F457922

General Info

Members Datasets Scaffolds Average Seq Length
515 294 1030 308

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0100406|Ga0501044_0100406_1045_2112
Length 346
Sequence LFLFQFPFQPGFKNFSFAADGTVEGLVLILMSAQVKFACVFPGQGSQSIGMMTGYGSFPVVRQTFAEASDVLKQDLWGMVCDGPADTLNLTVNTQPLMLAAGVAVYRAWQTLGEVRPAFMAGHSLGEYTALVASEALSFADALPLVRFRAEIMQQAVPEGVGAMAAILGLDDDVVRSICQEVTEASDGESLEPANFNSPGQVVVAGHKDAVVRGMEAARSKGAKRTVILPMSIPSHCSLMKPAAEKMRQQLAQVTLRSPKIPLLHNADVEQHEDAESIKEILVRQLFNPVRWTEIIRFISGAGIHHVVECGPGKVLSGLNKRIDANLQSLALTDDAALGHAAALAG

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
179 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
180 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
181 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
182 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
186 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
191 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
192 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
193 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
194 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
197 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
269 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
270 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
271 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
272 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
273 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
274 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
275 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
279 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
280 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
281 2643221609 Acidovorax sp. Root217 Isolate Unclassified
282 2643221611 Acidovorax sp. Root219 Isolate Unclassified
283 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
284 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
285 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
286 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
287 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
288 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
289 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
290 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
291 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
292 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
293 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
294 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.89
Metatranscriptomes 0
Isolates 3.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.12
Nodule 0.58
Rhizoplane 0.78
Rhizosphere 77.67
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0100406 3300049823 Bacteria 2912
2 JGI25155J39150_1000041 3300002704 Bacteria 88843
3 JGI25154J39366_1000532 3300002738 Bacteria 19092
4 JGI25157J39369_1000021 3300002741 Bacteria 163907
5 JGI25150J39212_1008690 3300002774 Bacteria 1975
6 JGI25159J45721_1002903 3300002987 Bacteria 6257
7 JGI25159J45721_1002920 3300002987 Bacteria 6229
8 JGI25151J46595_10000203 3300003187 Bacteria 73276
9 JGI25151J46595_10005774 3300003187 Bacteria 6339
10 JGI25151J46595_10006188 3300003187 Bacteria 6059
11 rootH1_10016625 3300003316 Bacteria 2189
12 rootH1_10040961 3300003316 Bacteria 3027
13 rootH2_10040300 3300003320 Bacteria 2961
14 rootH1_10042792 3300003323 Bacteria 1952
15 rootH1_10066965 3300003323 Bacteria 13543
16 JGI25160J50197_1000784 3300003354 Bacteria 17048
17 JGI25161J50226_1000042 3300003374 Bacteria 123841
18 Ga0055539_1001038 3300003752 Bacteria 5950
19 Ga0055539_1004990 3300003752 Bacteria 1743
20 Ga0055533_1000033 3300003756 Bacteria 265716
21 Ga0055525_1001031 3300003759 Bacteria 7289
22 Ga0055526_1013276 3300003771 Bacteria 3499
23 Ga0055537_1000897 3300003773 Bacteria 14118
24 Ga0055524_1000260 3300003775 Bacteria 53486
25 Ga0055536_1006790 3300003781 Bacteria 5239
26 Ga0055534_1002028 3300003784 Bacteria 7345
27 Ga0055528_1001244 3300003790 Bacteria 16187
28 Ga0055530_10004910 3300003791 Bacteria 6631
29 Ga0055540_1000010 3300003792 Bacteria 290865
30 Ga0055531_10008678 3300003794 Bacteria 5313
31 Ga0055531_10014544 3300003794 Bacteria 3536
32 Ga0055543_1000279 3300004625 Bacteria 37669
33 Ga0065165_1006407 3300005262 Bacteria 6184
34 Ga0065707_10212760 3300005295 Bacteria 1258
35 Ga0070658_10004301 3300005327 Bacteria 11639
36 Ga0070658_10064261 3300005327 Bacteria 2993
37 Ga0070658_10300157 3300005327 Bacteria 1369
38 Ga0070690_100000845 3300005330 Bacteria 15537
39 Ga0068869_100002558 3300005334 Bacteria 10978
40 Ga0068869_100059314 3300005334 Bacteria 2801
41 Ga0068869_100079578 3300005334 Bacteria 2443
42 Ga0070680_100060160 3300005336 Bacteria 3108
43 Ga0070680_100238078 3300005336 Bacteria 1538
44 Ga0070660_100038465 3300005339 Bacteria 3632
45 Ga0070660_100201471 3300005339 Bacteria 1614
46 Ga0070660_100223664 3300005339 Bacteria 1530
47 Ga0070689_100004467 3300005340 Bacteria 9455
48 Ga0070661_100315318 3300005344 Bacteria 1220
49 Ga0070692_10019632 3300005345 Bacteria 3264
50 Ga0070668_100007129 3300005347 Bacteria 8283
51 Ga0070668_100018023 3300005347 Bacteria 5297
52 Ga0070669_100025721 3300005353 Bacteria 4228
53 Ga0070673_100289278 3300005364 Bacteria 1439
54 Ga0070673_100326907 3300005364 Bacteria 1356
55 Ga0070673_100432415 3300005364 Bacteria 1182
56 Ga0070688_100155194 3300005365 Bacteria 1568
57 Ga0070710_10030300 3300005437 Bacteria 2910
58 Ga0070700_100000846 3300005441 Bacteria 15113
59 Ga0070700_100078022 3300005441 Bacteria 2131
60 Ga0070700_100186838 3300005441 Bacteria 1446
61 Ga0070694_100118275 3300005444 Bacteria 1898
62 Ga0070694_100236823 3300005444 Bacteria 1375
63 Ga0070663_100063775 3300005455 Bacteria 2662
64 Ga0070678_100016566 3300005456 Bacteria 4720
65 Ga0070678_100142623 3300005456 Bacteria 1919
66 Ga0070681_10217992 3300005458 Bacteria 1824
67 Ga0068867_100012057 3300005459 Bacteria 6106
68 Ga0068867_100029458 3300005459 Bacteria 3955
69 Ga0068853_100086990 3300005539 Bacteria 2741
70 Ga0070686_100001455 3300005544 Bacteria 13358
71 Ga0070695_100056225 3300005545 Bacteria 2539
72 Ga0070696_100086516 3300005546 Bacteria 2225
73 Ga0070693_100037034 3300005547 Bacteria 2717
74 Ga0070665_100072404 3300005548 Bacteria 3454
75 Ga0070704_100003101 3300005549 Bacteria 9470
76 Ga0068855_100000854 3300005563 Bacteria 37817
77 Ga0068855_100001935 3300005563 Bacteria 25716
78 Ga0068857_100035333 3300005577 Bacteria 4426
79 Ga0068857_100428262 3300005577 Bacteria 1234
80 Ga0068854_100005269 3300005578 Bacteria 8160
81 Ga0068854_100067827 3300005578 Bacteria 2600
82 Ga0068856_100002812 3300005614 Bacteria 17820
83 Ga0068856_100145271 3300005614 Bacteria 2380
84 Ga0070702_100001220 3300005615 Bacteria 10400
85 Ga0068859_100007107 3300005617 Bacteria 11361
86 Ga0068859_100772820 3300005617 Bacteria 1049
87 Ga0068866_10000235 3300005718 Bacteria 26083
88 Ga0068866_10036970 3300005718 Bacteria 2395
89 Ga0068861_100032646 3300005719 Bacteria 3834
90 Ga0068861_100047909 3300005719 Bacteria 3228
91 Ga0068870_10005533 3300005840 Bacteria 5515
92 Ga0068863_100085641 3300005841 Bacteria 2986
93 Ga0068863_100278337 3300005841 Bacteria 1621
94 Ga0068858_100002549 3300005842 Bacteria 18376
95 Ga0068860_100009873 3300005843 Bacteria 9463
96 Ga0068860_100011681 3300005843 Bacteria 8657
97 Ga0068860_100194861 3300005843 Bacteria 1962
98 Ga0068862_100005397 3300005844 Bacteria 10689
99 Ga0068862_100035873 3300005844 Bacteria 4201
100 Ga0068862_100137531 3300005844 Bacteria 2166
101 Ga0068862_100146870 3300005844 Bacteria 2096
102 Ga0075365_10036287 3300006038 Bacteria 3193
103 Ga0075365_10092291 3300006038 Bacteria 2064
104 Ga0075432_10013163 3300006058 Bacteria 2810
105 Ga0075362_10032027 3300006177 Bacteria 2279
106 Ga0075367_10016611 3300006178 Bacteria 4021
107 Ga0075366_10250647 3300006195 Bacteria 1080
108 Ga0075370_10037855 3300006353 Unclassified 2713
109 Ga0068871_100057290 3300006358 Bacteria 3170
110 Ga0075428_100148162 3300006844 Bacteria 2550
111 Ga0075430_100039430 3300006846 Bacteria 3999
112 Ga0075431_100299598 3300006847 Bacteria 1624
113 Ga0068865_100000229 3300006881 Bacteria 31243
114 Ga0068865_100162223 3300006881 Bacteria 1706
115 Ga0097620_100007107 3300006931 Bacteria 11361
116 Ga0097620_100772783 3300006931 Bacteria 1049
117 Ga0105240_10103450 3300009093 Bacteria 3460
118 Ga0105240_10251666 3300009093 Bacteria 2043
119 Ga0105240_10350446 3300009093 Bacteria 1675
120 Ga0111539_10323826 3300009094 Bacteria 1794
121 Ga0105245_10000613 3300009098 Bacteria 32290
122 Ga0105243_10004808 3300009148 Bacteria 10615
123 Ga0105242_10000678 3300009176 Bacteria 26735
124 Ga0105248_10104615 3300009177 Bacteria 3191
125 Ga0105237_10067786 3300009545 Bacteria 3562
126 Ga0105237_10158056 3300009545 Bacteria 2264
127 Ga0105249_10008913 3300009553 Bacteria 8762
128 Ga0105249_10012098 3300009553 Bacteria 7597
129 Ga0105239_10088857 3300010375 Bacteria 3407
130 Ga0157326_1001451 3300012513 Bacteria 2623
131 Ga0157370_10003417 3300013104 Bacteria 18643
132 Ga0157370_10010884 3300013104 Bacteria 9553
133 Ga0157370_10021458 3300013104 Bacteria 6436
134 Ga0157369_10024680 3300013105 Bacteria 6682
135 Ga0157369_10242406 3300013105 Bacteria 1883
136 Ga0157374_10174958 3300013296 Bacteria 2095
137 Ga0157378_10001171 3300013297 Bacteria 23874
138 Ga0157378_10114889 3300013297 Bacteria 2473
139 Ga0163162_10130796 3300013306 Bacteria 2618
140 Ga0157375_10320144 3300013308 Bacteria 1715
141 Ga0163163_10428270 3300014325 Bacteria 1382
142 Ga0157380_10001394 3300014326 Bacteria 15775
143 Ga0157380_10018325 3300014326 Bacteria 5195
144 Ga0157380_10033173 3300014326 Bacteria 3976
145 Ga0182008_10005703 3300014497 Bacteria 7048
146 Ga0157379_10110312 3300014968 Bacteria 2471
147 Ga0157379_10124390 3300014968 Bacteria 2320
148 Ga0182006_1033026 3300015261 Bacteria 2076
149 Ga0182007_10008951 3300015262 Bacteria 4077
150 Ga0182005_1023964 3300015265 Bacteria 1668
151 Ga0209674_100064 3300025226 Bacteria 265769
152 Ga0209563_100126 3300025230 Bacteria 113122
153 Ga0207427_101069 3300025231 Bacteria 11289
154 Ga0207425_1003810 3300025245 Bacteria 4705
155 Ga0209646_1000060 3300025246 Bacteria 256386
156 Ga0209026_1000049 3300025250 Bacteria 255273
157 Ga0209677_100099 3300025253 Bacteria 92370
158 Ga0209677_100229 3300025253 Bacteria 39781
159 Ga0209759_1000069 3300025256 Bacteria 182437
160 Ga0209565_1000462 3300025263 Bacteria 30996
161 Ga0209673_1000008 3300025273 Bacteria 626013
162 Ga0209130_1000216 3300025284 Bacteria 75536
163 Ga0209130_1001740 3300025284 Bacteria 12994
164 Ga0209675_1000400 3300025291 Bacteria 35775
165 Ga0209675_1015447 3300025291 Bacteria 2266
166 Ga0209676_1000007 3300025292 Bacteria 1029371
167 Ga0209676_1005634 3300025292 Bacteria 6458
168 Ga0209025_1007550 3300025294 Bacteria 8068
169 Ga0209025_1010246 3300025294 Bacteria 6378
170 Ga0209025_1014775 3300025294 Bacteria 4771
171 Ga0209564_1002817 3300025295 Bacteria 12908
172 Ga0209564_1004210 3300025295 Bacteria 8969
173 Ga0209564_1007216 3300025295 Bacteria 5783
174 Ga0209050_1000003 3300025298 Bacteria 1609245
175 Ga0209050_1009272 3300025298 Bacteria 5067
176 Ga0209050_1009597 3300025298 Bacteria 4926
177 Ga0209256_1000001 3300025299 Bacteria 2166974
178 Ga0207426_1000117 3300025302 Bacteria 224652
179 Ga0207426_1016077 3300025302 Bacteria 2697
180 Ga0207426_1050062 3300025302 Bacteria 1247
181 Ga0209051_1000003 3300025303 Bacteria 1609245
182 Ga0209051_1000244 3300025303 Bacteria 91505
183 Ga0209257_1000020 3300025304 Bacteria 773356
184 Ga0209257_1000144 3300025304 Bacteria 197078
185 Ga0209257_1007579 3300025304 Bacteria 6507
186 Ga0207656_10110882 3300025321 Bacteria 1268
187 Ga0207682_10049321 3300025893 Bacteria 1738
188 Ga0207642_10001272 3300025899 Bacteria 7804
189 Ga0207645_10043971 3300025907 Bacteria 2859
190 Ga0207643_10006831 3300025908 Bacteria 6125
191 Ga0207705_10003399 3300025909 Bacteria 12102
192 Ga0207705_10097678 3300025909 Bacteria 2157
193 Ga0207695_10124438 3300025913 Bacteria 2542
194 Ga0207660_10059979 3300025917 Bacteria 2733
195 Ga0207662_10049408 3300025918 Bacteria 2495
196 Ga0207657_10005722 3300025919 Bacteria 12970
197 Ga0207657_10098414 3300025919 Bacteria 2431
198 Ga0207681_10009331 3300025923 Bacteria 5995
199 Ga0207681_10046474 3300025923 Bacteria 2920
200 Ga0207644_10043818 3300025931 Bacteria 3176
201 Ga0207686_10005352 3300025934 Bacteria 6883
202 Ga0207670_10004995 3300025936 Bacteria 7226
203 Ga0207704_10000551 3300025938 Bacteria 16714
204 Ga0207704_10005451 3300025938 Bacteria 5867
205 Ga0207691_10046386 3300025940 Bacteria 3994
206 Ga0207711_10089600 3300025941 Bacteria 2703
207 Ga0207711_10127666 3300025941 Bacteria 2276
208 Ga0207689_10000136 3300025942 Bacteria 62820
209 Ga0207689_10073835 3300025942 Bacteria 2802
210 Ga0207689_10087023 3300025942 Bacteria 2567
211 Ga0207661_10019127 3300025944 Bacteria 5100
212 Ga0207667_10002571 3300025949 Bacteria 22570
213 Ga0207667_10016348 3300025949 Bacteria 8388
214 Ga0207651_10097155 3300025960 Bacteria 2174
215 Ga0207651_10169124 3300025960 Bacteria 1722
216 Ga0207651_10261477 3300025960 Bacteria 1421
217 Ga0207712_10057615 3300025961 Bacteria 2742
218 Ga0207712_10074836 3300025961 Bacteria 2446
219 Ga0207668_10084965 3300025972 Bacteria 2307
220 Ga0207703_10055397 3300026035 Bacteria 3226
221 Ga0207639_10060757 3300026041 Bacteria 2916
222 Ga0207708_10001168 3300026075 Bacteria 19751
223 Ga0207708_10004098 3300026075 Bacteria 10723
224 Ga0207708_10201765 3300026075 Bacteria 1587
225 Ga0207702_10002287 3300026078 Bacteria 18385
226 Ga0207641_10078085 3300026088 Bacteria 2867
227 Ga0207641_10092410 3300026088 Bacteria 2650
228 Ga0207641_10138084 3300026088 Bacteria 2196
229 Ga0207648_10000485 3300026089 Bacteria 44215
230 Ga0207648_10004350 3300026089 Bacteria 14571
231 Ga0207675_100000213 3300026118 Bacteria 54289
232 Ga0207675_100011315 3300026118 Bacteria 8351
233 Ga0207675_100111779 3300026118 Bacteria 2578
234 Ga0207675_100466884 3300026118 Bacteria 1253
235 Ga0207683_10023921 3300026121 Bacteria 5256
236 Ga0207683_10028497 3300026121 Bacteria 4829
237 Ga0207683_10092410 3300026121 Bacteria 2696
238 Ga0207698_10166304 3300026142 Bacteria 1936
239 Ga0209967_1002053 3300027364 Bacteria 2598
240 Ga0268265_10006043 3300028380 Bacteria 8229
241 Ga0268265_10010425 3300028380 Bacteria 6275
242 Ga0268264_10032820 3300028381 Bacteria 4260
243 Ga0268264_10089122 3300028381 Bacteria 2656
244 Ga0268264_10159489 3300028381 Bacteria 2030
245 Ga0268264_10317730 3300028381 Bacteria 1471
246 Ga0265330_10027152 3300031235 Bacteria 2587
247 Ga0265332_10038204 3300031238 Bacteria 2080
248 Ga0265331_10032470 3300031250 Bacteria 2587
249 Ga0307513_10000020 3300031456 Bacteria 228745
250 Ga0307408_100000663 3300031548 Bacteria 28685
251 Ga0307408_100129220 3300031548 Bacteria 1969
252 Ga0316575_10002071 3300031665 Bacteria 6684
253 Ga0265314_10010145 3300031711 Bacteria 7893
254 Ga0265342_10054163 3300031712 Bacteria 2385
255 Ga0307516_10004689 3300031730 Bacteria 16729
256 Ga0307516_10034258 3300031730 Bacteria 5105
257 Ga0307413_10089072 3300031824 Bacteria 2004
258 Ga0307406_10032915 3300031901 Bacteria 3168
259 Ga0307411_10250562 3300032005 Bacteria 1392
260 Ga0373934_0003709 3300035086 Bacteria 5622
261 Ga0316582_0014186 3300036647 Bacteria 4513
262 Ga0316584_0009401 3300036712 Bacteria 6786
263 Ga0395899_0007775 3300037312 Bacteria 8268
264 Ga0395899_0029114 3300037312 Bacteria 4153
265 Ga0395899_0182292 3300037312 Bacteria 1473
266 Ga0395900_0018346 3300037418 Bacteria 7137
267 Ga0395900_0044296 3300037418 Bacteria 4585
268 Ga0395900_0101488 3300037418 Bacteria 2955
269 Ga0395900_0116640 3300037418 Bacteria 2740
270 Ga0395900_0218458 3300037418 Bacteria 1922
271 Ga0395898_0087849 3300037466 Bacteria 2994
272 Ga0395905_0020754 3300037471 Bacteria 6220
273 Ga0395905_0038486 3300037471 Bacteria 4488
274 Ga0395905_0091419 3300037471 Bacteria 2853
275 Ga0395905_0118442 3300037471 Bacteria 2489
276 Ga0316581_0001344 3300037588 Bacteria 5463
277 Ga0395901_0000106 3300038443 Bacteria 114313
278 Ga0395901_0010702 3300038443 Bacteria 9299
279 Ga0395901_0204039 3300038443 Bacteria 2072
280 Ga0395901_0414245 3300038443 Bacteria 1383
281 Ga0400490_31124 3300038726 Bacteria 15244
282 Ga0400487_36792 3300039110 Bacteria 1780
283 Ga0439436_0000303 3300041404 Bacteria 11979
284 Ga0439461_0010328 3300041410 Bacteria 1711
285 Ga0439466_0021036 3300041411 Bacteria 2318
286 Ga0439465_0000048 3300041413 Bacteria 25346
287 Ga0451853_1767617 3300041512 Bacteria 1099
288 Ga0439431_0000579 3300041997 Bacteria 7786
289 Ga0439433_0000329 3300041999 Bacteria 8358
290 Ga0439445_0000168 3300042004 Bacteria 11631
291 Ga0439432_000367 3300042006 Bacteria 16615
292 Ga0439449_0000231 3300042007 Bacteria 20096
293 Ga0439452_004237 3300042010 Bacteria 4853
294 Ga0439457_008861 3300042014 Bacteria 2359
295 Ga0439446_0000246 3300042156 Bacteria 10064
296 Ga0439446_0019764 3300042156 Bacteria 1894
297 Ga0439458_0030004 3300042157 Bacteria 1293
298 Ga0439434_0001283 3300042435 Bacteria 7237
299 Ga0439435_0000951 3300042436 Bacteria 5034
300 Ga0439460_0002488 3300042461 Bacteria 4445
301 Ga0450893_0005650 3300042532 Bacteria 2013
302 Ga0451577_0000002 3300042876 Bacteria 1731375
303 Ga0451577_0022821 3300042876 Bacteria 5713
304 Ga0451577_0275502 3300042876 Bacteria 1524
305 Ga0466969_0007002 3300044656 Bacteria 5999
306 Ga0466969_0044833 3300044656 Bacteria 2198
307 Ga0453683_0000003 3300044673 Bacteria 942572
308 Ga0466966_0002275 3300044684 Bacteria 12510
309 Ga0466966_0097189 3300044684 Bacteria 1824
310 Ga0466961_0014688 3300044693 Bacteria 5031
311 Ga0466961_0226496 3300044693 Bacteria 1151
312 Ga0453684_0000002 3300044712 Bacteria 1731375
313 Ga0453684_0000221 3300044712 Bacteria 249908
314 Ga0453684_0199405 3300044712 Bacteria 2334
315 Ga0466968_0097218 3300044735 Bacteria 1311
316 Ga0466959_0019212 3300045049 Bacteria 5024
317 Ga0451576_0000004 3300045051 Bacteria 1312238
318 Ga0451576_0016175 3300045051 Bacteria 8242
319 Ga0495592_0007645 3300046454 Bacteria 8092
320 Ga0495603_0064578 3300046455 Bacteria 2158
321 Ga0495651_0162131 3300046462 Bacteria 1601
322 Ga0495653_0038748 3300046463 Bacteria 3739
323 Ga0495585_0003401 3300046492 Bacteria 10774
324 Ga0495585_0021515 3300046492 Bacteria 3702
325 Ga0495607_0039868 3300046501 Bacteria 2802
326 Ga0495606_0008218 3300046507 Bacteria 9122
327 Ga0495637_0023448 3300046520 Bacteria 2805
328 Ga0495637_0025557 3300046520 Bacteria 2660
329 Ga0495637_0030350 3300046520 Bacteria 2399
330 Ga0495643_0115262 3300046522 Bacteria 1362
331 Ga0495656_0004741 3300046615 Bacteria 4674
332 Ga0495656_0038229 3300046615 Bacteria 1986
333 Ga0495661_0000028 3300046665 Bacteria 182191
334 Ga0495588_0171611 3300046674 Bacteria 1147
335 Ga0495649_0018805 3300046694 Bacteria 3881
336 Ga0495683_0000216 3300047323 Bacteria 54311
337 Ga0496105_0340688 3300048908 Bacteria 1199
338 Ga0496111_0031335 3300048914 Bacteria 3787
339 Ga0496113_0477391 3300048916 Bacteria 1002
340 Ga0496114_0008446 3300048917 Bacteria 8158
341 Ga0495678_034477 3300049459 Bacteria 2082
342 Ga0501031_0003738 3300049568 Bacteria 9794
343 Ga0501031_0008819 3300049568 Bacteria 6557
344 Ga0501032_0000513 3300049569 Bacteria 31489
345 Ga0501032_0003360 3300049569 Bacteria 12282
346 Ga0501032_0018637 3300049569 Bacteria 4859
347 Ga0501032_0083014 3300049569 Bacteria 2131
348 Ga0501032_0204804 3300049569 Unclassified 1287
349 Ga0501032_0243782 3300049569 Unclassified 1167
350 Ga0501033_0000642 3300049570 Bacteria 32324
351 Ga0501033_0001649 3300049570 Bacteria 19561
352 Ga0501033_0003123 3300049570 Bacteria 13759
353 Ga0501033_0009527 3300049570 Bacteria 7474
354 Ga0501033_0034503 3300049570 Bacteria 3794
355 Ga0501033_0061751 3300049570 Bacteria 2761
356 Ga0501034_0004519 3300049571 Bacteria 15470
357 Ga0501034_0004851 3300049571 Bacteria 14846
358 Ga0501034_0052607 3300049571 Bacteria 4102
359 Ga0501034_0135696 3300049571 Bacteria 2441
360 Ga0501034_0209060 3300049571 Bacteria 1907
361 Ga0501034_0284578 3300049571 Bacteria 1592
362 Ga0501036_0005883 3300049572 Bacteria 9936
363 Ga0501036_0032543 3300049572 Bacteria 4406
364 Ga0501036_0046589 3300049572 Bacteria 3672
365 Ga0501036_0081356 3300049572 Bacteria 2737
366 Ga0501036_0101880 3300049572 Bacteria 2429
367 Ga0501036_0104306 3300049572 Bacteria 2397
368 Ga0501037_0016812 3300049573 Bacteria 5382
369 Ga0501037_0046452 3300049573 Bacteria 3184
370 Ga0501037_0108638 3300049573 Bacteria 1999
371 Ga0501038_0001864 3300049574 Bacteria 19473
372 Ga0501038_0003563 3300049574 Bacteria 14485
373 Ga0501038_0008871 3300049574 Bacteria 9229
374 Ga0501038_0012706 3300049574 Bacteria 7694
375 Ga0501038_0036219 3300049574 Bacteria 4331
376 Ga0501038_0103301 3300049574 Bacteria 2370
377 Ga0501038_0159415 3300049574 Bacteria 1835
378 Ga0501038_0246458 3300049574 Bacteria 1417
379 Ga0501039_0004141 3300049575 Bacteria 10912
380 Ga0501039_0027918 3300049575 Bacteria 4341
381 Ga0501039_0045464 3300049575 Bacteria 3392
382 Ga0501039_0435636 3300049575 Bacteria 1029
383 Ga0501040_0006982 3300049576 Bacteria 7317
384 Ga0501041_0003873 3300049577 Bacteria 8613
385 Ga0501041_0008410 3300049577 Bacteria 6069
386 Ga0501042_0000414 3300049578 Bacteria 21617
387 Ga0501042_0019177 3300049578 Bacteria 4746
388 Ga0501043_0015183 3300049579 Bacteria 6030
389 Ga0501043_0033195 3300049579 Bacteria 4059
390 Ga0501043_0049398 3300049579 Bacteria 3307
391 Ga0501043_0063547 3300049579 Bacteria 2899
392 Ga0501043_0087319 3300049579 Bacteria 2451
393 Ga0501043_0151427 3300049579 Bacteria 1815
394 Ga0501043_0228093 3300049579 Bacteria 1439
395 Ga0501046_0003766 3300049580 Bacteria 13882
396 Ga0501046_0005744 3300049580 Bacteria 11070
397 Ga0501046_0006547 3300049580 Bacteria 10300
398 Ga0501046_0015457 3300049580 Bacteria 6411
399 Ga0501046_0172715 3300049580 Bacteria 1621
400 Ga0501046_0349191 3300049580 Bacteria 1074
401 Ga0501046_0374500 3300049580 Bacteria 1031
402 Ga0501047_0002389 3300049581 Bacteria 17950
403 Ga0501047_0026382 3300049581 Bacteria 5590
404 Ga0501047_0134179 3300049581 Bacteria 2356
405 Ga0501047_0152038 3300049581 Bacteria 2190
406 Ga0501048_0004042 3300049582 Bacteria 11161
407 Ga0501048_0144003 3300049582 Bacteria 1685
408 Ga0501048_0161837 3300049582 Bacteria 1584
409 Ga0501067_0022921 3300049583 Bacteria 3458
410 Ga0501067_0137567 3300049583 Bacteria 1360
411 Ga0501068_0001118 3300049584 Bacteria 14194
412 Ga0501068_0003049 3300049584 Bacteria 8948
413 Ga0501069_0111690 3300049585 Bacteria 1557
414 Ga0501070_0092078 3300049586 Bacteria 2509
415 Ga0501070_0154857 3300049586 Bacteria 1890
416 Ga0501071_0063001 3300049587 Bacteria 2688
417 Ga0501072_0001234 3300049588 Bacteria 19087
418 Ga0501072_0006891 3300049588 Bacteria 8628
419 Ga0501072_0115192 3300049588 Bacteria 2140
420 Ga0501073_0000651 3300049589 Bacteria 24370
421 Ga0501073_0011761 3300049589 Bacteria 6390
422 Ga0501073_0196885 3300049589 Bacteria 1393
423 Ga0501074_0080899 3300049590 Bacteria 2330
424 Ga0501074_0276115 3300049590 Bacteria 1195
425 Ga0501075_0001487 3300049591 Bacteria 15267
426 Ga0501075_0082241 3300049591 Bacteria 2439
427 Ga0501076_0000390 3300049592 Bacteria 27421
428 Ga0501076_0014479 3300049592 Bacteria 5943
429 Ga0501077_0041715 3300049593 Bacteria 2920
430 Ga0501077_0076293 3300049593 Bacteria 2123
431 Ga0501079_0000671 3300049741 Bacteria 22952
432 Ga0501079_0005364 3300049741 Bacteria 9549
433 Ga0501079_0042012 3300049741 Bacteria 3531
434 Ga0501079_0103831 3300049741 Bacteria 2205
435 Ga0501080_0000604 3300049742 Bacteria 28440
436 Ga0501080_0001385 3300049742 Bacteria 20314
437 Ga0501080_0052868 3300049742 Bacteria 3781
438 Ga0501080_0070964 3300049742 Bacteria 3239
439 Ga0501080_0142327 3300049742 Bacteria 2217
440 Ga0501081_0021037 3300049743 Bacteria 4353
441 Ga0501081_0067666 3300049743 Bacteria 2486
442 Ga0501083_0011296 3300049744 Bacteria 6264
443 Ga0501083_0174303 3300049744 Bacteria 1406
444 Ga0501263_007765 3300049760 Bacteria 1267
445 Ga0501035_0000924 3300049822 Bacteria 31097
446 Ga0501035_0003294 3300049822 Bacteria 15480
447 Ga0501035_0012426 3300049822 Bacteria 7870
448 Ga0501035_0015998 3300049822 Bacteria 6922
449 Ga0501035_0040431 3300049822 Bacteria 4213
450 Ga0501035_0049991 3300049822 Bacteria 3748
451 Ga0501035_0205689 3300049822 Bacteria 1686
452 Ga0501035_0226067 3300049822 Bacteria 1596
453 Ga0501035_0433964 3300049822 Bacteria 1089
454 Ga0501044_0016769 3300049823 Bacteria 7861
455 Ga0501044_0036876 3300049823 Bacteria 5113
456 Ga0501044_0107000 3300049823 Bacteria 2808
457 Ga0501044_0134960 3300049823 Bacteria 2459
458 Ga0501044_0163262 3300049823 Bacteria 2203
459 Ga0501044_0193810 3300049823 Bacteria 1993
460 Ga0501044_0456159 3300049823 Bacteria 1184
461 Ga0501045_0015455 3300049824 Bacteria 5416
462 Ga0501045_0017009 3300049824 Bacteria 5164
463 Ga0501045_0245007 3300049824 Bacteria 1334
464 nmdc:mga03683_137738_c1 3300050489 Bacteria 1095
465 nmdc:mga03683_138159_c1 3300050489 Bacteria 1094
466 nmdc:mga03n38_139258_c1 3300050490 Bacteria 1210
467 nmdc:mga03n38_97943_c1 3300050490 Bacteria 1409
468 nmdc:mga0yw44_163702_c1 3300050492 Bacteria 1457
469 nmdc:mga0yw44_81635_c1 3300050492 Bacteria 2027
470 nmdc:mga0yw44_978_c2 3300050492 Bacteria 8791
471 nmdc:mga0k408_18145_c1 3300050493 Bacteria 3925
472 nmdc:mga0k408_244362_c1 3300050493 Bacteria 1072
473 nmdc:mga0k408_72297_c1 3300050493 Bacteria 2014
474 nmdc:mga07m45_6978_c2 3300050496 Bacteria 4900
475 nmdc:mga09592_212866_c1 3300050508 Bacteria 1675
476 nmdc:mga0qj67_45279_c1 3300050509 Bacteria 3472
477 nmdc:mga06r32_96040_c1 3300050510 Bacteria 2902
478 nmdc:mga08y16_542150_c1 3300050511 Bacteria 1178
479 nmdc:mga08y16_99789_c1 3300050511 Bacteria 3023
480 Ga0500644_0000994 3300053088 Bacteria 8812
481 Ga0500583_0129856 3300053092 Bacteria 1249
482 Ga0500593_000342 3300053117 Bacteria 18749
483 Ga0500618_011021 3300053125 Bacteria 2409
484 Ga0500559_0116670 3300053136 Bacteria 1240
485 Ga0500622_0023198 3300053156 Bacteria 3287
486 Ga0500634_0008881 3300053161 Bacteria 5049
487 Ga0500645_002662 3300053730 Bacteria 7781
488 Ga0500645_009503 3300053730 Bacteria 3264
489 Ga0500645_013714 3300053730 Bacteria 2596
490 Ga0501084_0018543 3300054114 Bacteria 5792
491 Ga0501084_0030682 3300054114 Bacteria 4495
492 Ga0501084_0083766 3300054114 Bacteria 2677
493 Ga0501084_0323175 3300054114 Bacteria 1303
494 Ga0501082_0006976 3300060353 Bacteria 9754
495 Ga0501082_0007048 3300060353 Bacteria 9702
496 Ga0501082_0034724 3300060353 Bacteria 4347
497 Ga0501082_0099424 3300060353 Bacteria 2515
498 Ga0530510_0041974 3300061734 Bacteria 3303
499 Ga0530510_0097553 3300061734 Bacteria 2149
500 2510251784 2510065045 Bacteria 7761063
501 2550693927 2548876994 Bacteria 4904866
502 2644059734 2643221609 Bacteria 6756331
503 2644074877 2643221611 Bacteria 6820941
504 2719640895 2718217991 Bacteria 7829542
505 2738715137 2738541276 Bacteria 4690596
506 2739288174 2738543020 Bacteria 5718238
507 2739293497 2738543021 Bacteria 5718241
508 2739612192 2739367655 Bacteria 4051151
509 2808984483 2808606386 Bacteria 4471946
510 2809131210 2808606415 Bacteria 4576710
511 2809150455 2808606419 Bacteria 4576925
512 2852621971 2852618963 Bacteria 4577824
513 2881930291 2881927736 Bacteria 3993927
514 3007253141 3007252601 Bacteria 4559114
515 3007318081 3007315729 Bacteria 5076637
516 Ga0501044_0100406
517 JGI25155J39150_1000041
518 JGI25154J39366_1000532
519 JGI25157J39369_1000021
520 JGI25150J39212_1008690
521 JGI25159J45721_1002903
522 JGI25159J45721_1002920
523 JGI25151J46595_10000203
524 JGI25151J46595_10005774
525 JGI25151J46595_10006188
526 rootH1_10016625
527 rootH1_10040961
528 rootH2_10040300
529 rootH1_10042792
530 rootH1_10066965
531 JGI25160J50197_1000784
532 JGI25161J50226_1000042
533 Ga0055539_1001038
534 Ga0055539_1004990
535 Ga0055533_1000033
536 Ga0055525_1001031
537 Ga0055526_1013276
538 Ga0055537_1000897
539 Ga0055524_1000260
540 Ga0055536_1006790
541 Ga0055534_1002028
542 Ga0055528_1001244
543 Ga0055530_10004910
544 Ga0055540_1000010
545 Ga0055531_10008678
546 Ga0055531_10014544
547 Ga0055543_1000279
548 Ga0065165_1006407
549 Ga0065707_10212760
550 Ga0070658_10004301
551 Ga0070658_10064261
552 Ga0070658_10300157
553 Ga0070690_100000845
554 Ga0068869_100002558
555 Ga0068869_100059314
556 Ga0068869_100079578
557 Ga0070680_100060160
558 Ga0070680_100238078
559 Ga0070660_100038465
560 Ga0070660_100201471
561 Ga0070660_100223664
562 Ga0070689_100004467
563 Ga0070661_100315318
564 Ga0070692_10019632
565 Ga0070668_100007129
566 Ga0070668_100018023
567 Ga0070669_100025721
568 Ga0070673_100289278
569 Ga0070673_100326907
570 Ga0070673_100432415
571 Ga0070688_100155194
572 Ga0070710_10030300
573 Ga0070700_100000846
574 Ga0070700_100078022
575 Ga0070700_100186838
576 Ga0070694_100118275
577 Ga0070694_100236823
578 Ga0070663_100063775
579 Ga0070678_100016566
580 Ga0070678_100142623
581 Ga0070681_10217992
582 Ga0068867_100012057
583 Ga0068867_100029458
584 Ga0068853_100086990
585 Ga0070686_100001455
586 Ga0070695_100056225
587 Ga0070696_100086516
588 Ga0070693_100037034
589 Ga0070665_100072404
590 Ga0070704_100003101
591 Ga0068855_100000854
592 Ga0068855_100001935
593 Ga0068857_100035333
594 Ga0068857_100428262
595 Ga0068854_100005269
596 Ga0068854_100067827
597 Ga0068856_100002812
598 Ga0068856_100145271
599 Ga0070702_100001220
600 Ga0068859_100007107
601 Ga0068859_100772820
602 Ga0068866_10000235
603 Ga0068866_10036970
604 Ga0068861_100032646
605 Ga0068861_100047909
606 Ga0068870_10005533
607 Ga0068863_100085641
608 Ga0068863_100278337
609 Ga0068858_100002549
610 Ga0068860_100009873
611 Ga0068860_100011681
612 Ga0068860_100194861
613 Ga0068862_100005397
614 Ga0068862_100035873
615 Ga0068862_100137531
616 Ga0068862_100146870
617 Ga0075365_10036287
618 Ga0075365_10092291
619 Ga0075432_10013163
620 Ga0075362_10032027
621 Ga0075367_10016611
622 Ga0075366_10250647
623 Ga0075370_10037855
624 Ga0068871_100057290
625 Ga0075428_100148162
626 Ga0075430_100039430
627 Ga0075431_100299598
628 Ga0068865_100000229
629 Ga0068865_100162223
630 Ga0097620_100007107
631 Ga0097620_100772783
632 Ga0105240_10103450
633 Ga0105240_10251666
634 Ga0105240_10350446
635 Ga0111539_10323826
636 Ga0105245_10000613
637 Ga0105243_10004808
638 Ga0105242_10000678
639 Ga0105248_10104615
640 Ga0105237_10067786
641 Ga0105237_10158056
642 Ga0105249_10008913
643 Ga0105249_10012098
644 Ga0105239_10088857
645 Ga0157326_1001451
646 Ga0157370_10003417
647 Ga0157370_10010884
648 Ga0157370_10021458
649 Ga0157369_10024680
650 Ga0157369_10242406
651 Ga0157374_10174958
652 Ga0157378_10001171
653 Ga0157378_10114889
654 Ga0163162_10130796
655 Ga0157375_10320144
656 Ga0163163_10428270
657 Ga0157380_10001394
658 Ga0157380_10018325
659 Ga0157380_10033173
660 Ga0182008_10005703
661 Ga0157379_10110312
662 Ga0157379_10124390
663 Ga0182006_1033026
664 Ga0182007_10008951
665 Ga0182005_1023964
666 Ga0209674_100064
667 Ga0209563_100126
668 Ga0207427_101069
669 Ga0207425_1003810
670 Ga0209646_1000060
671 Ga0209026_1000049
672 Ga0209677_100099
673 Ga0209677_100229
674 Ga0209759_1000069
675 Ga0209565_1000462
676 Ga0209673_1000008
677 Ga0209130_1000216
678 Ga0209130_1001740
679 Ga0209675_1000400
680 Ga0209675_1015447
681 Ga0209676_1000007
682 Ga0209676_1005634
683 Ga0209025_1007550
684 Ga0209025_1010246
685 Ga0209025_1014775
686 Ga0209564_1002817
687 Ga0209564_1004210
688 Ga0209564_1007216
689 Ga0209050_1000003
690 Ga0209050_1009272
691 Ga0209050_1009597
692 Ga0209256_1000001
693 Ga0207426_1000117
694 Ga0207426_1016077
695 Ga0207426_1050062
696 Ga0209051_1000003
697 Ga0209051_1000244
698 Ga0209257_1000020
699 Ga0209257_1000144
700 Ga0209257_1007579
701 Ga0207656_10110882
702 Ga0207682_10049321
703 Ga0207642_10001272
704 Ga0207645_10043971
705 Ga0207643_10006831
706 Ga0207705_10003399
707 Ga0207705_10097678
708 Ga0207695_10124438
709 Ga0207660_10059979
710 Ga0207662_10049408
711 Ga0207657_10005722
712 Ga0207657_10098414
713 Ga0207681_10009331
714 Ga0207681_10046474
715 Ga0207644_10043818
716 Ga0207686_10005352
717 Ga0207670_10004995
718 Ga0207704_10000551
719 Ga0207704_10005451
720 Ga0207691_10046386
721 Ga0207711_10089600
722 Ga0207711_10127666
723 Ga0207689_10000136
724 Ga0207689_10073835
725 Ga0207689_10087023
726 Ga0207661_10019127
727 Ga0207667_10002571
728 Ga0207667_10016348
729 Ga0207651_10097155
730 Ga0207651_10169124
731 Ga0207651_10261477
732 Ga0207712_10057615
733 Ga0207712_10074836
734 Ga0207668_10084965
735 Ga0207703_10055397
736 Ga0207639_10060757
737 Ga0207708_10001168
738 Ga0207708_10004098
739 Ga0207708_10201765
740 Ga0207702_10002287
741 Ga0207641_10078085
742 Ga0207641_10092410
743 Ga0207641_10138084
744 Ga0207648_10000485
745 Ga0207648_10004350
746 Ga0207675_100000213
747 Ga0207675_100011315
748 Ga0207675_100111779
749 Ga0207675_100466884
750 Ga0207683_10023921
751 Ga0207683_10028497
752 Ga0207683_10092410
753 Ga0207698_10166304
754 Ga0209967_1002053
755 Ga0268265_10006043
756 Ga0268265_10010425
757 Ga0268264_10032820
758 Ga0268264_10089122
759 Ga0268264_10159489
760 Ga0268264_10317730
761 Ga0265330_10027152
762 Ga0265332_10038204
763 Ga0265331_10032470
764 Ga0307513_10000020
765 Ga0307408_100000663
766 Ga0307408_100129220
767 Ga0316575_10002071
768 Ga0265314_10010145
769 Ga0265342_10054163
770 Ga0307516_10004689
771 Ga0307516_10034258
772 Ga0307413_10089072
773 Ga0307406_10032915
774 Ga0307411_10250562
775 Ga0373934_0003709
776 Ga0316582_0014186
777 Ga0316584_0009401
778 Ga0395899_0007775
779 Ga0395899_0029114
780 Ga0395899_0182292
781 Ga0395900_0018346
782 Ga0395900_0044296
783 Ga0395900_0101488
784 Ga0395900_0116640
785 Ga0395900_0218458
786 Ga0395898_0087849
787 Ga0395905_0020754
788 Ga0395905_0038486
789 Ga0395905_0091419
790 Ga0395905_0118442
791 Ga0316581_0001344
792 Ga0395901_0000106
793 Ga0395901_0010702
794 Ga0395901_0204039
795 Ga0395901_0414245
796 Ga0400490_31124
797 Ga0400487_36792
798 Ga0439436_0000303
799 Ga0439461_0010328
800 Ga0439466_0021036
801 Ga0439465_0000048
802 Ga0451853_1767617
803 Ga0439431_0000579
804 Ga0439433_0000329
805 Ga0439445_0000168
806 Ga0439432_000367
807 Ga0439449_0000231
808 Ga0439452_004237
809 Ga0439457_008861
810 Ga0439446_0000246
811 Ga0439446_0019764
812 Ga0439458_0030004
813 Ga0439434_0001283
814 Ga0439435_0000951
815 Ga0439460_0002488
816 Ga0450893_0005650
817 Ga0451577_0000002
818 Ga0451577_0022821
819 Ga0451577_0275502
820 Ga0466969_0007002
821 Ga0466969_0044833
822 Ga0453683_0000003
823 Ga0466966_0002275
824 Ga0466966_0097189
825 Ga0466961_0014688
826 Ga0466961_0226496
827 Ga0453684_0000002
828 Ga0453684_0000221
829 Ga0453684_0199405
830 Ga0466968_0097218
831 Ga0466959_0019212
832 Ga0451576_0000004
833 Ga0451576_0016175
834 Ga0495592_0007645
835 Ga0495603_0064578
836 Ga0495651_0162131
837 Ga0495653_0038748
838 Ga0495585_0003401
839 Ga0495585_0021515
840 Ga0495607_0039868
841 Ga0495606_0008218
842 Ga0495637_0023448
843 Ga0495637_0025557
844 Ga0495637_0030350
845 Ga0495643_0115262
846 Ga0495656_0004741
847 Ga0495656_0038229
848 Ga0495661_0000028
849 Ga0495588_0171611
850 Ga0495649_0018805
851 Ga0495683_0000216
852 Ga0496105_0340688
853 Ga0496111_0031335
854 Ga0496113_0477391
855 Ga0496114_0008446
856 Ga0495678_034477
857 Ga0501031_0003738
858 Ga0501031_0008819
859 Ga0501032_0000513
860 Ga0501032_0003360
861 Ga0501032_0018637
862 Ga0501032_0083014
863 Ga0501032_0204804
864 Ga0501032_0243782
865 Ga0501033_0000642
866 Ga0501033_0001649
867 Ga0501033_0003123
868 Ga0501033_0009527
869 Ga0501033_0034503
870 Ga0501033_0061751
871 Ga0501034_0004519
872 Ga0501034_0004851
873 Ga0501034_0052607
874 Ga0501034_0135696
875 Ga0501034_0209060
876 Ga0501034_0284578
877 Ga0501036_0005883
878 Ga0501036_0032543
879 Ga0501036_0046589
880 Ga0501036_0081356
881 Ga0501036_0101880
882 Ga0501036_0104306
883 Ga0501037_0016812
884 Ga0501037_0046452
885 Ga0501037_0108638
886 Ga0501038_0001864
887 Ga0501038_0003563
888 Ga0501038_0008871
889 Ga0501038_0012706
890 Ga0501038_0036219
891 Ga0501038_0103301
892 Ga0501038_0159415
893 Ga0501038_0246458
894 Ga0501039_0004141
895 Ga0501039_0027918
896 Ga0501039_0045464
897 Ga0501039_0435636
898 Ga0501040_0006982
899 Ga0501041_0003873
900 Ga0501041_0008410
901 Ga0501042_0000414
902 Ga0501042_0019177
903 Ga0501043_0015183
904 Ga0501043_0033195
905 Ga0501043_0049398
906 Ga0501043_0063547
907 Ga0501043_0087319
908 Ga0501043_0151427
909 Ga0501043_0228093
910 Ga0501046_0003766
911 Ga0501046_0005744
912 Ga0501046_0006547
913 Ga0501046_0015457
914 Ga0501046_0172715
915 Ga0501046_0349191
916 Ga0501046_0374500
917 Ga0501047_0002389
918 Ga0501047_0026382
919 Ga0501047_0134179
920 Ga0501047_0152038
921 Ga0501048_0004042
922 Ga0501048_0144003
923 Ga0501048_0161837
924 Ga0501067_0022921
925 Ga0501067_0137567
926 Ga0501068_0001118
927 Ga0501068_0003049
928 Ga0501069_0111690
929 Ga0501070_0092078
930 Ga0501070_0154857
931 Ga0501071_0063001
932 Ga0501072_0001234
933 Ga0501072_0006891
934 Ga0501072_0115192
935 Ga0501073_0000651
936 Ga0501073_0011761
937 Ga0501073_0196885
938 Ga0501074_0080899
939 Ga0501074_0276115
940 Ga0501075_0001487
941 Ga0501075_0082241
942 Ga0501076_0000390
943 Ga0501076_0014479
944 Ga0501077_0041715
945 Ga0501077_0076293
946 Ga0501079_0000671
947 Ga0501079_0005364
948 Ga0501079_0042012
949 Ga0501079_0103831
950 Ga0501080_0000604
951 Ga0501080_0001385
952 Ga0501080_0052868
953 Ga0501080_0070964
954 Ga0501080_0142327
955 Ga0501081_0021037
956 Ga0501081_0067666
957 Ga0501083_0011296
958 Ga0501083_0174303
959 Ga0501263_007765
960 Ga0501035_0000924
961 Ga0501035_0003294
962 Ga0501035_0012426
963 Ga0501035_0015998
964 Ga0501035_0040431
965 Ga0501035_0049991
966 Ga0501035_0205689
967 Ga0501035_0226067
968 Ga0501035_0433964
969 Ga0501044_0016769
970 Ga0501044_0036876
971 Ga0501044_0107000
972 Ga0501044_0134960
973 Ga0501044_0163262
974 Ga0501044_0193810
975 Ga0501044_0456159
976 Ga0501045_0015455
977 Ga0501045_0017009
978 Ga0501045_0245007
979 nmdc:mga03683_137738_c1
980 nmdc:mga03683_138159_c1
981 nmdc:mga03n38_139258_c1
982 nmdc:mga03n38_97943_c1
983 nmdc:mga0yw44_163702_c1
984 nmdc:mga0yw44_81635_c1
985 nmdc:mga0yw44_978_c2
986 nmdc:mga0k408_18145_c1
987 nmdc:mga0k408_244362_c1
988 nmdc:mga0k408_72297_c1
989 nmdc:mga07m45_6978_c2
990 nmdc:mga09592_212866_c1
991 nmdc:mga0qj67_45279_c1
992 nmdc:mga06r32_96040_c1
993 nmdc:mga08y16_542150_c1
994 nmdc:mga08y16_99789_c1
995 Ga0500644_0000994
996 Ga0500583_0129856
997 Ga0500593_000342
998 Ga0500618_011021
999 Ga0500559_0116670
1000 Ga0500622_0023198
1001 Ga0500634_0008881
1002 Ga0500645_002662
1003 Ga0500645_009503
1004 Ga0500645_013714
1005 Ga0501084_0018543
1006 Ga0501084_0030682
1007 Ga0501084_0083766
1008 Ga0501084_0323175
1009 Ga0501082_0006976
1010 Ga0501082_0007048
1011 Ga0501082_0034724
1012 Ga0501082_0099424
1013 Ga0530510_0041974
1014 Ga0530510_0097553
1015 2510251784
1016 2550693927
1017 2644059734
1018 2644074877
1019 2719640895
1020 2738715137
1021 2739288174
1022 2739293497
1023 2739612192
1024 2808984483
1025 2809131210
1026 2809150455
1027 2852621971
1028 2881930291
1029 3007253141
1030 3007318081

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00698

Acyl_transf_1

Acyl transferase domain

38

341

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ezo-assembly1.cif.gz_A crystal structure of acyl-carrier-protein s-malonyltransferase from burkholderia pseudomallei 1710b 0.9888 3 313
2g2y-assembly1.cif.gz_A structure of e.coli fabd complexed with malonate 0.9844 3 311
3h0p-assembly1.cif.gz_A 2.0 angstrom crystal structure of an acyl carrier protein s-malonyltransferase from salmonella typhimurium. 0.9802 2 311
3tqe-assembly1.cif.gz_A structure of the malonyl coa-acyl carrier protein transacylase (fabd) from coxiella burnetii 0.9802 2 315
3hjv-assembly1.cif.gz_B 1.7 angstrom resolution crystal structure of an acyl carrier protein s-malonyltransferase from vibrio cholerae o1 biovar eltor str. n16961 0.9799 2 311
ID Description Score Start End Superfamily
af_P0AAI9_6_286_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9822 7 291 3.20.10.10
af_P0AAI9_6_286_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9753 7 291 3.20.10.10
2g1hA01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.975 3 313 3.40.366.10
2g1hA01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9668 3 313 3.40.366.10
3tqeA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding 0.9586 124 202 3.30.70.250
ID Description Score Start End GO Terms
AF-A0A1H4AF03-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9966 1 315 GO:0004314
GO:0005829
GO:0006633
AF-A0A429WVA6-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9962 1 315 GO:0004314
GO:0005829
GO:0006633
AF-A0A1Y1J9N5-F1-model_v4 deleted 0.9959 1 316
AF-A0A7W9TU84-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9936 3 315 GO:0004314
GO:0005829
GO:0006633
AF-A0A4S8FAB7-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9933 1 316 GO:0004314
GO:0005829
GO:0006633

Map