F457886

General Info

Members Datasets Scaffolds Average Seq Length
515 310 1030 272

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0284056|Ga0373931_0284056_15_1004
Length 311
Sequence MQEGRGRERGVAEFRLHSVNGRSFAGPPSKRNASMIRGTTLLIAHLGYPTDAFKAPMIYNPWFEQSGVDAVVVPMAVRAEHYAAFLRPLFRLENVHGALVTMPHKVTTAALLDEVTPTVEVAGACNAIVKRPDGSLAGDMFDGEGFVRGVLRKGRGLAGARALVVGAGGVGSAIAASLAGAHVGTLGVFDTRADAAEQLARRLREHYRQIDVRTGSNDPAGYDVVVNATPLGMNAGDPLPFDAESLTPGTLVGEVVMKEEYTPLLRAAAARGCPVQVGTDMLYEMIPAYLEFFGFPTTTPDVLRAVSRIRY

Samples

Sample ID Description Type Environment
1 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
209 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
225 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
228 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
262 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
288 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
289 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
300 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
301 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
302 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
303 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
304 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
305 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
306 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
307 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
308 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
309 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
310 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.12
Metatranscriptomes 1.55
Isolates 2.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.6
Nodule 0.39
Rhizoplane 5.05
Rhizosphere 81.94
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373931_0284056 3300035691 Bacteria 1017
2 JGI24740J21852_10000047 3300001979 Bacteria 39298
3 JGI24034J26672_10011665 3300002239 Bacteria 1319
4 JGI25156J39149_1008751 3300002705 Bacteria 2522
5 JGI25160J50197_1000037 3300003354 Bacteria 162757
6 Ga0055539_1000203 3300003752 Bacteria 46893
7 Ga0055532_1000037 3300003758 Bacteria 205054
8 Ga0055525_1000888 3300003759 Bacteria 8589
9 Ga0055527_1000666 3300003760 Bacteria 10298
10 Ga0055535_1000018 3300003761 Bacteria 243804
11 Ga0055529_1000041 3300003763 Bacteria 226495
12 Ga0055541_1004129 3300003841 Bacteria 2667
13 Ga0065165_1000629 3300005262 Bacteria 51217
14 Ga0065715_10103195 3300005293 Bacteria 3051
15 Ga0065715_10165457 3300005293 Bacteria 1590
16 Ga0065715_10224696 3300005293 Bacteria 1257
17 Ga0070658_10250944 3300005327 Bacteria 1501
18 Ga0070690_100046163 3300005330 Bacteria 2769
19 Ga0070670_100057172 3300005331 Bacteria 3349
20 Ga0070670_100196677 3300005331 Bacteria 1751
21 Ga0070677_10001471 3300005333 Bacteria 7449
22 Ga0068869_100004312 3300005334 Bacteria 8830
23 Ga0068869_100047735 3300005334 Bacteria 3093
24 Ga0068869_100332677 3300005334 Bacteria 1234
25 Ga0070666_10004700 3300005335 Bacteria 8344
26 Ga0070666_10056206 3300005335 Bacteria 2657
27 Ga0068868_100000928 3300005338 Bacteria 19961
28 Ga0070660_100002643 3300005339 Bacteria 12320
29 Ga0070689_100017265 3300005340 Bacteria 5296
30 Ga0070687_100167337 3300005343 Bacteria 1305
31 Ga0070661_100000131 3300005344 Bacteria 62870
32 Ga0070661_100012776 3300005344 Bacteria 5880
33 Ga0070661_100083164 3300005344 Bacteria 2364
34 Ga0070661_100192495 3300005344 Bacteria 1556
35 Ga0070669_100004160 3300005353 Bacteria 10482
36 Ga0070669_100007709 3300005353 Bacteria 7695
37 Ga0070675_100000772 3300005354 Bacteria 22339
38 Ga0070675_100003039 3300005354 Bacteria 12673
39 Ga0070675_100060672 3300005354 Bacteria 3122
40 Ga0070675_100219212 3300005354 Bacteria 1656
41 Ga0070675_100530036 3300005354 Unclassified 1063
42 Ga0070671_100003449 3300005355 Bacteria 12337
43 Ga0070671_100008648 3300005355 Bacteria 8166
44 Ga0070671_100140758 3300005355 Bacteria 2036
45 Ga0070674_100015351 3300005356 Bacteria 4780
46 Ga0070674_100181259 3300005356 Bacteria 1613
47 Ga0070674_100189669 3300005356 Bacteria 1580
48 Ga0070673_100005018 3300005364 Bacteria 8443
49 Ga0070673_100012974 3300005364 Bacteria 5744
50 Ga0070673_100040373 3300005364 Bacteria 3579
51 Ga0070673_100128048 3300005364 Bacteria 2127
52 Ga0070673_100170045 3300005364 Bacteria 1860
53 Ga0070688_100140393 3300005365 Bacteria 1640
54 Ga0070659_100000182 3300005366 Bacteria 48054
55 Ga0070659_100011714 3300005366 Bacteria 6492
56 Ga0070659_100074962 3300005366 Bacteria 2696
57 Ga0070667_100007507 3300005367 Bacteria 9043
58 Ga0070667_100049904 3300005367 Bacteria 3525
59 Ga0070667_100142379 3300005367 Bacteria 2101
60 Ga0070667_100158834 3300005367 Bacteria 1990
61 Ga0070667_100465752 3300005367 Bacteria 1156
62 Ga0070713_100001252 3300005436 Bacteria 16220
63 Ga0070710_10079338 3300005437 Bacteria 1913
64 Ga0070701_10005488 3300005438 Bacteria 5247
65 Ga0070700_100001365 3300005441 Bacteria 12129
66 Ga0070700_100136301 3300005441 Bacteria 1662
67 Ga0070694_100044889 3300005444 Bacteria 2959
68 Ga0070663_100000018 3300005455 Bacteria 115228
69 Ga0070663_100013815 3300005455 Bacteria 5165
70 Ga0070663_100066627 3300005455 Bacteria 2610
71 Ga0070678_100001367 3300005456 Bacteria 12969
72 Ga0070678_100035806 3300005456 Bacteria 3469
73 Ga0070678_100045442 3300005456 Bacteria 3142
74 Ga0070678_100132490 3300005456 Bacteria 1983
75 Ga0070662_100000120 3300005457 Bacteria 43782
76 Ga0070662_100013726 3300005457 Bacteria 5395
77 Ga0070681_10153538 3300005458 Bacteria 2228
78 Ga0068867_100000747 3300005459 Bacteria 21835
79 Ga0068867_100025064 3300005459 Bacteria 4278
80 Ga0068867_100214013 3300005459 Bacteria 1549
81 Ga0068867_100435938 3300005459 Bacteria 1113
82 Ga0070685_10132971 3300005466 Bacteria 1557
83 Ga0070706_100003222 3300005467 Bacteria 16122
84 Ga0070707_100106151 3300005468 Bacteria 2724
85 Ga0070698_100160466 3300005471 Bacteria 2192
86 Ga0068853_100001080 3300005539 Bacteria 19275
87 Ga0070672_100013508 3300005543 Bacteria 5771
88 Ga0070672_100027196 3300005543 Bacteria 4264
89 Ga0070672_100068994 3300005543 Bacteria 2805
90 Ga0070672_100074880 3300005543 Bacteria 2701
91 Ga0070672_100342419 3300005543 Bacteria 1273
92 Ga0070686_100003993 3300005544 Bacteria 8114
93 Ga0070665_100108247 3300005548 Bacteria 2782
94 Ga0068855_100003059 3300005563 Bacteria 20475
95 Ga0070664_100000040 3300005564 Bacteria 78303
96 Ga0070664_100000226 3300005564 Bacteria 40249
97 Ga0070664_100021109 3300005564 Bacteria 5365
98 Ga0070664_100034710 3300005564 Bacteria 4231
99 Ga0070664_100200364 3300005564 Bacteria 1781
100 Ga0070664_100316411 3300005564 Bacteria 1413
101 Ga0068854_100000034 3300005578 Bacteria 102389
102 Ga0068856_100000115 3300005614 Bacteria 79608
103 Ga0068856_100002965 3300005614 Bacteria 17396
104 Ga0068856_100017787 3300005614 Bacteria 6894
105 Ga0068856_100102400 3300005614 Bacteria 2857
106 Ga0070702_100047298 3300005615 Bacteria 2443
107 Ga0070702_100093806 3300005615 Bacteria 1826
108 Ga0068852_100032428 3300005616 Bacteria 4326
109 Ga0068852_100069939 3300005616 Bacteria 3078
110 Ga0068852_100076804 3300005616 Bacteria 2950
111 Ga0068852_100103317 3300005616 Bacteria 2577
112 Ga0068859_100006800 3300005617 Bacteria 11622
113 Ga0068859_100021438 3300005617 Bacteria 6485
114 Ga0068864_100000270 3300005618 Bacteria 46170
115 Ga0068864_100003018 3300005618 Bacteria 13912
116 Ga0068864_100090502 3300005618 Bacteria 2697
117 Ga0068861_100021777 3300005719 Bacteria 4609
118 Ga0068870_10057194 3300005840 Bacteria 2084
119 Ga0068863_100000679 3300005841 Bacteria 34412
120 Ga0068863_100007805 3300005841 Bacteria 10464
121 Ga0068863_100030213 3300005841 Bacteria 5176
122 Ga0068858_100000225 3300005842 Bacteria 61439
123 Ga0068858_100006055 3300005842 Bacteria 11789
124 Ga0068860_100016611 3300005843 Bacteria 7178
125 Ga0068860_100057318 3300005843 Bacteria 3703
126 Ga0068860_100059050 3300005843 Bacteria 3647
127 Ga0068862_100004738 3300005844 Bacteria 11448
128 Ga0070717_10116593 3300006028 Bacteria 2283
129 Ga0075368_10018558 3300006042 Bacteria 2615
130 Ga0075368_10075186 3300006042 Bacteria 1369
131 Ga0070712_100251266 3300006175 Bacteria 1413
132 Ga0075362_10014993 3300006177 Bacteria 3143
133 Ga0075367_10057601 3300006178 Bacteria 2311
134 Ga0075367_10069226 3300006178 Bacteria 2118
135 Ga0075366_10028297 3300006195 Bacteria 3289
136 Ga0075366_10029487 3300006195 Bacteria 3223
137 Ga0075370_10049011 3300006353 Bacteria 2394
138 Ga0068871_100017117 3300006358 Bacteria 5478
139 Ga0068871_100065345 3300006358 Bacteria 2980
140 Ga0068871_100640219 3300006358 Bacteria 970
141 Ga0075428_100064783 3300006844 Bacteria 4002
142 Ga0075428_100610233 3300006844 Bacteria 1165
143 Ga0075430_100085664 3300006846 Bacteria 2638
144 Ga0075430_100179545 3300006846 Bacteria 1761
145 Ga0075431_100123944 3300006847 Bacteria 2666
146 Ga0075433_10004143 3300006852 Bacteria 11251
147 Ga0075434_100014425 3300006871 Bacteria 7553
148 Ga0075429_100034420 3300006880 Bacteria 4402
149 Ga0075429_100524125 3300006880 Bacteria 1038
150 Ga0068865_100003880 3300006881 Bacteria 8969
151 Ga0068865_100041453 3300006881 Bacteria 3133
152 Ga0068865_100382997 3300006881 Bacteria 1147
153 Ga0068865_100462814 3300006881 Bacteria 1051
154 Ga0097620_100006800 3300006931 Bacteria 11622
155 Ga0097620_100021439 3300006931 Bacteria 6485
156 Ga0075435_100024794 3300007076 Bacteria 4661
157 Ga0105251_10000503 3300009011 Bacteria 37047
158 Ga0105250_10002250 3300009092 Bacteria 9803
159 Ga0105240_10027731 3300009093 Bacteria 7412
160 Ga0105240_10476900 3300009093 Bacteria 1391
161 Ga0111539_10023024 3300009094 Bacteria 7650
162 Ga0111539_10024125 3300009094 Bacteria 7469
163 Ga0105243_10147269 3300009148 Bacteria 2016
164 Ga0105243_10170930 3300009148 Bacteria 1882
165 Ga0105243_10321661 3300009148 Bacteria 1410
166 Ga0105242_10008153 3300009176 Bacteria 8057
167 Ga0105242_10261634 3300009176 Bacteria 1563
168 Ga0105248_10013418 3300009177 Bacteria 9018
169 Ga0105248_10056256 3300009177 Bacteria 4413
170 Ga0105237_10000076 3300009545 Bacteria 131773
171 Ga0105238_10007384 3300009551 Bacteria 11012
172 Ga0105238_10314649 3300009551 Bacteria 1551
173 Ga0105249_10045934 3300009553 Bacteria 3974
174 Ga0105239_10008182 3300010375 Bacteria 11927
175 Ga0105239_10041681 3300010375 Bacteria 5030
176 Ga0105246_10152449 3300011119 Bacteria 1751
177 Ga0105246_10366866 3300011119 Bacteria 1185
178 Ga0157373_10008298 3300013100 Bacteria 7717
179 Ga0157373_10011895 3300013100 Bacteria 6393
180 Ga0157371_10000104 3300013102 Bacteria 128065
181 Ga0157371_10000769 3300013102 Bacteria 37033
182 Ga0157370_10000558 3300013104 Bacteria 46503
183 Ga0157370_10006051 3300013104 Bacteria 13437
184 Ga0157374_10084109 3300013296 Bacteria 3024
185 Ga0157374_10087464 3300013296 Bacteria 2966
186 Ga0157374_10087635 3300013296 Bacteria 2964
187 Ga0163162_10006036 3300013306 Bacteria 11727
188 Ga0163162_10029057 3300013306 Bacteria 5470
189 Ga0163162_10073271 3300013306 Bacteria 3480
190 Ga0157372_10000637 3300013307 Bacteria 38480
191 Ga0157372_10110826 3300013307 Bacteria 3143
192 Ga0157372_10111830 3300013307 Bacteria 3129
193 Ga0157372_10640332 3300013307 Bacteria 1238
194 Ga0157375_10045508 3300013308 Bacteria 4271
195 Ga0163163_10002982 3300014325 Bacteria 14319
196 Ga0163163_10012952 3300014325 Bacteria 7618
197 Ga0163163_10345830 3300014325 Bacteria 1543
198 Ga0157380_10010665 3300014326 Bacteria 6617
199 Ga0157380_10049190 3300014326 Bacteria 3324
200 Ga0157377_10007833 3300014745 Bacteria 5178
201 Ga0157379_10011386 3300014968 Bacteria 7759
202 Ga0157379_10078690 3300014968 Bacteria 2953
203 Ga0157376_10042403 3300014969 Bacteria 3730
204 Ga0157376_10141363 3300014969 Bacteria 2160
205 Ga0182006_1001042 3300015261 Bacteria 18011
206 Ga0182007_10014528 3300015262 Bacteria 2965
207 Ga0183361_10035 3300016635 Bacteria 47636
208 Ga0163161_10061950 3300017792 Bacteria 2724
209 Ga0163161_10123863 3300017792 Bacteria 1944
210 Ga0154015_1222406 3300020610 Bacteria 18981
211 Ga0213876_10192788 3300021384 Bacteria 1084
212 Ga0213875_10000674 3300021388 Bacteria 26801
213 Ga0213875_10051387 3300021388 Bacteria 1931
214 Ga0209784_100301 3300025224 Bacteria 26577
215 Ga0209566_100329 3300025225 Bacteria 42615
216 Ga0209566_102948 3300025225 Bacteria 2844
217 Ga0209674_100238 3300025226 Bacteria 46947
218 Ga0209147_100005 3300025229 Bacteria 1036530
219 Ga0209563_100170 3300025230 Bacteria 46947
220 Ga0209258_100007 3300025242 Bacteria 1036530
221 Ga0209677_100206 3300025253 Bacteria 46947
222 Ga0209759_1015420 3300025256 Bacteria 1973
223 Ga0209455_1000011 3300025272 Bacteria 947242
224 Ga0207426_1000004 3300025302 Bacteria 1047900
225 Ga0207697_10001457 3300025315 Bacteria 12916
226 Ga0207696_1001069 3300025711 Bacteria 16167
227 Ga0207655_1019264 3300025728 Bacteria 3576
228 Ga0207713_1013271 3300025735 Bacteria 4350
229 Ga0207682_10001324 3300025893 Bacteria 11389
230 Ga0207682_10004180 3300025893 Bacteria 6099
231 Ga0207682_10025214 3300025893 Bacteria 2358
232 Ga0207688_10000872 3300025901 Bacteria 15227
233 Ga0207688_10013968 3300025901 Bacteria 4365
234 Ga0207680_10000416 3300025903 Bacteria 20261
235 Ga0207645_10006820 3300025907 Bacteria 8151
236 Ga0207645_10113246 3300025907 Bacteria 1757
237 Ga0207643_10004624 3300025908 Bacteria 7390
238 Ga0207643_10059934 3300025908 Bacteria 2172
239 Ga0207705_10223108 3300025909 Bacteria 1432
240 Ga0207684_10002424 3300025910 Bacteria 18808
241 Ga0207707_10124646 3300025912 Bacteria 2253
242 Ga0207695_10005348 3300025913 Bacteria 17077
243 Ga0207695_10021153 3300025913 Bacteria 7431
244 Ga0207671_10005377 3300025914 Bacteria 11831
245 Ga0207657_10000250 3300025919 Bacteria 57310
246 Ga0207649_10000315 3300025920 Bacteria 36740
247 Ga0207649_10008412 3300025920 Bacteria 5625
248 Ga0207649_10099850 3300025920 Bacteria 1918
249 Ga0207646_10047710 3300025922 Bacteria 3841
250 Ga0207681_10041385 3300025923 Bacteria 3072
251 Ga0207681_10093356 3300025923 Bacteria 2154
252 Ga0207659_10000337 3300025926 Bacteria 28208
253 Ga0207659_10005440 3300025926 Bacteria 7719
254 Ga0207659_10022388 3300025926 Bacteria 4207
255 Ga0207659_10040289 3300025926 Bacteria 3265
256 Ga0207700_10014599 3300025928 Bacteria 5152
257 Ga0207664_10216838 3300025929 Bacteria 1658
258 Ga0207644_10000543 3300025931 Bacteria 24519
259 Ga0207644_10103460 3300025931 Bacteria 2143
260 Ga0207690_10007440 3300025932 Bacteria 6499
261 Ga0207690_10015711 3300025932 Bacteria 4593
262 Ga0207706_10000095 3300025933 Bacteria 92378
263 Ga0207706_10001893 3300025933 Bacteria 20555
264 Ga0207706_10023703 3300025933 Bacteria 5508
265 Ga0207706_10060225 3300025933 Bacteria 3343
266 Ga0207686_10001421 3300025934 Bacteria 13569
267 Ga0207709_10161942 3300025935 Bacteria 1561
268 Ga0207670_10004563 3300025936 Bacteria 7479
269 Ga0207669_10121295 3300025937 Bacteria 1775
270 Ga0207669_10140534 3300025937 Bacteria 1675
271 Ga0207669_10406252 3300025937 Bacteria 1068
272 Ga0207704_10028541 3300025938 Bacteria 3098
273 Ga0207704_10091631 3300025938 Bacteria 1998
274 Ga0207665_10008131 3300025939 Bacteria 6924
275 Ga0207691_10006066 3300025940 Bacteria 11675
276 Ga0207691_10023561 3300025940 Bacteria 5797
277 Ga0207691_10037660 3300025940 Bacteria 4478
278 Ga0207691_10041733 3300025940 Bacteria 4234
279 Ga0207691_10119969 3300025940 Bacteria 2332
280 Ga0207691_10144807 3300025940 Bacteria 2092
281 Ga0207711_10020498 3300025941 Bacteria 5513
282 Ga0207711_10183067 3300025941 Bacteria 1906
283 Ga0207689_10002705 3300025942 Bacteria 16395
284 Ga0207689_10002978 3300025942 Bacteria 15626
285 Ga0207689_10320491 3300025942 Bacteria 1286
286 Ga0207679_10000041 3300025945 Bacteria 127201
287 Ga0207679_10001552 3300025945 Bacteria 14363
288 Ga0207679_10029614 3300025945 Bacteria 3813
289 Ga0207679_10075912 3300025945 Bacteria 2552
290 Ga0207679_10086825 3300025945 Bacteria 2407
291 Ga0207679_10405413 3300025945 Bacteria 1200
292 Ga0207667_10040163 3300025949 Bacteria 4982
293 Ga0207651_10013626 3300025960 Bacteria 4660
294 Ga0207651_10023271 3300025960 Bacteria 3806
295 Ga0207651_10023867 3300025960 Bacteria 3771
296 Ga0207651_10183149 3300025960 Bacteria 1663
297 Ga0207651_10257745 3300025960 Bacteria 1430
298 Ga0207640_10000252 3300025981 Bacteria 36460
299 Ga0207640_10074537 3300025981 Bacteria 2297
300 Ga0207658_10125815 3300025986 Bacteria 2051
301 Ga0207658_10444696 3300025986 Bacteria 1146
302 Ga0207677_10026008 3300026023 Bacteria 3663
303 Ga0207677_10215142 3300026023 Bacteria 1537
304 Ga0207703_10000408 3300026035 Bacteria 45772
305 Ga0207639_10023389 3300026041 Bacteria 4462
306 Ga0207678_10000027 3300026067 Bacteria 115784
307 Ga0207678_10071278 3300026067 Bacteria 2979
308 Ga0207678_10119827 3300026067 Bacteria 2246
309 Ga0207708_10010209 3300026075 Bacteria 6971
310 Ga0207708_10018886 3300026075 Bacteria 5192
311 Ga0207708_10121867 3300026075 Bacteria 2032
312 Ga0207702_10000059 3300026078 Bacteria 127076
313 Ga0207702_10049309 3300026078 Bacteria 3553
314 Ga0207702_10053144 3300026078 Bacteria 3429
315 Ga0207702_10088238 3300026078 Bacteria 2709
316 Ga0207641_10002065 3300026088 Bacteria 19074
317 Ga0207641_10006964 3300026088 Bacteria 9461
318 Ga0207641_10462570 3300026088 Bacteria 1227
319 Ga0207648_10001163 3300026089 Bacteria 29498
320 Ga0207648_10023829 3300026089 Bacteria 5474
321 Ga0207648_10048081 3300026089 Bacteria 3736
322 Ga0207648_10136949 3300026089 Bacteria 2157
323 Ga0207676_10000269 3300026095 Bacteria 45280
324 Ga0207676_10003930 3300026095 Bacteria 10493
325 Ga0207676_10382620 3300026095 Bacteria 1310
326 Ga0207675_100007023 3300026118 Bacteria 10638
327 Ga0207675_100184021 3300026118 Bacteria 2002
328 Ga0207683_10001051 3300026121 Bacteria 25171
329 Ga0207683_10027790 3300026121 Bacteria 4889
330 Ga0207683_10049392 3300026121 Bacteria 3683
331 Ga0207683_10189948 3300026121 Bacteria 1865
332 Ga0207683_10349910 3300026121 Bacteria 1356
333 Ga0207698_10017202 3300026142 Bacteria 4898
334 Ga0207698_10050014 3300026142 Bacteria 3186
335 Ga0207698_10118349 3300026142 Bacteria 2237
336 Ga0209998_10004244 3300027717 Bacteria 3055
337 Ga0209974_10000445 3300027876 Bacteria 13695
338 Ga0207428_10001074 3300027907 Bacteria 29830
339 Ga0207428_10065430 3300027907 Bacteria 2868
340 Ga0268265_10031784 3300028380 Bacteria 3815
341 Ga0268264_10042823 3300028381 Bacteria 3749
342 Ga0268264_10055714 3300028381 Bacteria 3304
343 Ga0268264_10232255 3300028381 Bacteria 1704
344 Ga0307515_10025404 3300028794 Bacteria 10252
345 Ga0265325_10070702 3300031241 Bacteria 1753
346 Ga0307513_10000006 3300031456 Bacteria 470848
347 Ga0307408_100005497 3300031548 Bacteria 8471
348 Ga0307408_100022892 3300031548 Bacteria 4251
349 Ga0307408_100040880 3300031548 Bacteria 3285
350 Ga0307405_10009777 3300031731 Bacteria 4934
351 Ga0307405_10018284 3300031731 Bacteria 3863
352 Ga0307413_10001878 3300031824 Bacteria 8299
353 Ga0307410_10026410 3300031852 Bacteria 3655
354 Ga0307406_10005174 3300031901 Bacteria 7121
355 Ga0307406_10104600 3300031901 Bacteria 1935
356 Ga0307407_10003161 3300031903 Bacteria 6670
357 Ga0307407_10020514 3300031903 Bacteria 3389
358 Ga0307412_10008286 3300031911 Bacteria 5925
359 Ga0307412_10023383 3300031911 Bacteria 3802
360 Ga0307409_100002844 3300031995 Bacteria 9155
361 Ga0307416_100004578 3300032002 Bacteria 8357
362 Ga0307414_10086942 3300032004 Bacteria 2308
363 Ga0307411_10002200 3300032005 Bacteria 8481
364 Ga0307411_10040244 3300032005 Bacteria 2963
365 Ga0307415_100043526 3300032126 Bacteria 2996
366 Ga0307415_100068808 3300032126 Bacteria 2479
367 Ga0373949_0000103 3300035090 Bacteria 31484
368 Ga0373954_0213051 3300035118 Bacteria 950
369 Ga0373943_0076188 3300035170 Bacteria 1710
370 Ga0373946_0041829 3300035171 Bacteria 1881
371 Ga0373946_0093910 3300035171 Bacteria 1334
372 Ga0373935_0014282 3300035692 Bacteria 4793
373 Ga0373933_0271382 3300035724 Bacteria 1095
374 Ga0373947_0190386 3300035725 Bacteria 1338
375 Ga0373937_0039242 3300036401 Bacteria 4316
376 Ga0373937_0099673 3300036401 Bacteria 2695
377 Ga0373925_0048487 3300037068 Bacteria 3165
378 Ga0373925_0376666 3300037068 Bacteria 1155
379 Ga0395905_0000082 3300037471 Bacteria 158963
380 Ga0436364_0170052 3300037853 Bacteria 2455
381 Ga0436364_0531048 3300037853 Bacteria 8917
382 Ga0436364_0931094 3300037853 Bacteria 1982
383 Ga0436364_1183619 3300037853 Bacteria 29970
384 Ga0436365_0115278 3300039437 Bacteria 1131
385 Ga0436365_1828232 3300039437 Bacteria 1661
386 Ga0436361_0504916 3300039447 Bacteria 40492
387 Ga0436363_1393379 3300039450 Bacteria 885
388 Ga0439449_0000877 3300042007 Bacteria 11748
389 Ga0450911_000058 3300042115 Bacteria 45420
390 Ga0451577_0003070 3300042876 Bacteria 18890
391 Ga0466963_0144603 3300044694 Bacteria 1649
392 Ga0453684_0009366 3300044712 Bacteria 17157
393 Ga0466957_0003265 3300044842 Bacteria 8882
394 Ga0451576_0036681 3300045051 Bacteria 5195
395 Ga0451576_0117700 3300045051 Bacteria 2766
396 Ga0466967_0049365 3300045976 Bacteria 3680
397 Ga0466967_0056184 3300045976 Bacteria 3470
398 Ga0495603_0001042 3300046455 Bacteria 16056
399 Ga0495580_0000009 3300046472 Bacteria 101827
400 Ga0495582_0020588 3300046473 Bacteria 3611
401 Ga0495664_0202594 3300046477 Bacteria 1202
402 Ga0495583_0015706 3300046506 Bacteria 4103
403 Ga0495616_0035012 3300046513 Bacteria 2602
404 Ga0495616_0094446 3300046513 Bacteria 1411
405 Ga0495637_0037030 3300046520 Bacteria 2121
406 Ga0495648_0020152 3300046524 Bacteria 4663
407 Ga0495654_0065852 3300046530 Bacteria 1728
408 Ga0495665_0159106 3300046531 Bacteria 1178
409 Ga0495640_0213482 3300046533 Bacteria 1219
410 Ga0495597_0000837 3300046542 Bacteria 24200
411 Ga0495622_0020406 3300046557 Bacteria 3086
412 Ga0495635_0267891 3300046663 Bacteria 1149
413 Ga0495588_0008814 3300046674 Bacteria 4637
414 Ga0495658_0150664 3300046683 Bacteria 1428
415 Ga0495658_0221022 3300046683 Bacteria 1186
416 Ga0495658_0291503 3300046683 Bacteria 1031
417 Ga0495669_0044341 3300046684 Bacteria 1981
418 Ga0495671_0103704 3300046692 Bacteria 1389
419 Ga0495649_0115564 3300046694 Bacteria 1421
420 Ga0495674_0005831 3300047319 Bacteria 11813
421 Ga0495674_0038811 3300047319 Bacteria 4272
422 Ga0495672_0036082 3300047320 Bacteria 3039
423 Ga0495672_0077707 3300047320 Bacteria 1859
424 Ga0495687_052578 3300047443 Bacteria 1721
425 Ga0495686_0000042 3300047472 Bacteria 293968
426 Ga0496100_0000070 3300048903 Bacteria 56600
427 Ga0496100_0078475 3300048903 Bacteria 2222
428 Ga0496100_0108245 3300048903 Bacteria 1927
429 Ga0496101_0000044 3300048904 Bacteria 161295
430 Ga0496102_0001008 3300048905 Bacteria 26419
431 Ga0496102_0069901 3300048905 Bacteria 3223
432 Ga0496103_0003977 3300048906 Bacteria 8973
433 Ga0496103_0018931 3300048906 Bacteria 4134
434 Ga0496104_0016684 3300048907 Bacteria 6675
435 Ga0496104_0057426 3300048907 Bacteria 3682
436 Ga0496104_0245771 3300048907 Bacteria 1702
437 Ga0496105_0057944 3300048908 Bacteria 3198
438 Ga0496106_0009029 3300048909 Bacteria 7366
439 Ga0496106_0066997 3300048909 Bacteria 2736
440 Ga0496106_0127971 3300048909 Bacteria 1990
441 Ga0496107_0014812 3300048910 Bacteria 5459
442 Ga0496107_0078393 3300048910 Bacteria 2407
443 Ga0496108_0119295 3300048911 Bacteria 2262
444 Ga0496108_0294111 3300048911 Bacteria 1414
445 Ga0496109_0177515 3300048912 Bacteria 2000
446 Ga0496110_0203918 3300048913 Bacteria 1797
447 Ga0496112_0091124 3300048915 Bacteria 3017
448 Ga0496112_0189606 3300048915 Bacteria 2018
449 Ga0496113_0003769 3300048916 Bacteria 9150
450 Ga0496114_0381690 3300048917 Bacteria 1247
451 Ga0496116_0124576 3300048919 Bacteria 1483
452 Ga0496117_0000098 3300048920 Bacteria 196331
453 Ga0496118_0008754 3300048921 Bacteria 10381
454 Ga0496120_0108735 3300048923 Bacteria 1452
455 Ga0496121_0002190 3300048924 Bacteria 30584
456 Ga0496121_0004074 3300048924 Bacteria 20073
457 Ga0496121_0020462 3300048924 Bacteria 6548
458 Ga0496124_0035322 3300048927 Bacteria 4374
459 Ga0496125_0005204 3300048928 Bacteria 14596
460 Ga0496125_0008108 3300048928 Bacteria 11065
461 Ga0496125_0098096 3300048928 Bacteria 2169
462 Ga0496125_0203900 3300048928 Bacteria 1291
463 Ga0496126_0199802 3300048929 Bacteria 1689
464 Ga0495678_021267 3300049459 Bacteria 2860
465 Ga0495682_0066486 3300049460 Bacteria 1299
466 Ga0501033_0222010 3300049570 Bacteria 1345
467 Ga0501038_0105850 3300049574 Bacteria 2336
468 Ga0501040_0042021 3300049576 Bacteria 3114
469 Ga0501041_0031205 3300049577 Bacteria 3218
470 Ga0501042_0066621 3300049578 Bacteria 2574
471 Ga0501071_0346266 3300049587 Bacteria 1130
472 Ga0501072_0084756 3300049588 Bacteria 2513
473 Ga0501075_0055070 3300049591 Bacteria 2992
474 Ga0501076_0126958 3300049592 Bacteria 2067
475 Ga0501079_0043871 3300049741 Bacteria 3452
476 Ga0501081_0096598 3300049743 Bacteria 2084
477 Ga0501045_0267837 3300049824 Bacteria 1272
478 nmdc:mga0k408_37110_c1 3300050493 Bacteria 2797
479 nmdc:mga06z11_14050_c1 3300050494 Bacteria 3534
480 nmdc:mga06z11_79451_c1 3300050494 Bacteria 1756
481 nmdc:mga07m45_155943_c1 3300050496 Bacteria 1325
482 nmdc:mga05p37_407384_c1 3300050507 Bacteria 1586
483 nmdc:mga05p37_898139_c1 3300050507 Bacteria 956
484 nmdc:mga09592_262205_c1 3300050508 Bacteria 1499
485 nmdc:mga0qj67_26275_c1 3300050509 Bacteria 4507
486 nmdc:mga06r32_296599_c1 3300050510 Bacteria 1603
487 nmdc:mga08y16_15079_c1 3300050511 Bacteria 8126
488 nmdc:mga0n895_18572_c1 3300050512 Bacteria 6438
489 nmdc:mga0rr50_12364_c1 3300050513 Bacteria 5109
490 nmdc:mga0a205_6207_c1 3300050515 Bacteria 10788
491 Ga0495601_0187495 3300053077 Bacteria 1352
492 Ga0500651_0002536 3300053093 Bacteria 9686
493 Ga0500642_0001167 3300053130 Bacteria 7529
494 Ga0500645_029170 3300053730 Bacteria 1666
495 Ga0501084_0146722 3300054114 Bacteria 1987
496 Ga0587083_0000271 3300059505 Bacteria 4051
497 Ga0587088_000114 3300059508 Bacteria 4745
498 Ga0587098_002880 3300059604 Bacteria 1500
499 Ga0587067_000174 3300059640 Bacteria 4662
500 Ga0587072_000018 3300059643 Bacteria 10605
501 Ga0587079_001540 3300059647 Bacteria 2614
502 Ga0587111_0003390 3300060346 Bacteria 2258
503 Ga0501082_0095806 3300060353 Bacteria 2565
504 2514047338 2513237166 Bacteria 10373764
505 2563059756 2562617112 Bacteria 10918404
506 2597031041 2596583598 Bacteria 5251611
507 2599448172 2599185178 Bacteria 5365746
508 2713480536 2711768613 Bacteria 11048459
509 2792840397 2791355137 Bacteria 9654227
510 2885196265 2885192300 Bacteria 5882526
511 2900582441 2900577576 Bacteria 5438534
512 2904546347 2904541872 Bacteria 8915136
513 2904616595 2904615490 Bacteria 10047340
514 2929164162 2929160207 Bacteria 9075316
515 642598084 642555112 Bacteria 8676562
516 Ga0373931_0284056
517 JGI24740J21852_10000047
518 JGI24034J26672_10011665
519 JGI25156J39149_1008751
520 JGI25160J50197_1000037
521 Ga0055539_1000203
522 Ga0055532_1000037
523 Ga0055525_1000888
524 Ga0055527_1000666
525 Ga0055535_1000018
526 Ga0055529_1000041
527 Ga0055541_1004129
528 Ga0065165_1000629
529 Ga0065715_10103195
530 Ga0065715_10165457
531 Ga0065715_10224696
532 Ga0070658_10250944
533 Ga0070690_100046163
534 Ga0070670_100057172
535 Ga0070670_100196677
536 Ga0070677_10001471
537 Ga0068869_100004312
538 Ga0068869_100047735
539 Ga0068869_100332677
540 Ga0070666_10004700
541 Ga0070666_10056206
542 Ga0068868_100000928
543 Ga0070660_100002643
544 Ga0070689_100017265
545 Ga0070687_100167337
546 Ga0070661_100000131
547 Ga0070661_100012776
548 Ga0070661_100083164
549 Ga0070661_100192495
550 Ga0070669_100004160
551 Ga0070669_100007709
552 Ga0070675_100000772
553 Ga0070675_100003039
554 Ga0070675_100060672
555 Ga0070675_100219212
556 Ga0070675_100530036
557 Ga0070671_100003449
558 Ga0070671_100008648
559 Ga0070671_100140758
560 Ga0070674_100015351
561 Ga0070674_100181259
562 Ga0070674_100189669
563 Ga0070673_100005018
564 Ga0070673_100012974
565 Ga0070673_100040373
566 Ga0070673_100128048
567 Ga0070673_100170045
568 Ga0070688_100140393
569 Ga0070659_100000182
570 Ga0070659_100011714
571 Ga0070659_100074962
572 Ga0070667_100007507
573 Ga0070667_100049904
574 Ga0070667_100142379
575 Ga0070667_100158834
576 Ga0070667_100465752
577 Ga0070713_100001252
578 Ga0070710_10079338
579 Ga0070701_10005488
580 Ga0070700_100001365
581 Ga0070700_100136301
582 Ga0070694_100044889
583 Ga0070663_100000018
584 Ga0070663_100013815
585 Ga0070663_100066627
586 Ga0070678_100001367
587 Ga0070678_100035806
588 Ga0070678_100045442
589 Ga0070678_100132490
590 Ga0070662_100000120
591 Ga0070662_100013726
592 Ga0070681_10153538
593 Ga0068867_100000747
594 Ga0068867_100025064
595 Ga0068867_100214013
596 Ga0068867_100435938
597 Ga0070685_10132971
598 Ga0070706_100003222
599 Ga0070707_100106151
600 Ga0070698_100160466
601 Ga0068853_100001080
602 Ga0070672_100013508
603 Ga0070672_100027196
604 Ga0070672_100068994
605 Ga0070672_100074880
606 Ga0070672_100342419
607 Ga0070686_100003993
608 Ga0070665_100108247
609 Ga0068855_100003059
610 Ga0070664_100000040
611 Ga0070664_100000226
612 Ga0070664_100021109
613 Ga0070664_100034710
614 Ga0070664_100200364
615 Ga0070664_100316411
616 Ga0068854_100000034
617 Ga0068856_100000115
618 Ga0068856_100002965
619 Ga0068856_100017787
620 Ga0068856_100102400
621 Ga0070702_100047298
622 Ga0070702_100093806
623 Ga0068852_100032428
624 Ga0068852_100069939
625 Ga0068852_100076804
626 Ga0068852_100103317
627 Ga0068859_100006800
628 Ga0068859_100021438
629 Ga0068864_100000270
630 Ga0068864_100003018
631 Ga0068864_100090502
632 Ga0068861_100021777
633 Ga0068870_10057194
634 Ga0068863_100000679
635 Ga0068863_100007805
636 Ga0068863_100030213
637 Ga0068858_100000225
638 Ga0068858_100006055
639 Ga0068860_100016611
640 Ga0068860_100057318
641 Ga0068860_100059050
642 Ga0068862_100004738
643 Ga0070717_10116593
644 Ga0075368_10018558
645 Ga0075368_10075186
646 Ga0070712_100251266
647 Ga0075362_10014993
648 Ga0075367_10057601
649 Ga0075367_10069226
650 Ga0075366_10028297
651 Ga0075366_10029487
652 Ga0075370_10049011
653 Ga0068871_100017117
654 Ga0068871_100065345
655 Ga0068871_100640219
656 Ga0075428_100064783
657 Ga0075428_100610233
658 Ga0075430_100085664
659 Ga0075430_100179545
660 Ga0075431_100123944
661 Ga0075433_10004143
662 Ga0075434_100014425
663 Ga0075429_100034420
664 Ga0075429_100524125
665 Ga0068865_100003880
666 Ga0068865_100041453
667 Ga0068865_100382997
668 Ga0068865_100462814
669 Ga0097620_100006800
670 Ga0097620_100021439
671 Ga0075435_100024794
672 Ga0105251_10000503
673 Ga0105250_10002250
674 Ga0105240_10027731
675 Ga0105240_10476900
676 Ga0111539_10023024
677 Ga0111539_10024125
678 Ga0105243_10147269
679 Ga0105243_10170930
680 Ga0105243_10321661
681 Ga0105242_10008153
682 Ga0105242_10261634
683 Ga0105248_10013418
684 Ga0105248_10056256
685 Ga0105237_10000076
686 Ga0105238_10007384
687 Ga0105238_10314649
688 Ga0105249_10045934
689 Ga0105239_10008182
690 Ga0105239_10041681
691 Ga0105246_10152449
692 Ga0105246_10366866
693 Ga0157373_10008298
694 Ga0157373_10011895
695 Ga0157371_10000104
696 Ga0157371_10000769
697 Ga0157370_10000558
698 Ga0157370_10006051
699 Ga0157374_10084109
700 Ga0157374_10087464
701 Ga0157374_10087635
702 Ga0163162_10006036
703 Ga0163162_10029057
704 Ga0163162_10073271
705 Ga0157372_10000637
706 Ga0157372_10110826
707 Ga0157372_10111830
708 Ga0157372_10640332
709 Ga0157375_10045508
710 Ga0163163_10002982
711 Ga0163163_10012952
712 Ga0163163_10345830
713 Ga0157380_10010665
714 Ga0157380_10049190
715 Ga0157377_10007833
716 Ga0157379_10011386
717 Ga0157379_10078690
718 Ga0157376_10042403
719 Ga0157376_10141363
720 Ga0182006_1001042
721 Ga0182007_10014528
722 Ga0183361_10035
723 Ga0163161_10061950
724 Ga0163161_10123863
725 Ga0154015_1222406
726 Ga0213876_10192788
727 Ga0213875_10000674
728 Ga0213875_10051387
729 Ga0209784_100301
730 Ga0209566_100329
731 Ga0209566_102948
732 Ga0209674_100238
733 Ga0209147_100005
734 Ga0209563_100170
735 Ga0209258_100007
736 Ga0209677_100206
737 Ga0209759_1015420
738 Ga0209455_1000011
739 Ga0207426_1000004
740 Ga0207697_10001457
741 Ga0207696_1001069
742 Ga0207655_1019264
743 Ga0207713_1013271
744 Ga0207682_10001324
745 Ga0207682_10004180
746 Ga0207682_10025214
747 Ga0207688_10000872
748 Ga0207688_10013968
749 Ga0207680_10000416
750 Ga0207645_10006820
751 Ga0207645_10113246
752 Ga0207643_10004624
753 Ga0207643_10059934
754 Ga0207705_10223108
755 Ga0207684_10002424
756 Ga0207707_10124646
757 Ga0207695_10005348
758 Ga0207695_10021153
759 Ga0207671_10005377
760 Ga0207657_10000250
761 Ga0207649_10000315
762 Ga0207649_10008412
763 Ga0207649_10099850
764 Ga0207646_10047710
765 Ga0207681_10041385
766 Ga0207681_10093356
767 Ga0207659_10000337
768 Ga0207659_10005440
769 Ga0207659_10022388
770 Ga0207659_10040289
771 Ga0207700_10014599
772 Ga0207664_10216838
773 Ga0207644_10000543
774 Ga0207644_10103460
775 Ga0207690_10007440
776 Ga0207690_10015711
777 Ga0207706_10000095
778 Ga0207706_10001893
779 Ga0207706_10023703
780 Ga0207706_10060225
781 Ga0207686_10001421
782 Ga0207709_10161942
783 Ga0207670_10004563
784 Ga0207669_10121295
785 Ga0207669_10140534
786 Ga0207669_10406252
787 Ga0207704_10028541
788 Ga0207704_10091631
789 Ga0207665_10008131
790 Ga0207691_10006066
791 Ga0207691_10023561
792 Ga0207691_10037660
793 Ga0207691_10041733
794 Ga0207691_10119969
795 Ga0207691_10144807
796 Ga0207711_10020498
797 Ga0207711_10183067
798 Ga0207689_10002705
799 Ga0207689_10002978
800 Ga0207689_10320491
801 Ga0207679_10000041
802 Ga0207679_10001552
803 Ga0207679_10029614
804 Ga0207679_10075912
805 Ga0207679_10086825
806 Ga0207679_10405413
807 Ga0207667_10040163
808 Ga0207651_10013626
809 Ga0207651_10023271
810 Ga0207651_10023867
811 Ga0207651_10183149
812 Ga0207651_10257745
813 Ga0207640_10000252
814 Ga0207640_10074537
815 Ga0207658_10125815
816 Ga0207658_10444696
817 Ga0207677_10026008
818 Ga0207677_10215142
819 Ga0207703_10000408
820 Ga0207639_10023389
821 Ga0207678_10000027
822 Ga0207678_10071278
823 Ga0207678_10119827
824 Ga0207708_10010209
825 Ga0207708_10018886
826 Ga0207708_10121867
827 Ga0207702_10000059
828 Ga0207702_10049309
829 Ga0207702_10053144
830 Ga0207702_10088238
831 Ga0207641_10002065
832 Ga0207641_10006964
833 Ga0207641_10462570
834 Ga0207648_10001163
835 Ga0207648_10023829
836 Ga0207648_10048081
837 Ga0207648_10136949
838 Ga0207676_10000269
839 Ga0207676_10003930
840 Ga0207676_10382620
841 Ga0207675_100007023
842 Ga0207675_100184021
843 Ga0207683_10001051
844 Ga0207683_10027790
845 Ga0207683_10049392
846 Ga0207683_10189948
847 Ga0207683_10349910
848 Ga0207698_10017202
849 Ga0207698_10050014
850 Ga0207698_10118349
851 Ga0209998_10004244
852 Ga0209974_10000445
853 Ga0207428_10001074
854 Ga0207428_10065430
855 Ga0268265_10031784
856 Ga0268264_10042823
857 Ga0268264_10055714
858 Ga0268264_10232255
859 Ga0307515_10025404
860 Ga0265325_10070702
861 Ga0307513_10000006
862 Ga0307408_100005497
863 Ga0307408_100022892
864 Ga0307408_100040880
865 Ga0307405_10009777
866 Ga0307405_10018284
867 Ga0307413_10001878
868 Ga0307410_10026410
869 Ga0307406_10005174
870 Ga0307406_10104600
871 Ga0307407_10003161
872 Ga0307407_10020514
873 Ga0307412_10008286
874 Ga0307412_10023383
875 Ga0307409_100002844
876 Ga0307416_100004578
877 Ga0307414_10086942
878 Ga0307411_10002200
879 Ga0307411_10040244
880 Ga0307415_100043526
881 Ga0307415_100068808
882 Ga0373949_0000103
883 Ga0373954_0213051
884 Ga0373943_0076188
885 Ga0373946_0041829
886 Ga0373946_0093910
887 Ga0373935_0014282
888 Ga0373933_0271382
889 Ga0373947_0190386
890 Ga0373937_0039242
891 Ga0373937_0099673
892 Ga0373925_0048487
893 Ga0373925_0376666
894 Ga0395905_0000082
895 Ga0436364_0170052
896 Ga0436364_0531048
897 Ga0436364_0931094
898 Ga0436364_1183619
899 Ga0436365_0115278
900 Ga0436365_1828232
901 Ga0436361_0504916
902 Ga0436363_1393379
903 Ga0439449_0000877
904 Ga0450911_000058
905 Ga0451577_0003070
906 Ga0466963_0144603
907 Ga0453684_0009366
908 Ga0466957_0003265
909 Ga0451576_0036681
910 Ga0451576_0117700
911 Ga0466967_0049365
912 Ga0466967_0056184
913 Ga0495603_0001042
914 Ga0495580_0000009
915 Ga0495582_0020588
916 Ga0495664_0202594
917 Ga0495583_0015706
918 Ga0495616_0035012
919 Ga0495616_0094446
920 Ga0495637_0037030
921 Ga0495648_0020152
922 Ga0495654_0065852
923 Ga0495665_0159106
924 Ga0495640_0213482
925 Ga0495597_0000837
926 Ga0495622_0020406
927 Ga0495635_0267891
928 Ga0495588_0008814
929 Ga0495658_0150664
930 Ga0495658_0221022
931 Ga0495658_0291503
932 Ga0495669_0044341
933 Ga0495671_0103704
934 Ga0495649_0115564
935 Ga0495674_0005831
936 Ga0495674_0038811
937 Ga0495672_0036082
938 Ga0495672_0077707
939 Ga0495687_052578
940 Ga0495686_0000042
941 Ga0496100_0000070
942 Ga0496100_0078475
943 Ga0496100_0108245
944 Ga0496101_0000044
945 Ga0496102_0001008
946 Ga0496102_0069901
947 Ga0496103_0003977
948 Ga0496103_0018931
949 Ga0496104_0016684
950 Ga0496104_0057426
951 Ga0496104_0245771
952 Ga0496105_0057944
953 Ga0496106_0009029
954 Ga0496106_0066997
955 Ga0496106_0127971
956 Ga0496107_0014812
957 Ga0496107_0078393
958 Ga0496108_0119295
959 Ga0496108_0294111
960 Ga0496109_0177515
961 Ga0496110_0203918
962 Ga0496112_0091124
963 Ga0496112_0189606
964 Ga0496113_0003769
965 Ga0496114_0381690
966 Ga0496116_0124576
967 Ga0496117_0000098
968 Ga0496118_0008754
969 Ga0496120_0108735
970 Ga0496121_0002190
971 Ga0496121_0004074
972 Ga0496121_0020462
973 Ga0496124_0035322
974 Ga0496125_0005204
975 Ga0496125_0008108
976 Ga0496125_0098096
977 Ga0496125_0203900
978 Ga0496126_0199802
979 Ga0495678_021267
980 Ga0495682_0066486
981 Ga0501033_0222010
982 Ga0501038_0105850
983 Ga0501040_0042021
984 Ga0501041_0031205
985 Ga0501042_0066621
986 Ga0501071_0346266
987 Ga0501072_0084756
988 Ga0501075_0055070
989 Ga0501076_0126958
990 Ga0501079_0043871
991 Ga0501081_0096598
992 Ga0501045_0267837
993 nmdc:mga0k408_37110_c1
994 nmdc:mga06z11_14050_c1
995 nmdc:mga06z11_79451_c1
996 nmdc:mga07m45_155943_c1
997 nmdc:mga05p37_407384_c1
998 nmdc:mga05p37_898139_c1
999 nmdc:mga09592_262205_c1
1000 nmdc:mga0qj67_26275_c1
1001 nmdc:mga06r32_296599_c1
1002 nmdc:mga08y16_15079_c1
1003 nmdc:mga0n895_18572_c1
1004 nmdc:mga0rr50_12364_c1
1005 nmdc:mga0a205_6207_c1
1006 Ga0495601_0187495
1007 Ga0500651_0002536
1008 Ga0500642_0001167
1009 Ga0500645_029170
1010 Ga0501084_0146722
1011 Ga0587083_0000271
1012 Ga0587088_000114
1013 Ga0587098_002880
1014 Ga0587067_000174
1015 Ga0587072_000018
1016 Ga0587079_001540
1017 Ga0587111_0003390
1018 Ga0501082_0095806
1019 2514047338
1020 2563059756
1021 2597031041
1022 2599448172
1023 2713480536
1024 2792840397
1025 2885196265
1026 2900582441
1027 2904546347
1028 2904616595
1029 2929164162
1030 642598084

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08501

Shikimate_dh_N

Shikimate dehydrogenase substrate binding domain

46

128

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hk8-assembly2.cif.gz_B crystal structure of shikimate dehydrogenase from aquifex aeolicus at 2.35 angstrom resolution 0.9224 1 272
4k28-assembly1.cif.gz_A 2.15 angstrom resolution crystal structure of a shikimate dehydrogenase family protein from pseudomonas putida kt2440 in complex with nad+ 0.9158 3 263
2d5c-assembly1.cif.gz_B crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with shikimate 0.9119 6 272
2hk8-assembly2.cif.gz_B crystal structure of shikimate dehydrogenase from aquifex aeolicus at 2.35 angstrom resolution 0.9092 1 272
1nvt-assembly1.cif.gz_B crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with nadp+ 0.9036 1 272
ID Description Score Start End Superfamily
3tumA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9538 3 106 3.40.50.10860
3tozG01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9468 2 107 3.40.50.10860
3tumA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9438 109 250 3.40.50.720
af_P15770_4_98_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9424 10 104 2.40.10.10
af_P0A6D5_3_112_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9422 2 112 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A2N4YT83-F1-model_v4 Shikimate dehydrogenase 0.9902 1 109 GO:0004764
GO:0008652
GO:0009073
GO:0009423
GO:0019632
AF-W7TEQ6-F1-model_v4 Shikimate 5-dehydrogenase 0.981 1 122 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661
AF-A0A519FLW2-F1-model_v4 deleted 0.9739 1 126
AF-A0A543N8V6-F1-model_v4 deleted 0.9723 2 259
AF-A0A1H1KIJ1-F1-model_v4 Shikimate dehydrogenase 0.9668 1 260 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661

Map