metagRoot

F457906

General Info

Members	Datasets	Scaffolds	Average Seq Length
515	281	515	235

Family's Representative Sequence

Representative Sequence	3300048905\|Ga0496102_0012915\|Ga0496102_0012915_2078_2899
Length	273
Sequence	MEIVRREKADDFRIRQLRAQQMLRGELDGDDLEEYVKERVLTTTFETAVDWARGNSMFPATFGLACCAIEMMSVVGARLDIARFGFEAFRATPRQADMLILSGRVSIKMAPVVRRIYDQMLEPKWAIAMGACSSSMGVFNNYAIVPADKFLPVDIHIPGCPPRPEALIYGILKLQRKIFGEPDLGWRERYKAYGTEEDERPWKSGPLSVQRVGAAPSDGIVESHGSPPSDAELHAPISHPELSGHEAHDAWEEAADDERVTTSRPPGDRRGDA

Samples

	Sample ID	Description	Type	Environment
1	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
2	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
3	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
4	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
5	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
6	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
7	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
8	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
9	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
10	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
11	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
12	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
13	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
14	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
15	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
16	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
17	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
18	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
19	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
20	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
21	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
22	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
23	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
24	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
25	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
26	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
27	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
28	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
29	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
30	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
31	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
32	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
33	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
34	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
35	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
36	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
37	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
38	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
39	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
40	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
41	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
42	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
43	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
44	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
45	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
46	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
47	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
48	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
49	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
50	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
51	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
52	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
53	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
54	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
55	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
56	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
57	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
58	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
59	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
60	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
61	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
62	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
63	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
64	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
65	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
66	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
67	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
68	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
69	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
70	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
71	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
72	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
73	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
74	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
75	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
76	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
77	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
78	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
79	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
80	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
81	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
82	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
83	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
84	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
85	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
86	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
87	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
88	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
89	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
90	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
91	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
133	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
136	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
137	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
138	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
139	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
140	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
141	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
142	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
143	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
144	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
145	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
146	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
147	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
148	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
149	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
150	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
151	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
152	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
153	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
154	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
155	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
156	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
157	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
158	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
159	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
160	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
161	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
162	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
163	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
164	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
165	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
166	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
167	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
168	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
169	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
170	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
171	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
172	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
173	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
174	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
175	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
176	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
177	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
178	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
179	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
180	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
181	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
182	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
183	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
184	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
185	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
186	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
187	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
188	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
189	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
190	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
191	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
192	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
193	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
194	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
195	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
196	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
197	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
198	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
199	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
200	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
201	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
202	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
203	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
204	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
205	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
206	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
207	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
208	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
209	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
210	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
211	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
212	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
213	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
214	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
215	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
216	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
217	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
218	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
219	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
220	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
221	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
222	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
223	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
224	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
225	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
226	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
227	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
228	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
229	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
230	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
231	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
232	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
233	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
234	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
235	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
236	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
237	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
238	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
239	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
240	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
241	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
242	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
243	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
244	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
245	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
246	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
247	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
248	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
249	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
250	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
251	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
252	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
253	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
254	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
255	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
256	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
257	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
258	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
259	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
261	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
262	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
263	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
264	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
265	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
266	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
267	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
268	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
269	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
270	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
271	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
272	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
273	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
274	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
275	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
276	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
277	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
278	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
279	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
280	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
281	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.22
Metatranscriptomes	0.78
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.27
Nodule	0
Rhizoplane	9.32
Rhizosphere	84.08
Stem	0
Stem Tuber	0
Unclassified	2.33

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24737J22298_10017875	3300001990	Bacteria	2280
2	JGI24737J22298_10064496	3300001990	Bacteria	1099
3	JGI25405J52794_10036623	3300003911	Bacteria	1030
4	Ga0070676_10232008	3300005328	Bacteria	1224
5	Ga0070683_100088996	3300005329	Bacteria	2897
6	Ga0070683_100133311	3300005329	Bacteria	2351
7	Ga0070683_101153511	3300005329	Bacteria	744
8	Ga0070690_100212496	3300005330	Bacteria	1351
9	Ga0070670_100390031	3300005331	Bacteria	1228
10	Ga0070682_100051419	3300005337	Bacteria	2575
11	Ga0070682_100150420	3300005337	Bacteria	1597
12	Ga0068868_100299714	3300005338	Bacteria	1365
13	Ga0068868_100754553	3300005338	Bacteria	875
14	Ga0068868_100979508	3300005338	Bacteria	772
15	Ga0070660_100001669	3300005339	Bacteria	15240
16	Ga0070660_100186754	3300005339	Bacteria	1678
17	Ga0070660_100880788	3300005339	Bacteria	754
18	Ga0070689_100100164	3300005340	Bacteria	2292
19	Ga0070691_10054227	3300005341	Bacteria	1919
20	Ga0070692_10056974	3300005345	Bacteria	2047
21	Ga0070692_10197634	3300005345	Bacteria	1176
22	Ga0070692_10362612	3300005345	Bacteria	904
23	Ga0070668_100030302	3300005347	Bacteria	4113
24	Ga0070675_100029576	3300005354	Bacteria	4420
25	Ga0070671_100278381	3300005355	Bacteria	1423
26	Ga0070674_100019860	3300005356	Bacteria	4278
27	Ga0070674_100122245	3300005356	Bacteria	1929
28	Ga0070674_100712864	3300005356	Bacteria	859
29	Ga0070688_100221808	3300005365	Bacteria	1333
30	Ga0070659_100014074	3300005366	Bacteria	5970
31	Ga0070659_100031084	3300005366	Bacteria	4134
32	Ga0070709_10175567	3300005434	Bacteria	1501
33	Ga0070714_100019766	3300005435	Bacteria	5493
34	Ga0070714_100457058	3300005435	Bacteria	1213
35	Ga0070713_100201107	3300005436	Bacteria	1799
36	Ga0070713_100554440	3300005436	Bacteria	1088
37	Ga0070711_100228215	3300005439	Bacteria	1451
38	Ga0070700_100008502	3300005441	Bacteria	5589
39	Ga0070700_100030467	3300005441	Bacteria	3224
40	Ga0070700_100077913	3300005441	Bacteria	2133
41	Ga0070663_100002800	3300005455	Bacteria	9895
42	Ga0070678_100199985	3300005456	Bacteria	1649
43	Ga0070678_100318810	3300005456	Bacteria	1327
44	Ga0070662_100059992	3300005457	Bacteria	2772
45	Ga0070662_100119426	3300005457	Bacteria	2019
46	Ga0070662_100131853	3300005457	Bacteria	1928
47	Ga0070681_10493321	3300005458	Bacteria	1138
48	Ga0068867_100090687	3300005459	Bacteria	2319
49	Ga0070685_10124147	3300005466	Bacteria	1606
50	Ga0070684_100032378	3300005535	Bacteria	4455
51	Ga0070684_100152709	3300005535	Bacteria	2093
52	Ga0070684_100377979	3300005535	Bacteria	1304
53	Ga0070684_100738316	3300005535	Bacteria	919
54	Ga0068853_100028808	3300005539	Bacteria	4674
55	Ga0070686_100632579	3300005544	Bacteria	846
56	Ga0070693_100237123	3300005547	Bacteria	1203
57	Ga0070665_100197463	3300005548	Bacteria	2013
58	Ga0070664_100183995	3300005564	Bacteria	1858
59	Ga0070664_100282983	3300005564	Bacteria	1496
60	Ga0068857_100167556	3300005577	Bacteria	1996
61	Ga0068857_100338952	3300005577	Bacteria	1391
62	Ga0068854_100070754	3300005578	Bacteria	2550
63	Ga0068854_100102260	3300005578	Bacteria	2150
64	Ga0068856_101015888	3300005614	Bacteria	847
65	Ga0070702_100021251	3300005615	Bacteria	3412
66	Ga0070702_100097458	3300005615	Bacteria	1797
67	Ga0070702_100495967	3300005615	Bacteria	896
68	Ga0068852_100161162	3300005616	Bacteria	2095
69	Ga0068852_100553932	3300005616	Bacteria	1150
70	Ga0068859_100133108	3300005617	Bacteria	2558
71	Ga0068859_100278622	3300005617	Bacteria	1765
72	Ga0068864_100097205	3300005618	Bacteria	2607
73	Ga0068864_100546086	3300005618	Bacteria	1119
74	Ga0068861_100496396	3300005719	Bacteria	1102
75	Ga0068870_10021017	3300005840	Bacteria	3187
76	Ga0068863_100461385	3300005841	Bacteria	1248
77	Ga0068858_100163827	3300005842	Bacteria	2094
78	Ga0068860_100104399	3300005843	Bacteria	2705
79	Ga0081455_10007545	3300005937	Bacteria	11439
80	Ga0081538_10001191	3300005981	Bacteria	27404
81	Ga0081540_1000568	3300005983	Bacteria	35821
82	Ga0081539_10001045	3300005985	Bacteria	50690
83	Ga0081539_10001489	3300005985	Bacteria	39599
84	Ga0081539_10005444	3300005985	Bacteria	12992
85	Ga0070717_10028271	3300006028	Bacteria	4487
86	Ga0070717_10110889	3300006028	Bacteria	2340
87	Ga0075365_10001589	3300006038	Bacteria	10448
88	Ga0075365_10006537	3300006038	Bacteria	6421
89	Ga0075365_10019279	3300006038	Bacteria	4208
90	Ga0075368_10056615	3300006042	Bacteria	1565
91	Ga0075363_100008514	3300006048	Bacteria	4779
92	Ga0075363_100041207	3300006048	Bacteria	2435
93	Ga0075363_100092696	3300006048	Bacteria	1664
94	Ga0075363_100204917	3300006048	Bacteria	1128
95	Ga0075364_10059932	3300006051	Bacteria	2496
96	Ga0075364_10294487	3300006051	Bacteria	1105
97	Ga0075432_10061981	3300006058	Bacteria	1333
98	Ga0070715_10057327	3300006163	Bacteria	1697
99	Ga0070712_100000013	3300006175	Bacteria	109912
100	Ga0070712_100002893	3300006175	Bacteria	10651
101	Ga0070712_100067270	3300006175	Bacteria	2549
102	Ga0075367_10065179	3300006178	Bacteria	2181
103	Ga0097621_100770796	3300006237	Bacteria	890
104	Ga0068871_100375678	3300006358	Bacteria	1262
105	Ga0075434_100158025	3300006871	Bacteria	2287
106	Ga0075434_100356912	3300006871	Bacteria	1483
107	Ga0068865_100001280	3300006881	Bacteria	14644
108	Ga0068865_100114880	3300006881	Bacteria	1992
109	Ga0068865_100619216	3300006881	Bacteria	917
110	Ga0068865_100922714	3300006881	Bacteria	760
111	Ga0097620_100133112	3300006931	Bacteria	2558
112	Ga0097620_100278624	3300006931	Bacteria	1765
113	Ga0075435_100495085	3300007076	Bacteria	1057
114	Ga0105240_10018075	3300009093	Bacteria	9479
115	Ga0111539_10063618	3300009094	Bacteria	4365
116	Ga0105245_10350196	3300009098	Bacteria	1463
117	Ga0105245_10894708	3300009098	Bacteria	929
118	Ga0105247_10229146	3300009101	Bacteria	1261
119	Ga0105243_10023540	3300009148	Bacteria	4692
120	Ga0105243_10176524	3300009148	Bacteria	1854
121	Ga0105243_10214267	3300009148	Bacteria	1698
122	Ga0105243_10275440	3300009148	Bacteria	1513
123	Ga0105243_10303868	3300009148	Bacteria	1447
124	Ga0105243_10778866	3300009148	Bacteria	941
125	Ga0105241_10127111	3300009174	Bacteria	2060
126	Ga0105242_10098001	3300009176	Bacteria	2479
127	Ga0105242_10129852	3300009176	Bacteria	2173
128	Ga0105248_10244961	3300009177	Bacteria	2018
129	Ga0105237_10740336	3300009545	Bacteria	989
130	Ga0105238_10678829	3300009551	Bacteria	1041
131	Ga0105239_10040445	3300010375	Bacteria	5108
132	Ga0105239_10403099	3300010375	Bacteria	1548
133	Ga0105239_11028559	3300010375	Bacteria	947
134	Ga0105246_10167617	3300011119	Bacteria	1679
135	Ga0157371_10313935	3300013102	Bacteria	1137
136	Ga0157378_10186833	3300013297	Bacteria	1952
137	Ga0157378_11388859	3300013297	Bacteria	745
138	Ga0163162_10574445	3300013306	Bacteria	1255
139	Ga0157372_10391961	3300013307	Bacteria	1618
140	Ga0157372_11330501	3300013307	Bacteria	829
141	Ga0157375_10056009	3300013308	Bacteria	3890
142	Ga0157375_10157295	3300013308	Bacteria	2412
143	Ga0163163_10046316	3300014325	Bacteria	4272
144	Ga0157380_10049473	3300014326	Bacteria	3316
145	Ga0157380_10538390	3300014326	Bacteria	1143
146	Ga0157380_10540175	3300014326	Bacteria	1141
147	Ga0157379_10160198	3300014968	Bacteria	2031
148	Ga0163161_10133540	3300017792	Bacteria	1874
149	Ga0163161_10332112	3300017792	Bacteria	1204
150	Ga0197907_10991395	3300020069	Bacteria	1425
151	Ga0213875_10014084	3300021388	Bacteria	3910
152	Ga0213875_10064693	3300021388	Bacteria	1709
153	Ga0207426_1042188	3300025302	Bacteria	1409
154	Ga0207656_10105523	3300025321	Bacteria	1296
155	Ga0207642_10043753	3300025899	Bacteria	1978
156	Ga0207710_10200003	3300025900	Bacteria	986
157	Ga0207710_10241315	3300025900	Bacteria	902
158	Ga0207688_10030391	3300025901	Bacteria	2978
159	Ga0207688_10049244	3300025901	Bacteria	2355
160	Ga0207688_10060014	3300025901	Bacteria	2142
161	Ga0207647_10057343	3300025904	Bacteria	2387
162	Ga0207645_10187261	3300025907	Bacteria	1359
163	Ga0207643_10019273	3300025908	Bacteria	3738
164	Ga0207643_10025586	3300025908	Bacteria	3263
165	Ga0207643_10253678	3300025908	Bacteria	1084
166	Ga0207705_10030926	3300025909	Bacteria	3821
167	Ga0207695_10017468	3300025913	Bacteria	8348
168	Ga0207671_10100708	3300025914	Bacteria	2188
169	Ga0207693_10007488	3300025915	Bacteria	8975
170	Ga0207693_10118510	3300025915	Bacteria	2079
171	Ga0207657_10004224	3300025919	Bacteria	15215
172	Ga0207657_10129189	3300025919	Bacteria	2072
173	Ga0207657_10480262	3300025919	Bacteria	974
174	Ga0207652_10437287	3300025921	Bacteria	1179
175	Ga0207650_10506026	3300025925	Bacteria	1010
176	Ga0207659_10370722	3300025926	Bacteria	1192
177	Ga0207687_10067011	3300025927	Bacteria	2553
178	Ga0207687_10242623	3300025927	Bacteria	1429
179	Ga0207700_10624859	3300025928	Bacteria	959
180	Ga0207664_10002161	3300025929	Bacteria	12930
181	Ga0207664_10344561	3300025929	Bacteria	1318
182	Ga0207690_10020757	3300025932	Bacteria	4063
183	Ga0207690_10149095	3300025932	Bacteria	1732
184	Ga0207690_10239941	3300025932	Bacteria	1396
185	Ga0207690_10489880	3300025932	Bacteria	993
186	Ga0207706_10061353	3300025933	Bacteria	3311
187	Ga0207706_10123874	3300025933	Bacteria	2274
188	Ga0207706_10868030	3300025933	Bacteria	763
189	Ga0207686_10054690	3300025934	Bacteria	2501
190	Ga0207709_10045449	3300025935	Bacteria	2659
191	Ga0207709_10051587	3300025935	Bacteria	2522
192	Ga0207709_10096377	3300025935	Bacteria	1946
193	Ga0207669_10080944	3300025937	Bacteria	2079
194	Ga0207669_10183989	3300025937	Bacteria	1501
195	Ga0207704_10011097	3300025938	Bacteria	4422
196	Ga0207691_10215905	3300025940	Bacteria	1665
197	Ga0207711_10139695	3300025941	Bacteria	2178
198	Ga0207661_10088111	3300025944	Bacteria	2579
199	Ga0207679_10063332	3300025945	Bacteria	2760
200	Ga0207679_10203615	3300025945	Bacteria	1655
201	Ga0207712_10165774	3300025961	Bacteria	1722
202	Ga0207712_10298660	3300025961	Bacteria	1321
203	Ga0207640_10179634	3300025981	Bacteria	1586
204	Ga0207677_10291858	3300026023	Bacteria	1343
205	Ga0207639_10040252	3300026041	Bacteria	3487
206	Ga0207639_10105773	3300026041	Bacteria	2283
207	Ga0207639_10384486	3300026041	Bacteria	1261
208	Ga0207678_10002606	3300026067	Bacteria	16433
209	Ga0207678_10286642	3300026067	Bacteria	1414
210	Ga0207708_10001007	3300026075	Bacteria	21085
211	Ga0207708_10082234	3300026075	Bacteria	2476
212	Ga0207708_10160813	3300026075	Bacteria	1773
213	Ga0207708_10441679	3300026075	Bacteria	1082
214	Ga0207702_10039414	3300026078	Bacteria	3958
215	Ga0207702_10184969	3300026078	Bacteria	1921
216	Ga0207648_10073188	3300026089	Bacteria	2987
217	Ga0207676_10094746	3300026095	Bacteria	2461
218	Ga0207674_10020606	3300026116	Bacteria	7119
219	Ga0207674_10160023	3300026116	Bacteria	2206
220	Ga0207675_100044705	3300026118	Bacteria	4139
221	Ga0207675_100423957	3300026118	Bacteria	1314
222	Ga0207675_100492231	3300026118	Bacteria	1220
223	Ga0207683_10140656	3300026121	Bacteria	2175
224	Ga0207683_10254433	3300026121	Bacteria	1603
225	Ga0207683_10305054	3300026121	Bacteria	1457
226	Ga0207698_10104880	3300026142	Bacteria	2354
227	Ga0207698_10194016	3300026142	Bacteria	1812
228	Ga0207698_10681668	3300026142	Bacteria	1021
229	Ga0207698_10696872	3300026142	Bacteria	1010
230	Ga0207428_10062582	3300027907	Bacteria	2942
231	Ga0268266_10267802	3300028379	Bacteria	1585
232	Ga0268266_10545380	3300028379	Bacteria	1111
233	Ga0268265_10463683	3300028380	Bacteria	1186
234	Ga0268265_10669667	3300028380	Bacteria	999
235	Ga0265326_10002998	3300028558	Bacteria	5614
236	Ga0265319_1001901	3300028563	Bacteria	11865
237	Ga0265318_10000545	3300028577	Bacteria	26811
238	Ga0265322_10081786	3300028654	Bacteria	916
239	Ga0265336_10000001	3300028666	Bacteria	916179
240	Ga0265338_10000004	3300028800	Bacteria	644793
241	Ga0265332_10207300	3300031238	Bacteria	814
242	Ga0265325_10109896	3300031241	Bacteria	1341
243	Ga0265340_10000002	3300031247	Bacteria	711693
244	Ga0265339_10138895	3300031249	Bacteria	1237
245	Ga0265316_10030285	3300031344	Bacteria	4438
246	Ga0307408_100230751	3300031548	Bacteria	1516
247	Ga0316576_10122001	3300031727	Bacteria	1958
248	Ga0307405_10096618	3300031731	Bacteria	1970
249	Ga0307413_10076970	3300031824	Bacteria	2122
250	Ga0307410_10024313	3300031852	Bacteria	3783
251	Ga0307410_10040733	3300031852	Bacteria	3059
252	Ga0307410_10407211	3300031852	Bacteria	1100
253	Ga0307406_10093082	3300031901	Bacteria	2034
254	Ga0307406_10432386	3300031901	Bacteria	1051
255	Ga0307407_10021524	3300031903	Bacteria	3328
256	Ga0307407_10348128	3300031903	Bacteria	1048
257	Ga0307412_10152724	3300031911	Bacteria	1706
258	Ga0307412_10249379	3300031911	Bacteria	1378
259	Ga0307409_100048138	3300031995	Bacteria	3241
260	Ga0307409_100131999	3300031995	Bacteria	2136
261	Ga0307409_100572469	3300031995	Bacteria	1112
262	Ga0307409_100590347	3300031995	Bacteria	1096
263	Ga0307409_100868897	3300031995	Bacteria	914
264	Ga0307416_100006134	3300032002	Bacteria	7489
265	Ga0307416_100169926	3300032002	Bacteria	2028
266	Ga0307416_100690692	3300032002	Bacteria	1109
267	Ga0307416_100700132	3300032002	Bacteria	1102
268	Ga0307416_100957700	3300032002	Bacteria	958
269	Ga0307414_10070620	3300032004	Bacteria	2515
270	Ga0307414_10209494	3300032004	Bacteria	1592
271	Ga0307414_10557400	3300032004	Bacteria	1022
272	Ga0307414_10718167	3300032004	Bacteria	906
273	Ga0307411_10058554	3300032005	Bacteria	2550
274	Ga0307415_100092951	3300032126	Bacteria	2189
275	Ga0307415_100238210	3300032126	Bacteria	1470
276	Ga0307415_100514167	3300032126	Bacteria	1049
277	Ga0373949_0078127	3300035090	Bacteria	878
278	Ga0373953_0021152	3300035117	Bacteria	2438
279	Ga0373954_0022104	3300035118	Bacteria	2884
280	Ga0373957_0056611	3300035120	Bacteria	1510
281	Ga0373946_0277031	3300035171	Bacteria	824
282	Ga0316574_0068583	3300035398	Bacteria	2237
283	Ga0373933_0308816	3300035724	Bacteria	1025
284	Ga0373937_0024988	3300036401	Bacteria	5391
285	Ga0316584_0110090	3300036712	Bacteria	2061
286	Ga0373925_0348231	3300037068	Bacteria	1202
287	Ga0395900_0002246	3300037418	Bacteria	21499
288	Ga0395898_0003455	3300037466	Bacteria	17662
289	Ga0395898_0105497	3300037466	Bacteria	2702
290	Ga0395898_0328615	3300037466	Bacteria	1458
291	Ga0395898_0350362	3300037466	Bacteria	1408
292	Ga0436364_1438537	3300037853	Bacteria	5416
293	Ga0395901_0006802	3300038443	Bacteria	11553
294	Ga0395901_0180843	3300038443	Bacteria	2212
295	Ga0395901_0519269	3300038443	Bacteria	1210
296	Ga0436365_0824534	3300039437	Bacteria	1548
297	Ga0436365_1102108	3300039437	Bacteria	21525
298	Ga0436365_1725409	3300039437	Bacteria	5697
299	Ga0436363_0012859	3300039450	Bacteria	1296
300	Ga0436363_0669888	3300039450	Bacteria	1201
301	Ga0436363_0850733	3300039450	Bacteria	845
302	Ga0436362_0239758	3300039453	Bacteria	2799
303	Ga0451791_0327589	3300041451	Bacteria	3598
304	Ga0439448_0013856	3300042005	Bacteria	2428
305	Ga0439455_0014762	3300042012	Bacteria	1787
306	Ga0439463_037411	3300042016	Bacteria	1231
307	Ga0466972_0290006	3300044658	Bacteria	765
308	Ga0466965_0056854	3300044683	Bacteria	1949
309	Ga0466965_0193315	3300044683	Bacteria	1077
310	Ga0466966_0033106	3300044684	Bacteria	3347
311	Ga0466963_0006643	3300044694	Bacteria	6867
312	Ga0466963_0019103	3300044694	Bacteria	4292
313	Ga0466963_0056025	3300044694	Bacteria	2623
314	Ga0466963_0237275	3300044694	Bacteria	1278
315	Ga0466963_0319092	3300044694	Bacteria	1093
316	Ga0466963_0323368	3300044694	Bacteria	1085
317	Ga0466963_0421331	3300044694	Bacteria	941
318	Ga0466971_0030125	3300044719	Bacteria	2428
319	Ga0466971_0164061	3300044719	Bacteria	1040
320	Ga0466971_0207401	3300044719	Bacteria	926
321	Ga0466968_0300984	3300044735	Bacteria	771
322	Ga0466970_0223929	3300044765	Unclassified	1050
323	Ga0466970_0424286	3300044765	Bacteria	760
324	Ga0466957_0023685	3300044842	Bacteria	3631
325	Ga0466957_0045760	3300044842	Bacteria	2654
326	Ga0466957_0049437	3300044842	Bacteria	2557
327	Ga0466957_0091952	3300044842	Unclassified	1902
328	Ga0466957_0156531	3300044842	Bacteria	1477
329	Ga0466957_0222145	3300044842	Bacteria	1248
330	Ga0466960_0000181	3300044901	Bacteria	21653
331	Ga0466960_0007477	3300044901	Bacteria	4440
332	Ga0466959_0000694	3300045049	Bacteria	19701
333	Ga0466959_0001464	3300045049	Bacteria	14467
334	Ga0466959_0014631	3300045049	Bacteria	5708
335	Ga0466959_0046460	3300045049	Bacteria	3194
336	Ga0466958_0001617	3300045836	Bacteria	10842
337	Ga0466958_0005363	3300045836	Bacteria	6889
338	Ga0466958_0091739	3300045836	Bacteria	1881
339	Ga0466958_0162550	3300045836	Bacteria	1411
340	Ga0466967_0001002	3300045976	Bacteria	15413
341	Ga0466967_0004740	3300045976	Bacteria	9253
342	Ga0466967_0006851	3300045976	Bacteria	8130
343	Ga0466967_0027823	3300045976	Bacteria	4709
344	Ga0466967_0040152	3300045976	Bacteria	4027
345	Ga0466967_0064248	3300045976	Bacteria	3263
346	Ga0466967_0099987	3300045976	Bacteria	2649
347	Ga0466967_0300195	3300045976	Bacteria	1545
348	Ga0466967_0335872	3300045976	Bacteria	1460
349	Ga0466967_0351525	3300045976	Bacteria	1427
350	Ga0466967_0353698	3300045976	Bacteria	1422
351	Ga0466967_0747992	3300045976	Bacteria	969
352	Ga0495592_0145852	3300046454	Bacteria	1641
353	Ga0495629_0202789	3300046459	Bacteria	1371
354	Ga0495641_0006906	3300046461	Bacteria	7243
355	Ga0495641_0034868	3300046461	Bacteria	2376
356	Ga0495641_0042503	3300046461	Bacteria	2106
357	Ga0495651_0010955	3300046462	Bacteria	6975
358	Ga0495650_0000053	3300046471	Bacteria	316684
359	Ga0495582_0099192	3300046473	Bacteria	1630
360	Ga0495662_0111604	3300046476	Bacteria	1340
361	Ga0495664_0205994	3300046477	Bacteria	1192
362	Ga0495664_0342590	3300046477	Bacteria	901
363	Ga0495596_0076942	3300046500	Bacteria	1296
364	Ga0495618_0027308	3300046514	Bacteria	3554
365	Ga0495631_0187082	3300046518	Bacteria	887
366	Ga0495632_0179314	3300046519	Bacteria	971
367	Ga0495644_0008448	3300046523	Bacteria	3967
368	Ga0495652_0106110	3300046529	Bacteria	2269
369	Ga0495667_0046512	3300046559	Bacteria	2869
370	Ga0495656_0008515	3300046615	Bacteria	3664
371	Ga0495635_0011412	3300046663	Bacteria	6232
372	Ga0495657_0010844	3300046675	Bacteria	6841
373	Ga0495647_0021635	3300046681	Bacteria	2317
374	Ga0495658_0014291	3300046683	Bacteria	4054
375	Ga0495658_0202614	3300046683	Bacteria	1237
376	Ga0495589_0187057	3300046794	Bacteria	981
377	Ga0495600_0135576	3300046809	Bacteria	1599
378	Ga0495604_0223686	3300047317	Bacteria	1294
379	Ga0495674_0015458	3300047319	Bacteria	7132
380	Ga0495674_0532214	3300047319	Bacteria	937
381	Ga0495672_0052078	3300047320	Bacteria	2406
382	Ga0495676_0109852	3300047321	Bacteria	2025
383	Ga0495680_0003599	3300047322	Bacteria	15170
384	Ga0495675_0027217	3300047444	Bacteria	3644
385	Ga0495673_0012407	3300047469	Bacteria	4522
386	Ga0495684_0011380	3300047471	Bacteria	6870
387	Ga0496100_0001662	3300048903	Bacteria	11028
388	Ga0496100_0358450	3300048903	Bacteria	1103
389	Ga0496100_0679951	3300048903	Bacteria	802
390	Ga0496101_0001032	3300048904	Bacteria	16420
391	Ga0496101_0001988	3300048904	Bacteria	12406
392	Ga0496101_0111063	3300048904	Bacteria	2063
393	Ga0496102_0012915	3300048905	Bacteria	7232
394	Ga0496102_0450930	3300048905	Bacteria	1207
395	Ga0496104_0013656	3300048907	Bacteria	7322
396	Ga0496104_0058522	3300048907	Bacteria	3648
397	Ga0496104_0066408	3300048907	Bacteria	3425
398	Ga0496105_0217134	3300048908	Bacteria	1557
399	Ga0496105_0473789	3300048908	Bacteria	986
400	Ga0496106_0015340	3300048909	Bacteria	5670
401	Ga0496106_0213273	3300048909	Bacteria	1538
402	Ga0496107_0002155	3300048910	Bacteria	12647
403	Ga0496107_0038123	3300048910	Bacteria	3449
404	Ga0496107_0250323	3300048910	Bacteria	1318
405	Ga0496108_0002529	3300048911	Bacteria	14633
406	Ga0496108_0013342	3300048911	Bacteria	6700
407	Ga0496108_0085236	3300048911	Bacteria	2681
408	Ga0496108_0124361	3300048911	Bacteria	2214
409	Ga0496108_0695403	3300048911	Bacteria	882
410	Ga0496109_0007698	3300048912	Bacteria	9129
411	Ga0496109_0035002	3300048912	Bacteria	4527
412	Ga0496109_0215502	3300048912	Bacteria	1805
413	Ga0496109_0336368	3300048912	Bacteria	1426
414	Ga0496110_0001092	3300048913	Bacteria	19117
415	Ga0496110_0555201	3300048913	Bacteria	1043
416	Ga0496111_0024384	3300048914	Bacteria	4259
417	Ga0496111_0042675	3300048914	Bacteria	3257
418	Ga0496111_0135410	3300048914	Bacteria	1824
419	Ga0496112_0000095	3300048915	Bacteria	57431
420	Ga0496112_0036205	3300048915	Bacteria	4813
421	Ga0496112_0042428	3300048915	Bacteria	4451
422	Ga0496112_0097313	3300048915	Bacteria	2913
423	Ga0496112_0145218	3300048915	Bacteria	2341
424	Ga0496112_0520338	3300048915	Bacteria	1124
425	Ga0496112_0533058	3300048915	Bacteria	1108
426	Ga0496113_0003866	3300048916	Bacteria	9068
427	Ga0496113_0066251	3300048916	Bacteria	2735
428	Ga0496113_0113703	3300048916	Bacteria	2110
429	Ga0496113_0742114	3300048916	Bacteria	782
430	Ga0496114_0174589	3300048917	Bacteria	1874
431	Ga0496114_0217393	3300048917	Bacteria	1677
432	Ga0496115_0005651	3300048918	Bacteria	9094
433	Ga0496115_0478963	3300048918	Bacteria	1002
434	Ga0496119_0200835	3300048922	Bacteria	1032
435	Ga0496121_0002770	3300048924	Bacteria	26007
436	Ga0496126_0207358	3300048929	Bacteria	1652
437	Ga0501034_0008091	3300049571	Bacteria	11153
438	Ga0501034_0385490	3300049571	Bacteria	1326
439	Ga0501036_0235928	3300049572	Bacteria	1534
440	Ga0501039_0113175	3300049575	Bacteria	2122
441	Ga0501039_0548008	3300049575	Bacteria	907
442	Ga0501040_0010625	3300049576	Bacteria	6021
443	Ga0501040_0091759	3300049576	Bacteria	2111
444	Ga0501041_0211450	3300049577	Bacteria	1216
445	Ga0501042_0141260	3300049578	Bacteria	1736
446	Ga0501046_0449740	3300049580	Bacteria	926
447	Ga0501048_0046630	3300049582	Bacteria	3093
448	Ga0501048_0063398	3300049582	Bacteria	2614
449	Ga0501048_0111621	3300049582	Bacteria	1930
450	Ga0501070_0185229	3300049586	Bacteria	1712
451	Ga0501070_0694103	3300049586	Bacteria	805
452	Ga0501070_0729182	3300049586	Bacteria	782
453	Ga0501071_0087176	3300049587	Bacteria	2290
454	Ga0501071_0121839	3300049587	Bacteria	1933
455	Ga0501071_0144586	3300049587	Bacteria	1772
456	Ga0501071_0264094	3300049587	Bacteria	1300
457	Ga0501072_0016803	3300049588	Bacteria	5620
458	Ga0501072_0038280	3300049588	Bacteria	3763
459	Ga0501074_0068386	3300049590	Bacteria	2553
460	Ga0501075_0020119	3300049591	Bacteria	4849
461	Ga0501075_0115517	3300049591	Bacteria	2041
462	Ga0501076_0030426	3300049592	Bacteria	4205
463	Ga0501076_0147010	3300049592	Bacteria	1916
464	Ga0501076_0529315	3300049592	Bacteria	972
465	Ga0501077_0016549	3300049593	Bacteria	4646
466	Ga0501079_0019643	3300049741	Bacteria	5160
467	Ga0501080_0081359	3300049742	Bacteria	3009
468	Ga0501080_0203012	3300049742	Bacteria	1819
469	Ga0501081_0018355	3300049743	Bacteria	4645
470	Ga0501081_0226238	3300049743	Bacteria	1361
471	Ga0501081_0482873	3300049743	Bacteria	922
472	Ga0501083_0025105	3300049744	Bacteria	4128
473	Ga0501035_0101777	3300049822	Bacteria	2521
474	Ga0501035_0151660	3300049822	Bacteria	2011
475	Ga0501035_0332672	3300049822	Bacteria	1274
476	Ga0501044_0467623	3300049823	Bacteria	1166
477	Ga0501045_0010013	3300049824	Bacteria	6631
478	Ga0501045_0244219	3300049824	Bacteria	1336
479	nmdc:mga00v17_24681_c1	3300050491	Bacteria	3488
480	nmdc:mga00v17_34256_c1	3300050491	Bacteria	3015
481	nmdc:mga00v17_78772_c1	3300050491	Bacteria	2054
482	nmdc:mga00v17_80638_c1	3300050491	Bacteria	2031
483	nmdc:mga0yw44_200428_c1	3300050492	Bacteria	1318
484	nmdc:mga0yw44_3109_c1	3300050492	Bacteria	7278
485	nmdc:mga0yw44_77001_c1	3300050492	Bacteria	2083
486	nmdc:mga0yw44_80072_c1	3300050492	Bacteria	2045
487	nmdc:mga0yw44_88197_c1	3300050492	Bacteria	1956
488	nmdc:mga05p37_185386_c1	3300050507	Bacteria	2530
489	nmdc:mga09592_151397_c1	3300050508	Bacteria	2001
490	nmdc:mga08y16_114787_c1	3300050511	Bacteria	2804
491	nmdc:mga08y16_226079_c1	3300050511	Bacteria	1936
492	nmdc:mga0n895_336090_c1	3300050512	Bacteria	1530
493	nmdc:mga0n895_458595_c1	3300050512	Bacteria	1286
494	nmdc:mga0a205_50302_c1	3300050515	Bacteria	4023
495	Ga0495601_0035823	3300053077	Bacteria	3099
496	Ga0495612_0247195	3300053078	Bacteria	793
497	Ga0495655_0066949	3300053083	Bacteria	995
498	Ga0495655_0096628	3300053083	Bacteria	869
499	Ga0495619_0018953	3300053085	Bacteria	4370
500	Ga0500616_0006584	3300053153	Bacteria	7574
501	Ga0501084_0014085	3300054114	Bacteria	6622
502	Ga0501084_0033542	3300054114	Bacteria	4295
503	Ga0501084_0261983	3300054114	Bacteria	1459
504	Ga0590075_051026	3300059424	Bacteria	1061
505	Ga0587083_0059437	3300059505	Bacteria	857
506	Ga0587090_019800	3300059510	Bacteria	1041
507	Ga0587111_0020888	3300060346	Bacteria	1257
508	Ga0501082_0176203	3300060353	Bacteria	1859
509	Ga0501082_0280830	3300060353	Bacteria	1449
510	Ga0466962_0015902	3300061719	Bacteria	3631
511	Ga0466962_0016871	3300061719	Bacteria	3519
512	Ga0466962_0223274	3300061719	Bacteria	923
513	Ga0530510_0076350	3300061734	Bacteria	2434
514	Ga0530510_0100672	3300061734	Bacteria	2113
515	Ga0530510_0169453	3300061734	Bacteria	1617

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009545	Ga0105237_10740336	Ga0105237_107403361	187
2	3300006048	Ga0075363_100041207	Ga0075363_1000412072	193
3	3300050491	nmdc:mga00v17_34256_c1	nmdc:mga00v17_34256_c1_617_1435	195
4	3300050492	nmdc:mga0yw44_77001_c1	nmdc:mga0yw44_77001_c1_522_1340	195
5	3300048916	Ga0496113_0066251	Ga0496113_0066251_1964_2725	196
6	3300006178	Ga0075367_10065179	Ga0075367_100651793	198
7	3300006048	Ga0075363_100092696	Ga0075363_1000926962	199
8	3300050492	nmdc:mga0yw44_80072_c1	nmdc:mga0yw44_80072_c1_268_1089	199
9	3300050492	nmdc:mga0yw44_88197_c1	nmdc:mga0yw44_88197_c1_854_1672	199
10	3300031548	Ga0307408_100230751	Ga0307408_1002307512	201
11	3300005456	Ga0070678_100318810	Ga0070678_1003188102	203
12	3300006871	Ga0075434_100356912	Ga0075434_1003569122	203
13	3300026121	Ga0207683_10254433	Ga0207683_102544332	203
14	3300050492	nmdc:mga0yw44_200428_c1	nmdc:mga0yw44_200428_c1_47_832	203
15	3300050512	nmdc:mga0n895_336090_c1	nmdc:mga0n895_336090_c1_335_1084	203
16	3300046461	Ga0495641_0006906	Ga0495641_0006906_4370_5089	207
17	3300046476	Ga0495662_0111604	Ga0495662_0111604_422_1141	207
18	3300046683	Ga0495658_0014291	Ga0495658_0014291_593_1312	207
19	3300031344	Ga0265316_10030285	Ga0265316_100302852	208
20	3300035398	Ga0316574_0068583	Ga0316574_0068583_746_1612	209
21	3300028558	Ga0265326_10002998	Ga0265326_100029986	210
22	3300028563	Ga0265319_1001901	Ga0265319_10019018	210
23	3300028577	Ga0265318_10000545	Ga0265318_1000054511	210
24	3300028654	Ga0265322_10081786	Ga0265322_100817862	210
25	3300028666	Ga0265336_10000001	Ga0265336_10000001296	210
26	3300028800	Ga0265338_10000004	Ga0265338_10000004585	210
27	3300031238	Ga0265332_10207300	Ga0265332_102073001	210
28	3300031241	Ga0265325_10109896	Ga0265325_101098962	210
29	3300031247	Ga0265340_10000002	Ga0265340_10000002585	210
30	3300031249	Ga0265339_10138895	Ga0265339_101388952	210
31	3300006038	Ga0075365_10001589	Ga0075365_100015892	211
32	3300006051	Ga0075364_10059932	Ga0075364_100599323	211
33	3300006175	Ga0070712_100067270	Ga0070712_1000672705	211
34	3300047321	Ga0495676_0109852	Ga0495676_0109852_1217_1957	211
35	3300049576	Ga0501040_0010625	Ga0501040_0010625_414_1151	211
36	3300049582	Ga0501048_0046630	Ga0501048_0046630_2302_3039	211
37	3300049588	Ga0501072_0038280	Ga0501072_0038280_2812_3549	211
38	3300049591	Ga0501075_0020119	Ga0501075_0020119_3271_4008	211
39	3300049592	Ga0501076_0147010	Ga0501076_0147010_200_937	211
40	3300049593	Ga0501077_0016549	Ga0501077_0016549_3645_4382	211
41	3300049741	Ga0501079_0019643	Ga0501079_0019643_2784_3521	211
42	3300049743	Ga0501081_0018355	Ga0501081_0018355_2565_3302	211
43	3300049824	Ga0501045_0010013	Ga0501045_0010013_3070_3807	211
44	3300054114	Ga0501084_0033542	Ga0501084_0033542_3528_4265	211
45	3300060353	Ga0501082_0280830	Ga0501082_0280830_509_1246	211
46	3300061734	Ga0530510_0076350	Ga0530510_0076350_58_795	211
47	3300061734	Ga0530510_0169453	Ga0530510_0169453_603_1340	211
48	3300005578	Ga0068854_100102260	Ga0068854_1001022603	212
49	3300009148	Ga0105243_10176524	Ga0105243_101765243	212
50	3300026078	Ga0207702_10039414	Ga0207702_100394145	212
51	3300046459	Ga0495629_0202789	Ga0495629_0202789_266_1006	212
52	3300049592	Ga0501076_0529315	Ga0501076_0529315_233_952	212
53	3300038443	Ga0395901_0006802	Ga0395901_0006802_1681_2430	213
54	3300045976	Ga0466967_0351525	Ga0466967_0351525_299_961	213
55	3300046518	Ga0495631_0187082	Ga0495631_0187082_79_822	213
56	3300046523	Ga0495644_0008448	Ga0495644_0008448_2875_3618	213
57	3300046615	Ga0495656_0008515	Ga0495656_0008515_2735_3478	213
58	3300046681	Ga0495647_0021635	Ga0495647_0021635_1077_1817	213
59	3300047469	Ga0495673_0012407	Ga0495673_0012407_3062_3805	213
60	3300050491	nmdc:mga00v17_24681_c1	nmdc:mga00v17_24681_c1_177_926	213
61	3300050492	nmdc:mga0yw44_3109_c1	nmdc:mga0yw44_3109_c1_5554_6303	213
62	3300037466	Ga0395898_0350362	Ga0395898_0350362_164_853	214
63	3300038443	Ga0395901_0519269	Ga0395901_0519269_189_878	214
64	3300005577	Ga0068857_100167556	Ga0068857_1001675564	215
65	3300026116	Ga0207674_10160023	Ga0207674_101600232	215
66	3300037418	Ga0395900_0002246	Ga0395900_0002246_11973_12641	215
67	3300037466	Ga0395898_0003455	Ga0395898_0003455_15079_15747	215
68	3300039437	Ga0436365_0824534	Ga0436365_0824534_623_1285	215
69	3300044683	Ga0466965_0193315	Ga0466965_0193315_250_921	215
70	3300044719	Ga0466971_0207401	Ga0466971_0207401_118_783	215
71	3300045049	Ga0466959_0001464	Ga0466959_0001464_8059_8721	215
72	3300045836	Ga0466958_0005363	Ga0466958_0005363_4044_4706	215
73	3300050508	nmdc:mga09592_151397_c1	nmdc:mga09592_151397_c1_775_1458	215
74	3300005981	Ga0081538_10001191	Ga0081538_1000119135	216
75	3300013307	Ga0157372_11330501	Ga0157372_113305012	216
76	3300027907	Ga0207428_10062582	Ga0207428_100625823	216
77	3300032002	Ga0307416_100700132	Ga0307416_1007001322	216
78	3300032004	Ga0307414_10557400	Ga0307414_105574002	216
79	3300032126	Ga0307415_100238210	Ga0307415_1002382102	216
80	3300039437	Ga0436365_1725409	Ga0436365_1725409_2520_3191	216
81	3300039450	Ga0436363_0850733	Ga0436363_0850733_38_700	216
82	3300045976	Ga0466967_0300195	Ga0466967_0300195_653_1333	216
83	3300046471	Ga0495650_0000053	Ga0495650_0000053_133878_134546	216
84	3300046683	Ga0495658_0202614	Ga0495658_0202614_192_884	216
85	3300048924	Ga0496121_0002770	Ga0496121_0002770_17445_18170	216
86	3300050507	nmdc:mga05p37_185386_c1	nmdc:mga05p37_185386_c1_1069_1737	216
87	3300050511	nmdc:mga08y16_114787_c1	nmdc:mga08y16_114787_c1_1343_2011	216
88	3300053153	Ga0500616_0006584	Ga0500616_0006584_3741_4421	216
89	3300005435	Ga0070714_100457058	Ga0070714_1004570582	217
90	3300005436	Ga0070713_100201107	Ga0070713_1002011072	217
91	3300005436	Ga0070713_100554440	Ga0070713_1005544401	217
92	3300005439	Ga0070711_100228215	Ga0070711_1002282151	217
93	3300005535	Ga0070684_100377979	Ga0070684_1003779792	217
94	3300005615	Ga0070702_100495967	Ga0070702_1004959672	217
95	3300006028	Ga0070717_10110889	Ga0070717_101108892	217
96	3300006042	Ga0075368_10056615	Ga0075368_100566152	217
97	3300006048	Ga0075363_100204917	Ga0075363_1002049172	217
98	3300006058	Ga0075432_10061981	Ga0075432_100619812	217
99	3300006163	Ga0070715_10057327	Ga0070715_100573273	217
100	3300006175	Ga0070712_100000013	Ga0070712_100000013109	217
101	3300006175	Ga0070712_100002893	Ga0070712_1000028938	217
102	3300025901	Ga0207688_10049244	Ga0207688_100492446	217
103	3300025915	Ga0207693_10007488	Ga0207693_100074887	217
104	3300025915	Ga0207693_10118510	Ga0207693_101185102	217
105	3300025928	Ga0207700_10624859	Ga0207700_106248591	217
106	3300025929	Ga0207664_10344561	Ga0207664_103445612	217
107	3300032004	Ga0307414_10718167	Ga0307414_107181672	217
108	3300035117	Ga0373953_0021152	Ga0373953_0021152_414_1079	217
109	3300035118	Ga0373954_0022104	Ga0373954_0022104_373_1038	217
110	3300035120	Ga0373957_0056611	Ga0373957_0056611_650_1315	217
111	3300035724	Ga0373933_0308816	Ga0373933_0308816_302_967	217
112	3300036401	Ga0373937_0024988	Ga0373937_0024988_4558_5223	217
113	3300039450	Ga0436363_0012859	Ga0436363_0012859_525_1193	217
114	3300044684	Ga0466966_0033106	Ga0466966_0033106_2000_2698	217
115	3300044735	Ga0466968_0300984	Ga0466968_0300984_86_751	217
116	3300044765	Ga0466970_0223929	Ga0466970_0223929_152_817	217
117	3300044842	Ga0466957_0091952	Ga0466957_0091952_1085_1750	217
118	3300045049	Ga0466959_0014631	Ga0466959_0014631_3617_4282	217
119	3300045836	Ga0466958_0001617	Ga0466958_0001617_3883_4548	217
120	3300045976	Ga0466967_0004740	Ga0466967_0004740_8525_9190	217
121	3300045976	Ga0466967_0335872	Ga0466967_0335872_596_1282	217
122	3300046454	Ga0495592_0145852	Ga0495592_0145852_661_1326	217
123	3300046461	Ga0495641_0034868	Ga0495641_0034868_800_1465	217
124	3300046462	Ga0495651_0010955	Ga0495651_0010955_3809_4474	217
125	3300046477	Ga0495664_0205994	Ga0495664_0205994_233_898	217
126	3300046514	Ga0495618_0027308	Ga0495618_0027308_2269_2934	217
127	3300046559	Ga0495667_0046512	Ga0495667_0046512_1278_1943	217
128	3300046663	Ga0495635_0011412	Ga0495635_0011412_2320_2985	217
129	3300046675	Ga0495657_0010844	Ga0495657_0010844_5281_5946	217
130	3300046809	Ga0495600_0135576	Ga0495600_0135576_639_1304	217
131	3300047317	Ga0495604_0223686	Ga0495604_0223686_87_752	217
132	3300047319	Ga0495674_0015458	Ga0495674_0015458_3900_4565	217
133	3300047322	Ga0495680_0003599	Ga0495680_0003599_8426_9091	217
134	3300047444	Ga0495675_0027217	Ga0495675_0027217_2490_3155	217
135	3300047471	Ga0495684_0011380	Ga0495684_0011380_4359_5024	217
136	3300048903	Ga0496100_0358450	Ga0496100_0358450_421_1086	217
137	3300048907	Ga0496104_0066408	Ga0496104_0066408_124_789	217
138	3300048908	Ga0496105_0473789	Ga0496105_0473789_103_768	217
139	3300048915	Ga0496112_0036205	Ga0496112_0036205_201_866	217
140	3300048916	Ga0496113_0113703	Ga0496113_0113703_1343_2008	217
141	3300048917	Ga0496114_0217393	Ga0496114_0217393_933_1598	217
142	3300048918	Ga0496115_0478963	Ga0496115_0478963_85_750	217
143	3300053077	Ga0495601_0035823	Ga0495601_0035823_1646_2311	217
144	3300053078	Ga0495612_0247195	Ga0495612_0247195_85_750	217
145	3300053085	Ga0495619_0018953	Ga0495619_0018953_2945_3610	217
146	3300001990	JGI24737J22298_10064496	JGI24737J22298_100644961	218
147	3300005329	Ga0070683_100133311	Ga0070683_1001333113	218
148	3300005337	Ga0070682_100150420	Ga0070682_1001504201	218
149	3300005338	Ga0068868_100299714	Ga0068868_1002997142	218
150	3300005338	Ga0068868_100754553	Ga0068868_1007545531	218
151	3300005339	Ga0070660_100001669	Ga0070660_1000016697	218
152	3300005341	Ga0070691_10054227	Ga0070691_100542273	218
153	3300005345	Ga0070692_10056974	Ga0070692_100569742	218
154	3300005345	Ga0070692_10197634	Ga0070692_101976342	218
155	3300005347	Ga0070668_100030302	Ga0070668_1000303024	218
156	3300005354	Ga0070675_100029576	Ga0070675_1000295765	218
157	3300005356	Ga0070674_100019860	Ga0070674_1000198606	218
158	3300005356	Ga0070674_100712864	Ga0070674_1007128641	218
159	3300005366	Ga0070659_100014074	Ga0070659_1000140746	218
160	3300005441	Ga0070700_100008502	Ga0070700_1000085026	218
161	3300005441	Ga0070700_100077913	Ga0070700_1000779131	218
162	3300005455	Ga0070663_100002800	Ga0070663_1000028007	218
163	3300005457	Ga0070662_100059992	Ga0070662_1000599922	218
164	3300005457	Ga0070662_100131853	Ga0070662_1001318533	218
165	3300005458	Ga0070681_10493321	Ga0070681_104933212	218
166	3300005535	Ga0070684_100152709	Ga0070684_1001527092	218
167	3300005539	Ga0068853_100028808	Ga0068853_1000288086	218
168	3300005547	Ga0070693_100237123	Ga0070693_1002371232	218
169	3300005548	Ga0070665_100197463	Ga0070665_1001974631	218
170	3300005615	Ga0070702_100097458	Ga0070702_1000974582	218
171	3300005616	Ga0068852_100161162	Ga0068852_1001611622	218
172	3300005617	Ga0068859_100133108	Ga0068859_1001331083	218
173	3300005617	Ga0068859_100278622	Ga0068859_1002786222	218
174	3300006038	Ga0075365_10019279	Ga0075365_100192795	218
175	3300006048	Ga0075363_100008514	Ga0075363_1000085145	218
176	3300006051	Ga0075364_10294487	Ga0075364_102944871	218
177	3300006881	Ga0068865_100001280	Ga0068865_1000012808	218
178	3300006881	Ga0068865_100619216	Ga0068865_1006192161	218
179	3300006931	Ga0097620_100133112	Ga0097620_1001331123	218
180	3300006931	Ga0097620_100278624	Ga0097620_1002786242	218
181	3300009098	Ga0105245_10350196	Ga0105245_103501962	218
182	3300009148	Ga0105243_10023540	Ga0105243_100235402	218
183	3300009148	Ga0105243_10214267	Ga0105243_102142673	218
184	3300009176	Ga0105242_10129852	Ga0105242_101298524	218
185	3300010375	Ga0105239_10040445	Ga0105239_100404454	218
186	3300013308	Ga0157375_10056009	Ga0157375_100560092	218
187	3300014326	Ga0157380_10049473	Ga0157380_100494733	218
188	3300014326	Ga0157380_10538390	Ga0157380_105383902	218
189	3300017792	Ga0163161_10332112	Ga0163161_103321121	218
190	3300021388	Ga0213875_10014084	Ga0213875_100140843	218
191	3300021388	Ga0213875_10064693	Ga0213875_100646932	218
192	3300025302	Ga0207426_1042188	Ga0207426_10421883	218
193	3300025899	Ga0207642_10043753	Ga0207642_100437534	218
194	3300025901	Ga0207688_10030391	Ga0207688_100303913	218
195	3300025901	Ga0207688_10060014	Ga0207688_100600143	218
196	3300025908	Ga0207643_10019273	Ga0207643_100192735	218
197	3300025908	Ga0207643_10253678	Ga0207643_102536782	218
198	3300025909	Ga0207705_10030926	Ga0207705_100309266	218
199	3300025919	Ga0207657_10004224	Ga0207657_100042247	218
200	3300025919	Ga0207657_10480262	Ga0207657_104802622	218
201	3300025926	Ga0207659_10370722	Ga0207659_103707222	218
202	3300025927	Ga0207687_10242623	Ga0207687_102426232	218
203	3300025932	Ga0207690_10020757	Ga0207690_100207572	218
204	3300025932	Ga0207690_10149095	Ga0207690_101490952	218
205	3300025932	Ga0207690_10239941	Ga0207690_102399412	218
206	3300025933	Ga0207706_10061353	Ga0207706_100613534	218
207	3300025933	Ga0207706_10123874	Ga0207706_101238743	218
208	3300025935	Ga0207709_10045449	Ga0207709_100454494	218
209	3300025935	Ga0207709_10051587	Ga0207709_100515872	218
210	3300025935	Ga0207709_10096377	Ga0207709_100963771	218
211	3300025937	Ga0207669_10080944	Ga0207669_100809443	218
212	3300025937	Ga0207669_10183989	Ga0207669_101839892	218
213	3300025938	Ga0207704_10011097	Ga0207704_100110972	218
214	3300025940	Ga0207691_10215905	Ga0207691_102159052	218
215	3300025944	Ga0207661_10088111	Ga0207661_100881112	218
216	3300025945	Ga0207679_10203615	Ga0207679_102036153	218
217	3300025961	Ga0207712_10165774	Ga0207712_101657741	218
218	3300026023	Ga0207677_10291858	Ga0207677_102918582	218
219	3300026041	Ga0207639_10105773	Ga0207639_101057732	218
220	3300026041	Ga0207639_10384486	Ga0207639_103844862	218
221	3300026067	Ga0207678_10002606	Ga0207678_100026067	218
222	3300026075	Ga0207708_10001007	Ga0207708_1000100721	218
223	3300026095	Ga0207676_10094746	Ga0207676_100947464	218
224	3300026142	Ga0207698_10104880	Ga0207698_101048803	218
225	3300026142	Ga0207698_10696872	Ga0207698_106968722	218
226	3300028379	Ga0268266_10267802	Ga0268266_102678023	218
227	3300028380	Ga0268265_10669667	Ga0268265_106696672	218
228	3300031727	Ga0316576_10122001	Ga0316576_101220012	218
229	3300031731	Ga0307405_10096618	Ga0307405_100966184	218
230	3300031824	Ga0307413_10076970	Ga0307413_100769702	218
231	3300031852	Ga0307410_10040733	Ga0307410_100407335	218
232	3300031901	Ga0307406_10432386	Ga0307406_104323862	218
233	3300031903	Ga0307407_10021524	Ga0307407_100215243	218
234	3300031911	Ga0307412_10152724	Ga0307412_101527243	218
235	3300031995	Ga0307409_100048138	Ga0307409_1000481383	218
236	3300032004	Ga0307414_10070620	Ga0307414_100706205	218
237	3300032005	Ga0307411_10058554	Ga0307411_100585543	218
238	3300032126	Ga0307415_100514167	Ga0307415_1005141672	218
239	3300036712	Ga0316584_0110090	Ga0316584_0110090_493_1350	218
240	3300037853	Ga0436364_1438537	Ga0436364_1438537_929_1612	218
241	3300039437	Ga0436365_1102108	Ga0436365_1102108_17470_18195	218
242	3300039453	Ga0436362_0239758	Ga0436362_0239758_899_1624	218
243	3300044683	Ga0466965_0056854	Ga0466965_0056854_276_968	218
244	3300044694	Ga0466963_0006643	Ga0466963_0006643_4562_5254	218
245	3300044694	Ga0466963_0237275	Ga0466963_0237275_381_1046	218
246	3300044719	Ga0466971_0030125	Ga0466971_0030125_68_760	218
247	3300044719	Ga0466971_0164061	Ga0466971_0164061_278_952	218
248	3300044765	Ga0466970_0424286	Ga0466970_0424286_21_713	218
249	3300044842	Ga0466957_0156531	Ga0466957_0156531_416_1081	218
250	3300045049	Ga0466959_0000694	Ga0466959_0000694_18051_18743	218
251	3300045836	Ga0466958_0091739	Ga0466958_0091739_398_1072	218
252	3300048910	Ga0496107_0038123	Ga0496107_0038123_127_984	218
253	3300048911	Ga0496108_0013342	Ga0496108_0013342_3377_4234	218
254	3300048911	Ga0496108_0695403	Ga0496108_0695403_167_841	218
255	3300048912	Ga0496109_0035002	Ga0496109_0035002_326_1183	218
256	3300048914	Ga0496111_0024384	Ga0496111_0024384_1850_2707	218
257	3300048915	Ga0496112_0000095	Ga0496112_0000095_17167_17841	218
258	3300048915	Ga0496112_0145218	Ga0496112_0145218_706_1563	218
259	3300048915	Ga0496112_0520338	Ga0496112_0520338_79_774	218
260	3300048922	Ga0496119_0200835	Ga0496119_0200835_296_982	218
261	3300048929	Ga0496126_0207358	Ga0496126_0207358_756_1442	218
262	3300049571	Ga0501034_0385490	Ga0501034_0385490_14_709	218
263	3300049742	Ga0501080_0081359	Ga0501080_0081359_918_1607	218
264	3300050491	nmdc:mga00v17_80638_c1	nmdc:mga00v17_80638_c1_1087_1944	218
265	3300050511	nmdc:mga08y16_226079_c1	nmdc:mga08y16_226079_c1_660_1334	218
266	3300053083	Ga0495655_0066949	Ga0495655_0066949_291_965	218
267	3300061719	Ga0466962_0016871	Ga0466962_0016871_1235_1927	218
268	3300005356	Ga0070674_100122245	Ga0070674_1001222453	219
269	3300005434	Ga0070709_10175567	Ga0070709_101755672	219
270	3300005435	Ga0070714_100019766	Ga0070714_1000197661	219
271	3300005457	Ga0070662_100119426	Ga0070662_1001194262	219
272	3300005535	Ga0070684_100738316	Ga0070684_1007383161	219
273	3300005564	Ga0070664_100183995	Ga0070664_1001839953	219
274	3300005985	Ga0081539_10001489	Ga0081539_1000148920	219
275	3300005985	Ga0081539_10005444	Ga0081539_1000544412	219
276	3300006028	Ga0070717_10028271	Ga0070717_100282714	219
277	3300009093	Ga0105240_10018075	Ga0105240_1001807512	219
278	3300009101	Ga0105247_10229146	Ga0105247_102291462	219
279	3300010375	Ga0105239_10403099	Ga0105239_104030992	219
280	3300020069	Ga0197907_10991395	Ga0197907_109913952	219
281	3300025900	Ga0207710_10200003	Ga0207710_102000032	219
282	3300025913	Ga0207695_10017468	Ga0207695_100174683	219
283	3300025919	Ga0207657_10129189	Ga0207657_101291894	219
284	3300025929	Ga0207664_10002161	Ga0207664_1000216111	219
285	3300025945	Ga0207679_10063332	Ga0207679_100633322	219
286	3300026067	Ga0207678_10286642	Ga0207678_102866422	219
287	3300026075	Ga0207708_10441679	Ga0207708_104416792	219
288	3300032002	Ga0307416_100169926	Ga0307416_1001699264	219
289	3300037466	Ga0395898_0328615	Ga0395898_0328615_333_1019	219
290	3300038443	Ga0395901_0180843	Ga0395901_0180843_1012_1698	219
291	3300039450	Ga0436363_0669888	Ga0436363_0669888_254_940	219
292	3300042005	Ga0439448_0013856	Ga0439448_0013856_933_1619	219
293	3300042012	Ga0439455_0014762	Ga0439455_0014762_548_1234	219
294	3300042016	Ga0439463_037411	Ga0439463_037411_117_803	219
295	3300044658	Ga0466972_0290006	Ga0466972_0290006_54_737	219
296	3300044694	Ga0466963_0056025	Ga0466963_0056025_884_1570	219
297	3300044694	Ga0466963_0319092	Ga0466963_0319092_205_888	219
298	3300044842	Ga0466957_0045760	Ga0466957_0045760_1144_1830	219
299	3300044842	Ga0466957_0222145	Ga0466957_0222145_38_787	219
300	3300045049	Ga0466959_0046460	Ga0466959_0046460_1770_2519	219
301	3300045976	Ga0466967_0001002	Ga0466967_0001002_11962_12648	219
302	3300045976	Ga0466967_0006851	Ga0466967_0006851_6352_7035	219
303	3300045976	Ga0466967_0747992	Ga0466967_0747992_39_725	219
304	3300046477	Ga0495664_0342590	Ga0495664_0342590_146_832	219
305	3300046500	Ga0495596_0076942	Ga0495596_0076942_365_1042	219
306	3300046529	Ga0495652_0106110	Ga0495652_0106110_122_814	219
307	3300047319	Ga0495674_0532214	Ga0495674_0532214_214_900	219
308	3300047320	Ga0495672_0052078	Ga0495672_0052078_953_1642	219
309	3300048904	Ga0496101_0001032	Ga0496101_0001032_15456_16145	219
310	3300048911	Ga0496108_0124361	Ga0496108_0124361_1204_1893	219
311	3300048912	Ga0496109_0336368	Ga0496109_0336368_508_1200	219
312	3300049823	Ga0501044_0467623	Ga0501044_0467623_271_960	219
313	3300003911	JGI25405J52794_10036623	JGI25405J52794_100366232	220
314	3300005329	Ga0070683_101153511	Ga0070683_1011535111	220
315	3300005937	Ga0081455_10007545	Ga0081455_100075456	220
316	3300005985	Ga0081539_10001045	Ga0081539_1000104511	220
317	3300006038	Ga0075365_10006537	Ga0075365_100065376	220
318	3300006881	Ga0068865_100114880	Ga0068865_1001148804	220
319	3300009148	Ga0105243_10275440	Ga0105243_102754403	220
320	3300009148	Ga0105243_10303868	Ga0105243_103038682	220
321	3300013297	Ga0157378_10186833	Ga0157378_101868332	220
322	3300013308	Ga0157375_10157295	Ga0157375_101572955	220
323	3300025932	Ga0207690_10489880	Ga0207690_104898802	220
324	3300025933	Ga0207706_10868030	Ga0207706_108680301	220
325	3300025981	Ga0207640_10179634	Ga0207640_101796342	220
326	3300026075	Ga0207708_10160813	Ga0207708_101608132	220
327	3300026121	Ga0207683_10305054	Ga0207683_103050542	220
328	3300031852	Ga0307410_10024313	Ga0307410_100243133	220
329	3300031852	Ga0307410_10407211	Ga0307410_104072112	220
330	3300031901	Ga0307406_10093082	Ga0307406_100930824	220
331	3300031903	Ga0307407_10348128	Ga0307407_103481282	220
332	3300031911	Ga0307412_10249379	Ga0307412_102493793	220
333	3300031995	Ga0307409_100131999	Ga0307409_1001319993	220
334	3300031995	Ga0307409_100572469	Ga0307409_1005724692	220
335	3300031995	Ga0307409_100868897	Ga0307409_1008688972	220
336	3300032002	Ga0307416_100006134	Ga0307416_1000061346	220
337	3300032002	Ga0307416_100690692	Ga0307416_1006906922	220
338	3300032002	Ga0307416_100957700	Ga0307416_1009577001	220
339	3300032004	Ga0307414_10209494	Ga0307414_102094942	220
340	3300032126	Ga0307415_100092951	Ga0307415_1000929512	220
341	3300037466	Ga0395898_0105497	Ga0395898_0105497_1654_2334	220
342	3300044694	Ga0466963_0019103	Ga0466963_0019103_1987_2673	220
343	3300045976	Ga0466967_0027823	Ga0466967_0027823_2541_3230	220
344	3300048903	Ga0496100_0001662	Ga0496100_0001662_5459_6121	220
345	3300048904	Ga0496101_0001988	Ga0496101_0001988_3502_4164	220
346	3300048905	Ga0496102_0012915	Ga0496102_0012915_2078_2899	220
347	3300048910	Ga0496107_0002155	Ga0496107_0002155_8173_8835	220
348	3300048918	Ga0496115_0005651	Ga0496115_0005651_3686_4348	220
349	3300049572	Ga0501036_0235928	Ga0501036_0235928_599_1282	220
350	3300049575	Ga0501039_0113175	Ga0501039_0113175_808_1491	220
351	3300049575	Ga0501039_0548008	Ga0501039_0548008_131_820	220
352	3300049576	Ga0501040_0091759	Ga0501040_0091759_1072_1761	220
353	3300049577	Ga0501041_0211450	Ga0501041_0211450_287_976	220
354	3300049578	Ga0501042_0141260	Ga0501042_0141260_577_1266	220
355	3300049580	Ga0501046_0449740	Ga0501046_0449740_188_877	220
356	3300049582	Ga0501048_0063398	Ga0501048_0063398_1577_2260	220
357	3300049582	Ga0501048_0111621	Ga0501048_0111621_921_1610	220
358	3300049586	Ga0501070_0185229	Ga0501070_0185229_684_1601	220
359	3300049586	Ga0501070_0694103	Ga0501070_0694103_23_712	220
360	3300049586	Ga0501070_0729182	Ga0501070_0729182_45_728	220
361	3300049587	Ga0501071_0087176	Ga0501071_0087176_1560_2243	220
362	3300049587	Ga0501071_0121839	Ga0501071_0121839_962_1651	220
363	3300049587	Ga0501071_0144586	Ga0501071_0144586_207_1124	220
364	3300049587	Ga0501071_0264094	Ga0501071_0264094_67_756	220
365	3300049588	Ga0501072_0016803	Ga0501072_0016803_2331_3248	220
366	3300049590	Ga0501074_0068386	Ga0501074_0068386_1285_2202	220
367	3300049591	Ga0501075_0115517	Ga0501075_0115517_901_1584	220
368	3300049592	Ga0501076_0030426	Ga0501076_0030426_715_1398	220
369	3300049742	Ga0501080_0203012	Ga0501080_0203012_131_1048	220
370	3300049743	Ga0501081_0226238	Ga0501081_0226238_589_1278	220
371	3300049743	Ga0501081_0482873	Ga0501081_0482873_112_795	220
372	3300049744	Ga0501083_0025105	Ga0501083_0025105_2921_3838	220
373	3300049822	Ga0501035_0101777	Ga0501035_0101777_191_880	220
374	3300049822	Ga0501035_0151660	Ga0501035_0151660_97_780	220
375	3300049822	Ga0501035_0332672	Ga0501035_0332672_470_1159	220
376	3300049824	Ga0501045_0244219	Ga0501045_0244219_346_1029	220
377	3300050491	nmdc:mga00v17_78772_c1	nmdc:mga00v17_78772_c1_1138_2025	220
378	3300050512	nmdc:mga0n895_458595_c1	nmdc:mga0n895_458595_c1_221_910	220
379	3300054114	Ga0501084_0014085	Ga0501084_0014085_4996_5685	220
380	3300054114	Ga0501084_0261983	Ga0501084_0261983_462_1151	220
381	3300059424	Ga0590075_051026	Ga0590075_051026_238_927	220
382	3300060353	Ga0501082_0176203	Ga0501082_0176203_160_849	220
383	3300061734	Ga0530510_0100672	Ga0530510_0100672_1000_1683	220
384	3300001990	JGI24737J22298_10017875	JGI24737J22298_100178753	221
385	3300005328	Ga0070676_10232008	Ga0070676_102320082	221
386	3300005329	Ga0070683_100088996	Ga0070683_1000889964	221
387	3300005330	Ga0070690_100212496	Ga0070690_1002124962	221
388	3300005331	Ga0070670_100390031	Ga0070670_1003900312	221
389	3300005337	Ga0070682_100051419	Ga0070682_1000514194	221
390	3300005338	Ga0068868_100979508	Ga0068868_1009795081	221
391	3300005339	Ga0070660_100186754	Ga0070660_1001867541	221
392	3300005339	Ga0070660_100880788	Ga0070660_1008807881	221
393	3300005340	Ga0070689_100100164	Ga0070689_1001001644	221
394	3300005345	Ga0070692_10362612	Ga0070692_103626121	221
395	3300005355	Ga0070671_100278381	Ga0070671_1002783813	221
396	3300005365	Ga0070688_100221808	Ga0070688_1002218082	221
397	3300005366	Ga0070659_100031084	Ga0070659_1000310843	221
398	3300005441	Ga0070700_100030467	Ga0070700_1000304673	221
399	3300005456	Ga0070678_100199985	Ga0070678_1001999852	221
400	3300005459	Ga0068867_100090687	Ga0068867_1000906873	221
401	3300005466	Ga0070685_10124147	Ga0070685_101241471	221
402	3300005535	Ga0070684_100032378	Ga0070684_1000323786	221
403	3300005544	Ga0070686_100632579	Ga0070686_1006325791	221
404	3300005564	Ga0070664_100282983	Ga0070664_1002829832	221
405	3300005577	Ga0068857_100338952	Ga0068857_1003389522	221
406	3300005578	Ga0068854_100070754	Ga0068854_1000707543	221
407	3300005614	Ga0068856_101015888	Ga0068856_1010158881	221
408	3300005615	Ga0070702_100021251	Ga0070702_1000212512	221
409	3300005616	Ga0068852_100553932	Ga0068852_1005539322	221
410	3300005618	Ga0068864_100097205	Ga0068864_1000972052	221
411	3300005618	Ga0068864_100546086	Ga0068864_1005460862	221
412	3300005719	Ga0068861_100496396	Ga0068861_1004963962	221
413	3300005840	Ga0068870_10021017	Ga0068870_100210173	221
414	3300005841	Ga0068863_100461385	Ga0068863_1004613852	221
415	3300005842	Ga0068858_100163827	Ga0068858_1001638273	221
416	3300005843	Ga0068860_100104399	Ga0068860_1001043993	221
417	3300005983	Ga0081540_1000568	Ga0081540_100056816	221
418	3300006237	Ga0097621_100770796	Ga0097621_1007707962	221
419	3300006358	Ga0068871_100375678	Ga0068871_1003756782	221
420	3300006871	Ga0075434_100158025	Ga0075434_1001580253	221
421	3300006881	Ga0068865_100922714	Ga0068865_1009227141	221
422	3300007076	Ga0075435_100495085	Ga0075435_1004950852	221
423	3300009094	Ga0111539_10063618	Ga0111539_100636184	221
424	3300009098	Ga0105245_10894708	Ga0105245_108947082	221
425	3300009148	Ga0105243_10778866	Ga0105243_107788662	221
426	3300009174	Ga0105241_10127111	Ga0105241_101271113	221
427	3300009176	Ga0105242_10098001	Ga0105242_100980013	221
428	3300009177	Ga0105248_10244961	Ga0105248_102449613	221
429	3300009551	Ga0105238_10678829	Ga0105238_106788292	221
430	3300010375	Ga0105239_11028559	Ga0105239_110285592	221
431	3300011119	Ga0105246_10167617	Ga0105246_101676172	221
432	3300013102	Ga0157371_10313935	Ga0157371_103139352	221
433	3300013297	Ga0157378_11388859	Ga0157378_113888591	221
434	3300013306	Ga0163162_10574445	Ga0163162_105744452	221
435	3300013307	Ga0157372_10391961	Ga0157372_103919613	221
436	3300014325	Ga0163163_10046316	Ga0163163_100463167	221
437	3300014326	Ga0157380_10540175	Ga0157380_105401751	221
438	3300014968	Ga0157379_10160198	Ga0157379_101601982	221
439	3300017792	Ga0163161_10133540	Ga0163161_101335404	221
440	3300025321	Ga0207656_10105523	Ga0207656_101055232	221
441	3300025900	Ga0207710_10241315	Ga0207710_102413152	221
442	3300025904	Ga0207647_10057343	Ga0207647_100573433	221
443	3300025907	Ga0207645_10187261	Ga0207645_101872612	221
444	3300025908	Ga0207643_10025586	Ga0207643_100255863	221
445	3300025914	Ga0207671_10100708	Ga0207671_101007081	221
446	3300025921	Ga0207652_10437287	Ga0207652_104372872	221
447	3300025925	Ga0207650_10506026	Ga0207650_105060262	221
448	3300025927	Ga0207687_10067011	Ga0207687_100670113	221
449	3300025934	Ga0207686_10054690	Ga0207686_100546903	221
450	3300025941	Ga0207711_10139695	Ga0207711_101396954	221
451	3300025961	Ga0207712_10298660	Ga0207712_102986602	221
452	3300026041	Ga0207639_10040252	Ga0207639_100402523	221
453	3300026075	Ga0207708_10082234	Ga0207708_100822342	221
454	3300026078	Ga0207702_10184969	Ga0207702_101849693	221
455	3300026089	Ga0207648_10073188	Ga0207648_100731884	221
456	3300026116	Ga0207674_10020606	Ga0207674_100206062	221
457	3300026118	Ga0207675_100044705	Ga0207675_1000447052	221
458	3300026118	Ga0207675_100423957	Ga0207675_1004239572	221
459	3300026118	Ga0207675_100492231	Ga0207675_1004922312	221
460	3300026121	Ga0207683_10140656	Ga0207683_101406562	221
461	3300026142	Ga0207698_10194016	Ga0207698_101940163	221
462	3300026142	Ga0207698_10681668	Ga0207698_106816682	221
463	3300028379	Ga0268266_10545380	Ga0268266_105453802	221
464	3300028380	Ga0268265_10463683	Ga0268265_104636832	221
465	3300031995	Ga0307409_100590347	Ga0307409_1005903472	221
466	3300035090	Ga0373949_0078127	Ga0373949_0078127_179_844	221
467	3300035171	Ga0373946_0277031	Ga0373946_0277031_139_807	221
468	3300037068	Ga0373925_0348231	Ga0373925_0348231_507_1175	221
469	3300041451	Ga0451791_0327589	Ga0451791_0327589_1709_2407	221
470	3300044694	Ga0466963_0323368	Ga0466963_0323368_298_990	221
471	3300044694	Ga0466963_0421331	Ga0466963_0421331_165_857	221
472	3300044842	Ga0466957_0023685	Ga0466957_0023685_825_1517	221
473	3300044842	Ga0466957_0049437	Ga0466957_0049437_772_1464	221
474	3300044901	Ga0466960_0000181	Ga0466960_0000181_19882_20568	221
475	3300044901	Ga0466960_0007477	Ga0466960_0007477_3012_3677	221
476	3300045836	Ga0466958_0162550	Ga0466958_0162550_643_1335	221
477	3300045976	Ga0466967_0040152	Ga0466967_0040152_371_1063	221
478	3300045976	Ga0466967_0064248	Ga0466967_0064248_710_1402	221
479	3300045976	Ga0466967_0099987	Ga0466967_0099987_1769_2461	221
480	3300045976	Ga0466967_0353698	Ga0466967_0353698_317_1009	221
481	3300046461	Ga0495641_0042503	Ga0495641_0042503_685_1353	221
482	3300046473	Ga0495582_0099192	Ga0495582_0099192_352_1020	221
483	3300046519	Ga0495632_0179314	Ga0495632_0179314_212_880	221
484	3300046794	Ga0495589_0187057	Ga0495589_0187057_231_899	221
485	3300048903	Ga0496100_0679951	Ga0496100_0679951_47_712	221
486	3300048904	Ga0496101_0111063	Ga0496101_0111063_54_719	221
487	3300048905	Ga0496102_0450930	Ga0496102_0450930_41_709	221
488	3300048907	Ga0496104_0013656	Ga0496104_0013656_5622_6290	221
489	3300048907	Ga0496104_0058522	Ga0496104_0058522_2238_2906	221
490	3300048908	Ga0496105_0217134	Ga0496105_0217134_776_1444	221
491	3300048909	Ga0496106_0015340	Ga0496106_0015340_1698_2366	221
492	3300048909	Ga0496106_0213273	Ga0496106_0213273_247_912	221
493	3300048910	Ga0496107_0250323	Ga0496107_0250323_249_917	221
494	3300048911	Ga0496108_0002529	Ga0496108_0002529_4880_5548	221
495	3300048911	Ga0496108_0085236	Ga0496108_0085236_1009_1677	221
496	3300048912	Ga0496109_0007698	Ga0496109_0007698_63_731	221
497	3300048912	Ga0496109_0215502	Ga0496109_0215502_918_1583	221
498	3300048913	Ga0496110_0001092	Ga0496110_0001092_893_1561	221
499	3300048913	Ga0496110_0555201	Ga0496110_0555201_153_821	221
500	3300048914	Ga0496111_0042675	Ga0496111_0042675_1579_2247	221
501	3300048914	Ga0496111_0135410	Ga0496111_0135410_745_1410	221
502	3300048915	Ga0496112_0042428	Ga0496112_0042428_1264_1932	221
503	3300048915	Ga0496112_0097313	Ga0496112_0097313_1028_1723	221
504	3300048915	Ga0496112_0533058	Ga0496112_0533058_376_1044	221
505	3300048916	Ga0496113_0003866	Ga0496113_0003866_7265_7933	221
506	3300048916	Ga0496113_0742114	Ga0496113_0742114_70_762	221
507	3300048917	Ga0496114_0174589	Ga0496114_0174589_904_1569	221
508	3300049571	Ga0501034_0008091	Ga0501034_0008091_8781_9467	221
509	3300050515	nmdc:mga0a205_50302_c1	nmdc:mga0a205_50302_c1_923_1588	221
510	3300053083	Ga0495655_0096628	Ga0495655_0096628_49_714	221
511	3300059505	Ga0587083_0059437	Ga0587083_0059437_182_847	221
512	3300059510	Ga0587090_019800	Ga0587090_019800_109_774	221
513	3300060346	Ga0587111_0020888	Ga0587111_0020888_40_705	221
514	3300061719	Ga0466962_0015902	Ga0466962_0015902_1342_2034	221
515	3300061719	Ga0466962_0223274	Ga0466962_0223274_206_898	221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

65

174

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7p7j-assembly1.cif.gz_B	complex i from e. coli, ddm/lmng-purified, with dq, open state	0.8845	40	181
6ziy-assembly1.cif.gz_6	respiratory complex i from thermus thermophilus, nadh dataset, major state	0.8831	44	180
6i0d-assembly2.cif.gz_G	respiratory complex i from thermus thermophilus with bound decyl-ubiquinone	0.8816	44	180
7z80-assembly1.cif.gz_B	complex i from e. coli, ddm/lmng-purified, under turnover at ph 8, closed state	0.8794	44	181
5gpn-assembly1.cif.gz_a	architecture of mammalian respirasome	0.8697	40	182

ID	Description	Score	Start	End	Superfamily
3iasF00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;	0.8622	41	180	3.40.50.12280
af_P0AFC7_20_188_3.40.50.12280	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;	0.8346	28	182	3.40.50.12280
6cfwJ00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;	0.8338	55	181	3.40.50.12280
af_I6XUD2_20_159_3.40.50.12280	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;	0.8061	56	178	3.40.50.12280
af_P9WJH1_2_170_3.40.50.12280	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;	0.8024	24	190	3.40.50.12280

ID	Description	Score	Start	End	GO Terms
AF-A0A7C5BKH7-F1-model_v4	NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B)	0.9036	35	181	GO:0005506 GO:0005886 GO:0008137 GO:0009060 GO:0015990 GO:0045271 GO:0048038 GO:0050136 GO:0051539
AF-A0A7C3E9X9-F1-model_v4	NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B)	0.9009	38	181	GO:0005506 GO:0005886 GO:0008137 GO:0009060 GO:0015990 GO:0045271 GO:0048038 GO:0050136 GO:0051539
AF-A0A2G6MGY7-F1-model_v4	deleted	0.8989	45	181
AF-A0A257V0H8-F1-model_v4	NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B)	0.8984	38	181	GO:0005506 GO:0005886 GO:0008137 GO:0009060 GO:0015990 GO:0045271 GO:0048038 GO:0050136 GO:0051539
AF-A0A1F9III3-F1-model_v4	NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B)	0.8977	37	182	GO:0005506 GO:0005886 GO:0008137 GO:0009060 GO:0015990 GO:0045271 GO:0048038 GO:0050136 GO:0051539

Feature Viewer

pLDDT	pTM	Quality
66.49	0.56	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F457906

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

65

174

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map