nmdc:mga0yw44_978_c2 | 3300050492 | Bacteria | 8791 |
| 471 | nmdc:mga0k408_18145_c1 | 3300050493 | Bacteria | 3925 |
| 472 | nmdc:mga0k408_244362_c1 | 3300050493 | Bacteria | 1072 |
| 473 | nmdc:mga0k408_72297_c1 | 3300050493 | Bacteria | 2014 |
| 474 | nmdc:mga07m45_6978_c2 | 3300050496 | Bacteria | 4900 |
| 475 | nmdc:mga09592_212866_c1 | 3300050508 | Bacteria | 1675 |
| 476 | nmdc:mga0qj67_45279_c1 | 3300050509 | Bacteria | 3472 |
| 477 | nmdc:mga06r32_96040_c1 | 3300050510 | Bacteria | 2902 |
| 478 | nmdc:mga08y16_542150_c1 | 3300050511 | Bacteria | 1178 |
| 479 | nmdc:mga08y16_99789_c1 | 3300050511 | Bacteria | 3023 |
| 480 | Ga0500644_0000994 | 3300053088 | Bacteria | 8812 |
| 481 | Ga0500583_0129856 | 3300053092 | Bacteria | 1249 |
| 482 | Ga0500593_000342 | 3300053117 | Bacteria | 18749 |
| 483 | Ga0500618_011021 | 3300053125 | Bacteria | 2409 |
| 484 | Ga0500559_0116670 | 3300053136 | Bacteria | 1240 |
| 485 | Ga0500622_0023198 | 3300053156 | Bacteria | 3287 |
| 486 | Ga0500634_0008881 | 3300053161 | Bacteria | 5049 |
| 487 | Ga0500645_002662 | 3300053730 | Bacteria | 7781 |
| 488 | Ga0500645_009503 | 3300053730 | Bacteria | 3264 |
| 489 | Ga0500645_013714 | 3300053730 | Bacteria | 2596 |
| 490 | Ga0501084_0018543 | 3300054114 | Bacteria | 5792 |
| 491 | Ga0501084_0030682 | 3300054114 | Bacteria | 4495 |
| 492 | Ga0501084_0083766 | 3300054114 | Bacteria | 2677 |
| 493 | Ga0501084_0323175 | 3300054114 | Bacteria | 1303 |
| 494 | Ga0501082_0006976 | 3300060353 | Bacteria | 9754 |
| 495 | Ga0501082_0007048 | 3300060353 | Bacteria | 9702 |
| 496 | Ga0501082_0034724 | 3300060353 | Bacteria | 4347 |
| 497 | Ga0501082_0099424 | 3300060353 | Bacteria | 2515 |
| 498 | Ga0530510_0041974 | 3300061734 | Bacteria | 3303 |
| 499 | Ga0530510_0097553 | 3300061734 | Bacteria | 2149 |
| 500 | 2510251784 | 2510065045 | Bacteria | 7761063 |
| 501 | 2550693927 | 2548876994 | Bacteria | 4904866 |
| 502 | 2644059734 | 2643221609 | Bacteria | 6756331 |
| 503 | 2644074877 | 2643221611 | Bacteria | 6820941 |
| 504 | 2719640895 | 2718217991 | Bacteria | 7829542 |
| 505 | 2738715137 | 2738541276 | Bacteria | 4690596 |
| 506 | 2739288174 | 2738543020 | Bacteria | 5718238 |
| 507 | 2739293497 | 2738543021 | Bacteria | 5718241 |
| 508 | 2739612192 | 2739367655 | Bacteria | 4051151 |
| 509 | 2808984483 | 2808606386 | Bacteria | 4471946 |
| 510 | 2809131210 | 2808606415 | Bacteria | 4576710 |
| 511 | 2809150455 | 2808606419 | Bacteria | 4576925 |
| 512 | 2852621971 | 2852618963 | Bacteria | 4577824 |
| 513 | 2881930291 | 2881927736 | Bacteria | 3993927 |
| 514 | 3007253141 | 3007252601 | Bacteria | 4559114 |
| 515 | 3007318081 | 3007315729 | Bacteria | 5076637 |
| 516 | Ga0501044_0100406 | |||
| 517 | JGI25155J39150_1000041 | |||
| 518 | JGI25154J39366_1000532 | |||
| 519 | JGI25157J39369_1000021 | |||
| 520 | JGI25150J39212_1008690 | |||
| 521 | JGI25159J45721_1002903 | |||
| 522 | JGI25159J45721_1002920 | |||
| 523 | JGI25151J46595_10000203 | |||
| 524 | JGI25151J46595_10005774 | |||
| 525 | JGI25151J46595_10006188 | |||
| 526 | rootH1_10016625 | |||
| 527 | rootH1_10040961 | |||
| 528 | rootH2_10040300 | |||
| 529 | rootH1_10042792 | |||
| 530 | rootH1_10066965 | |||
| 531 | JGI25160J50197_1000784 | |||
| 532 | JGI25161J50226_1000042 | |||
| 533 | Ga0055539_1001038 | |||
| 534 | Ga0055539_1004990 | |||
| 535 | Ga0055533_1000033 | |||
| 536 | Ga0055525_1001031 | |||
| 537 | Ga0055526_1013276 | |||
| 538 | Ga0055537_1000897 | |||
| 539 | Ga0055524_1000260 | |||
| 540 | Ga0055536_1006790 | |||
| 541 | Ga0055534_1002028 | |||
| 542 | Ga0055528_1001244 | |||
| 543 | Ga0055530_10004910 | |||
| 544 | Ga0055540_1000010 | |||
| 545 | Ga0055531_10008678 | |||
| 546 | Ga0055531_10014544 | |||
| 547 | Ga0055543_1000279 | |||
| 548 | Ga0065165_1006407 | |||
| 549 | Ga0065707_10212760 | |||
| 550 | Ga0070658_10004301 | |||
| 551 | Ga0070658_10064261 | |||
| 552 | Ga0070658_10300157 | |||
| 553 | Ga0070690_100000845 | |||
| 554 | Ga0068869_100002558 | |||
| 555 | Ga0068869_100059314 | |||
| 556 | Ga0068869_100079578 | |||
| 557 | Ga0070680_100060160 | |||
| 558 | Ga0070680_100238078 | |||
| 559 | Ga0070660_100038465 | |||
| 560 | Ga0070660_100201471 | |||
| 561 | Ga0070660_100223664 | |||
| 562 | Ga0070689_100004467 | |||
| 563 | Ga0070661_100315318 | |||
| 564 | Ga0070692_10019632 | |||
| 565 | Ga0070668_100007129 | |||
| 566 | Ga0070668_100018023 | |||
| 567 | Ga0070669_100025721 | |||
| 568 | Ga0070673_100289278 | |||
| 569 | Ga0070673_100326907 | |||
| 570 | Ga0070673_100432415 | |||
| 571 | Ga0070688_100155194 | |||
| 572 | Ga0070710_10030300 | |||
| 573 | Ga0070700_100000846 | |||
| 574 | Ga0070700_100078022 | |||
| 575 | Ga0070700_100186838 | |||
| 576 | Ga0070694_100118275 | |||
| 577 | Ga0070694_100236823 | |||
| 578 | Ga0070663_100063775 | |||
| 579 | Ga0070678_100016566 | |||
| 580 | Ga0070678_100142623 | |||
| 581 | Ga0070681_10217992 | |||
| 582 | Ga0068867_100012057 | |||
| 583 | Ga0068867_100029458 | |||
| 584 | Ga0068853_100086990 | |||
| 585 | Ga0070686_100001455 | |||
| 586 | Ga0070695_100056225 | |||
| 587 | Ga0070696_100086516 | |||
| 588 | Ga0070693_100037034 | |||
| 589 | Ga0070665_100072404 | |||
| 590 | Ga0070704_100003101 | |||
| 591 | Ga0068855_100000854 | |||
| 592 | Ga0068855_100001935 | |||
| 593 | Ga0068857_100035333 | |||
| 594 | Ga0068857_100428262 | |||
| 595 | Ga0068854_100005269 | |||
| 596 | Ga0068854_100067827 | |||
| 597 | Ga0068856_100002812 | |||
| 598 | Ga0068856_100145271 | |||
| 599 | Ga0070702_100001220 | |||
| 600 | Ga0068859_100007107 | |||
| 601 | Ga0068859_100772820 | |||
| 602 | Ga0068866_10000235 | |||
| 603 | Ga0068866_10036970 | |||
| 604 | Ga0068861_100032646 | |||
| 605 | Ga0068861_100047909 | |||
| 606 | Ga0068870_10005533 | |||
| 607 | Ga0068863_100085641 | |||
| 608 | Ga0068863_100278337 | |||
| 609 | Ga0068858_100002549 | |||
| 610 | Ga0068860_100009873 | |||
| 611 | Ga0068860_100011681 | |||
| 612 | Ga0068860_100194861 | |||
| 613 | Ga0068862_100005397 | |||
| 614 | Ga0068862_100035873 | |||
| 615 | Ga0068862_100137531 | |||
| 616 | Ga0068862_100146870 | |||
| 617 | Ga0075365_10036287 | |||
| 618 | Ga0075365_10092291 | |||
| 619 | Ga0075432_10013163 | |||
| 620 | Ga0075362_10032027 | |||
| 621 | Ga0075367_10016611 | |||
| 622 | Ga0075366_10250647 | |||
| 623 | Ga0075370_10037855 | |||
| 624 | Ga0068871_100057290 | |||
| 625 | Ga0075428_100148162 | |||
| 626 | Ga0075430_100039430 | |||
| 627 | Ga0075431_100299598 | |||
| 628 | Ga0068865_100000229 | |||
| 629 | Ga0068865_100162223 | |||
| 630 | Ga0097620_100007107 | |||
| 631 | Ga0097620_100772783 | |||
| 632 | Ga0105240_10103450 | |||
| 633 | Ga0105240_10251666 | |||
| 634 | Ga0105240_10350446 | |||
| 635 | Ga0111539_10323826 | |||
| 636 | Ga0105245_10000613 | |||
| 637 | Ga0105243_10004808 | |||
| 638 | Ga0105242_10000678 | |||
| 639 | Ga0105248_10104615 | |||
| 640 | Ga0105237_10067786 | |||
| 641 | Ga0105237_10158056 | |||
| 642 | Ga0105249_10008913 | |||
| 643 | Ga0105249_10012098 | |||
| 644 | Ga0105239_10088857 | |||
| 645 | Ga0157326_1001451 | |||
| 646 | Ga0157370_10003417 | |||
| 647 | Ga0157370_10010884 | |||
| 648 | Ga0157370_10021458 | |||
| 649 | Ga0157369_10024680 | |||
| 650 | Ga0157369_10242406 | |||
| 651 | Ga0157374_10174958 | |||
| 652 | Ga0157378_10001171 | |||
| 653 | Ga0157378_10114889 | |||
| 654 | Ga0163162_10130796 | |||
| 655 | Ga0157375_10320144 | |||
| 656 | Ga0163163_10428270 | |||
| 657 | Ga0157380_10001394 | |||
| 658 | Ga0157380_10018325 | |||
| 659 | Ga0157380_10033173 | |||
| 660 | Ga0182008_10005703 | |||
| 661 | Ga0157379_10110312 | |||
| 662 | Ga0157379_10124390 | |||
| 663 | Ga0182006_1033026 | |||
| 664 | Ga0182007_10008951 | |||
| 665 | Ga0182005_1023964 | |||
| 666 | Ga0209674_100064 | |||
| 667 | Ga0209563_100126 | |||
| 668 | Ga0207427_101069 | |||
| 669 | Ga0207425_1003810 | |||
| 670 | Ga0209646_1000060 | |||
| 671 | Ga0209026_1000049 | |||
| 672 | Ga0209677_100099 | |||
| 673 | Ga0209677_100229 | |||
| 674 | Ga0209759_1000069 | |||
| 675 | Ga0209565_1000462 | |||
| 676 | Ga0209673_1000008 | |||
| 677 | Ga0209130_1000216 | |||
| 678 | Ga0209130_1001740 | |||
| 679 | Ga0209675_1000400 | |||
| 680 | Ga0209675_1015447 | |||
| 681 | Ga0209676_1000007 | |||
| 682 | Ga0209676_1005634 | |||
| 683 | Ga0209025_1007550 | |||
| 684 | Ga0209025_1010246 | |||
| 685 | Ga0209025_1014775 | |||
| 686 | Ga0209564_1002817 | |||
| 687 | Ga0209564_1004210 | |||
| 688 | Ga0209564_1007216 | |||
| 689 | Ga0209050_1000003 | |||
| 690 | Ga0209050_1009272 | |||
| 691 | Ga0209050_1009597 | |||
| 692 | Ga0209256_1000001 | |||
| 693 | Ga0207426_1000117 | |||
| 694 | Ga0207426_1016077 | |||
| 695 | Ga0207426_1050062 | |||
| 696 | Ga0209051_1000003 | |||
| 697 | Ga0209051_1000244 | |||
| 698 | Ga0209257_1000020 | |||
| 699 | Ga0209257_1000144 | |||
| 700 | Ga0209257_1007579 | |||
| 701 | Ga0207656_10110882 | |||
| 702 | Ga0207682_10049321 | |||
| 703 | Ga0207642_10001272 | |||
| 704 | Ga0207645_10043971 | |||
| 705 | Ga0207643_10006831 | |||
| 706 | Ga0207705_10003399 | |||
| 707 | Ga0207705_10097678 | |||
| 708 | Ga0207695_10124438 | |||
| 709 | Ga0207660_10059979 | |||
| 710 | Ga0207662_10049408 | |||
| 711 | Ga0207657_10005722 | |||
| 712 | Ga0207657_10098414 | |||
| 713 | Ga0207681_10009331 | |||
| 714 | Ga0207681_10046474 | |||
| 715 | Ga0207644_10043818 | |||
| 716 | Ga0207686_10005352 | |||
| 717 | Ga0207670_10004995 | |||
| 718 | Ga0207704_10000551 | |||
| 719 | Ga0207704_10005451 | |||
| 720 | Ga0207691_10046386 | |||
| 721 | Ga0207711_10089600 | |||
| 722 | Ga0207711_10127666 | |||
| 723 | Ga0207689_10000136 | |||
| 724 | Ga0207689_10073835 | |||
| 725 | Ga0207689_10087023 | |||
| 726 | Ga0207661_10019127 | |||
| 727 | Ga0207667_10002571 | |||
| 728 | Ga0207667_10016348 | |||
| 729 | Ga0207651_10097155 | |||
| 730 | Ga0207651_10169124 | |||
| 731 | Ga0207651_10261477 | |||
| 732 | Ga0207712_10057615 | |||
| 733 | Ga0207712_10074836 | |||
| 734 | Ga0207668_10084965 | |||
| 735 | Ga0207703_10055397 | |||
| 736 | Ga0207639_10060757 | |||
| 737 | Ga0207708_10001168 | |||
| 738 | Ga0207708_10004098 | |||
| 739 | Ga0207708_10201765 | |||
| 740 | Ga0207702_10002287 | |||
| 741 | Ga0207641_10078085 | |||
| 742 | Ga0207641_10092410 | |||
| 743 | Ga0207641_10138084 | |||
| 744 | Ga0207648_10000485 | |||
| 745 | Ga0207648_10004350 | |||
| 746 | Ga0207675_100000213 | |||
| 747 | Ga0207675_100011315 | |||
| 748 | Ga0207675_100111779 | |||
| 749 | Ga0207675_100466884 | |||
| 750 | Ga0207683_10023921 | |||
| 751 | Ga0207683_10028497 | |||
| 752 | Ga0207683_10092410 | |||
| 753 | Ga0207698_10166304 | |||
| 754 | Ga0209967_1002053 | |||
| 755 | Ga0268265_10006043 | |||
| 756 | Ga0268265_10010425 | |||
| 757 | Ga0268264_10032820 | |||
| 758 | Ga0268264_10089122 | |||
| 759 | Ga0268264_10159489 | |||
| 760 | Ga0268264_10317730 | |||
| 761 | Ga0265330_10027152 | |||
| 762 | Ga0265332_10038204 | |||
| 763 | Ga0265331_10032470 | |||
| 764 | Ga0307513_10000020 | |||
| 765 | Ga0307408_100000663 | |||
| 766 | Ga0307408_100129220 | |||
| 767 | Ga0316575_10002071 | |||
| 768 | Ga0265314_10010145 | |||
| 769 | Ga0265342_10054163 | |||
| 770 | Ga0307516_10004689 | |||
| 771 | Ga0307516_10034258 | |||
| 772 | Ga0307413_10089072 | |||
| 773 | Ga0307406_10032915 | |||
| 774 | Ga0307411_10250562 | |||
| 775 | Ga0373934_0003709 | |||
| 776 | Ga0316582_0014186 | |||
| 777 | Ga0316584_0009401 | |||
| 778 | Ga0395899_0007775 | |||
| 779 | Ga0395899_0029114 | |||
| 780 | Ga0395899_0182292 | |||
| 781 | Ga0395900_0018346 | |||
| 782 | Ga0395900_0044296 | |||
| 783 | Ga0395900_0101488 | |||
| 784 | Ga0395900_0116640 | |||
| 785 | Ga0395900_0218458 | |||
| 786 | Ga0395898_0087849 | |||
| 787 | Ga0395905_0020754 | |||
| 788 | Ga0395905_0038486 | |||
| 789 | Ga0395905_0091419 | |||
| 790 | Ga0395905_0118442 | |||
| 791 | Ga0316581_0001344 | |||
| 792 | Ga0395901_0000106 | |||
| 793 | Ga0395901_0010702 | |||
| 794 | Ga0395901_0204039 | |||
| 795 | Ga0395901_0414245 | |||
| 796 | Ga0400490_31124 | |||
| 797 | Ga0400487_36792 | |||
| 798 | Ga0439436_0000303 | |||
| 799 | Ga0439461_0010328 | |||
| 800 | Ga0439466_0021036 | |||
| 801 | Ga0439465_0000048 | |||
| 802 | Ga0451853_1767617 | |||
| 803 | Ga0439431_0000579 | |||
| 804 | Ga0439433_0000329 | |||
| 805 | Ga0439445_0000168 | |||
| 806 | Ga0439432_000367 | |||
| 807 | Ga0439449_0000231 | |||
| 808 | Ga0439452_004237 | |||
| 809 | Ga0439457_008861 | |||
| 810 | Ga0439446_0000246 | |||
| 811 | Ga0439446_0019764 | |||
| 812 | Ga0439458_0030004 | |||
| 813 | Ga0439434_0001283 | |||
| 814 | Ga0439435_0000951 | |||
| 815 | Ga0439460_0002488 | |||
| 816 | Ga0450893_0005650 | |||
| 817 | Ga0451577_0000002 | |||
| 818 | Ga0451577_0022821 | |||
| 819 | Ga0451577_0275502 | |||
| 820 | Ga0466969_0007002 | |||
| 821 | Ga0466969_0044833 | |||
| 822 | Ga0453683_0000003 | |||
| 823 | Ga0466966_0002275 | |||
| 824 | Ga0466966_0097189 | |||
| 825 | Ga0466961_0014688 | |||
| 826 | Ga0466961_0226496 | |||
| 827 | Ga0453684_0000002 | |||
| 828 | Ga0453684_0000221 | |||
| 829 | Ga0453684_0199405 | |||
| 830 | Ga0466968_0097218 | |||
| 831 | Ga0466959_0019212 | |||
| 832 | Ga0451576_0000004 | |||
| 833 | Ga0451576_0016175 | |||
| 834 | Ga0495592_0007645 | |||
| 835 | Ga0495603_0064578 | |||
| 836 | Ga0495651_0162131 | |||
| 837 | Ga0495653_0038748 | |||
| 838 | Ga0495585_0003401 | |||
| 839 | Ga0495585_0021515 | |||
| 840 | Ga0495607_0039868 | |||
| 841 | Ga0495606_0008218 | |||
| 842 | Ga0495637_0023448 | |||
| 843 | Ga0495637_0025557 | |||
| 844 | Ga0495637_0030350 | |||
| 845 | Ga0495643_0115262 | |||
| 846 | Ga0495656_0004741 | |||
| 847 | Ga0495656_0038229 | |||
| 848 | Ga0495661_0000028 | |||
| 849 | Ga0495588_0171611 | |||
| 850 | Ga0495649_0018805 | |||
| 851 | Ga0495683_0000216 | |||
| 852 | Ga0496105_0340688 | |||
| 853 | Ga0496111_0031335 | |||
| 854 | Ga0496113_0477391 | |||
| 855 | Ga0496114_0008446 | |||
| 856 | Ga0495678_034477 | |||
| 857 | Ga0501031_0003738 | |||
| 858 | Ga0501031_0008819 | |||
| 859 | Ga0501032_0000513 | |||
| 860 | Ga0501032_0003360 | |||
| 861 | Ga0501032_0018637 | |||
| 862 | Ga0501032_0083014 | |||
| 863 | Ga0501032_0204804 | |||
| 864 | Ga0501032_0243782 | |||
| 865 | Ga0501033_0000642 | |||
| 866 | Ga0501033_0001649 | |||
| 867 | Ga0501033_0003123 | |||
| 868 | Ga0501033_0009527 | |||
| 869 | Ga0501033_0034503 | |||
| 870 | Ga0501033_0061751 | |||
| 871 | Ga0501034_0004519 | |||
| 872 | Ga0501034_0004851 | |||
| 873 | Ga0501034_0052607 | |||
| 874 | Ga0501034_0135696 | |||
| 875 | Ga0501034_0209060 | |||
| 876 | Ga0501034_0284578 | |||
| 877 | Ga0501036_0005883 | |||
| 878 | Ga0501036_0032543 | |||
| 879 | Ga0501036_0046589 | |||
| 880 | Ga0501036_0081356 | |||
| 881 | Ga0501036_0101880 | |||
| 882 | Ga0501036_0104306 | |||
| 883 | Ga0501037_0016812 | |||
| 884 | Ga0501037_0046452 | |||
| 885 | Ga0501037_0108638 | |||
| 886 | Ga0501038_0001864 | |||
| 887 | Ga0501038_0003563 | |||
| 888 | Ga0501038_0008871 | |||
| 889 | Ga0501038_0012706 | |||
| 890 | Ga0501038_0036219 | |||
| 891 | Ga0501038_0103301 | |||
| 892 | Ga0501038_0159415 | |||
| 893 | Ga0501038_0246458 | |||
| 894 | Ga0501039_0004141 | |||
| 895 | Ga0501039_0027918 | |||
| 896 | Ga0501039_0045464 | |||
| 897 | Ga0501039_0435636 | |||
| 898 | Ga0501040_0006982 | |||
| 899 | Ga0501041_0003873 | |||
| 900 | Ga0501041_0008410 | |||
| 901 | Ga0501042_0000414 | |||
| 902 | Ga0501042_0019177 | |||
| 903 | Ga0501043_0015183 | |||
| 904 | Ga0501043_0033195 | |||
| 905 | Ga0501043_0049398 | |||
| 906 | Ga0501043_0063547 | |||
| 907 | Ga0501043_0087319 | |||
| 908 | Ga0501043_0151427 | |||
| 909 | Ga0501043_0228093 | |||
| 910 | Ga0501046_0003766 | |||
| 911 | Ga0501046_0005744 | |||
| 912 | Ga0501046_0006547 | |||
| 913 | Ga0501046_0015457 | |||
| 914 | Ga0501046_0172715 | |||
| 915 | Ga0501046_0349191 | |||
| 916 | Ga0501046_0374500 | |||
| 917 | Ga0501047_0002389 | |||
| 918 | Ga0501047_0026382 | |||
| 919 | Ga0501047_0134179 | |||
| 920 | Ga0501047_0152038 | |||
| 921 | Ga0501048_0004042 | |||
| 922 | Ga0501048_0144003 | |||
| 923 | Ga0501048_0161837 | |||
| 924 | Ga0501067_0022921 | |||
| 925 | Ga0501067_0137567 | |||
| 926 | Ga0501068_0001118 | |||
| 927 | Ga0501068_0003049 | |||
| 928 | Ga0501069_0111690 | |||
| 929 | Ga0501070_0092078 | |||
| 930 | Ga0501070_0154857 | |||
| 931 | Ga0501071_0063001 | |||
| 932 | Ga0501072_0001234 | |||
| 933 | Ga0501072_0006891 | |||
| 934 | Ga0501072_0115192 | |||
| 935 | Ga0501073_0000651 | |||
| 936 | Ga0501073_0011761 | |||
| 937 | Ga0501073_0196885 | |||
| 938 | Ga0501074_0080899 | |||
| 939 | Ga0501074_0276115 | |||
| 940 | Ga0501075_0001487 | |||
| 941 | Ga0501075_0082241 | |||
| 942 | Ga0501076_0000390 | |||
| 943 | Ga0501076_0014479 | |||
| 944 | Ga0501077_0041715 | |||
| 945 | Ga0501077_0076293 | |||
| 946 | Ga0501079_0000671 | |||
| 947 | Ga0501079_0005364 | |||
| 948 | Ga0501079_0042012 | |||
| 949 | Ga0501079_0103831 | |||
| 950 | Ga0501080_0000604 | |||
| 951 | Ga0501080_0001385 | |||
| 952 | Ga0501080_0052868 | |||
| 953 | Ga0501080_0070964 | |||
| 954 | Ga0501080_0142327 | |||
| 955 | Ga0501081_0021037 | |||
| 956 | Ga0501081_0067666 | |||
| 957 | Ga0501083_0011296 | |||
| 958 | Ga0501083_0174303 | |||
| 959 | Ga0501263_007765 | |||
| 960 | Ga0501035_0000924 | |||
| 961 | Ga0501035_0003294 | |||
| 962 | Ga0501035_0012426 | |||
| 963 | Ga0501035_0015998 | |||
| 964 | Ga0501035_0040431 | |||
| 965 | Ga0501035_0049991 | |||
| 966 | Ga0501035_0205689 | |||
| 967 | Ga0501035_0226067 | |||
| 968 | Ga0501035_0433964 | |||
| 969 | Ga0501044_0016769 | |||
| 970 | Ga0501044_0036876 | |||
| 971 | Ga0501044_0107000 | |||
| 972 | Ga0501044_0134960 | |||
| 973 | Ga0501044_0163262 | |||
| 974 | Ga0501044_0193810 | |||
| 975 | Ga0501044_0456159 | |||
| 976 | Ga0501045_0015455 | |||
| 977 | Ga0501045_0017009 | |||
| 978 | Ga0501045_0245007 | |||
| 979 | nmdc:mga03683_137738_c1 | |||
| 980 | nmdc:mga03683_138159_c1 | |||
| 981 | nmdc:mga03n38_139258_c1 | |||
| 982 | nmdc:mga03n38_97943_c1 | |||
| 983 | nmdc:mga0yw44_163702_c1 | |||
| 984 | nmdc:mga0yw44_81635_c1 | |||
| 985 | nmdc:mga0yw44_978_c2 | |||
| 986 | nmdc:mga0k408_18145_c1 | |||
| 987 | nmdc:mga0k408_244362_c1 | |||
| 988 | nmdc:mga0k408_72297_c1 | |||
| 989 | nmdc:mga07m45_6978_c2 | |||
| 990 | nmdc:mga09592_212866_c1 | |||
| 991 | nmdc:mga0qj67_45279_c1 | |||
| 992 | nmdc:mga06r32_96040_c1 | |||
| 993 | nmdc:mga08y16_542150_c1 | |||
| 994 | nmdc:mga08y16_99789_c1 | |||
| 995 | Ga0500644_0000994 | |||
| 996 | Ga0500583_0129856 | |||
| 997 | Ga0500593_000342 | |||
| 998 | Ga0500618_011021 | |||
| 999 | Ga0500559_0116670 | |||
| 1000 | Ga0500622_0023198 | |||
| 1001 | Ga0500634_0008881 | |||
| 1002 | Ga0500645_002662 | |||
| 1003 | Ga0500645_009503 | |||
| 1004 | Ga0500645_013714 | |||
| 1005 | Ga0501084_0018543 | |||
| 1006 | Ga0501084_0030682 | |||
| 1007 | Ga0501084_0083766 | |||
| 1008 | Ga0501084_0323175 | |||
| 1009 | Ga0501082_0006976 | |||
| 1010 | Ga0501082_0007048 | |||
| 1011 | Ga0501082_0034724 | |||
| 1012 | Ga0501082_0099424 | |||
| 1013 | Ga0530510_0041974 | |||
| 1014 | Ga0530510_0097553 | |||
| 1015 | 2510251784 | |||
| 1016 | 2550693927 | |||
| 1017 | 2644059734 | |||
| 1018 | 2644074877 | |||
| 1019 | 2719640895 | |||
| 1020 | 2738715137 | |||
| 1021 | 2739288174 | |||
| 1022 | 2739293497 | |||
| 1023 | 2739612192 | |||
| 1024 | 2808984483 | |||
| 1025 | 2809131210 | |||
| 1026 | 2809150455 | |||
| 1027 | 2852621971 | |||
| 1028 | 2881930291 | |||
| 1029 | 3007253141 | |||
| 1030 | 3007318081 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ezo-assembly1.cif.gz_A | crystal structure of acyl-carrier-protein s-malonyltransferase from burkholderia pseudomallei 1710b | 0.9888 | 3 | 313 |
| 2g2y-assembly1.cif.gz_A | structure of e.coli fabd complexed with malonate | 0.9844 | 3 | 311 |
| 3h0p-assembly1.cif.gz_A | 2.0 angstrom crystal structure of an acyl carrier protein s-malonyltransferase from salmonella typhimurium. | 0.9802 | 2 | 311 |
| 3tqe-assembly1.cif.gz_A | structure of the malonyl coa-acyl carrier protein transacylase (fabd) from coxiella burnetii | 0.9802 | 2 | 315 |
| 3hjv-assembly1.cif.gz_B | 1.7 angstrom resolution crystal structure of an acyl carrier protein s-malonyltransferase from vibrio cholerae o1 biovar eltor str. n16961 | 0.9799 | 2 | 311 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAI9_6_286_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9822 | 7 | 291 | 3.20.10.10 |
| af_P0AAI9_6_286_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9753 | 7 | 291 | 3.20.10.10 |
| 2g1hA01 | Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 | 0.975 | 3 | 313 | 3.40.366.10 |
| 2g1hA01 | Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 | 0.9668 | 3 | 313 | 3.40.366.10 |
| 3tqeA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding | 0.9586 | 124 | 202 | 3.30.70.250 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H4AF03-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9966 | 1 | 315 |
GO:0004314
GO:0005829 GO:0006633 |
| AF-A0A429WVA6-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9962 | 1 | 315 |
GO:0004314
GO:0005829 GO:0006633 |
| AF-A0A1Y1J9N5-F1-model_v4 | deleted | 0.9959 | 1 | 316 |
|
| AF-A0A7W9TU84-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9936 | 3 | 315 |
GO:0004314
GO:0005829 GO:0006633 |
| AF-A0A4S8FAB7-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9933 | 1 | 316 |
GO:0004314
GO:0005829 GO:0006633 |