F457835

General Info

Members Datasets Scaffolds Average Seq Length
515 312 1030 295

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10036040|Ga0081455_100360402
Length 357
Sequence MSEKPISPLRRRMLQDMAVRRLGEKAQSNYIRQIETFTLFLGRSPDTATAEDVRRFQIHLTETGVGPSSINQAATALRFFFGTTLDRPELARHLARVHYPRPLPRVLSPEEVGRLLEAAPGPGLKYKAALSIAYGAGLRAGEVVMLRVSDIDSKRMLIRVEQGKGRKDRHAMLSPQLLELLRAWWRQCRSQGWLFPGRDPVLPITTRQLNRVCHMAAEAAGLGTWVSPHTLRHSFATHLLESNTDVRVIQVLLGHSKLEVAEFIRRFLLHVLPKGFHRIRHYGLLAGTAKVETIAKARDILIAAVNPDTVEIDEDVTTAHAHPCPCCGGRMMIVELFEPSCQPQHQPINPTIRMDTS

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
80 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
124 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
125 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
126 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
127 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
135 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
136 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
139 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
140 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
141 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
142 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
164 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
175 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
185 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
186 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
215 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
216 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
294 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
297 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
298 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
299 2516143018 Ensifer sp. BR816 Isolate Nodule
300 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
301 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
302 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
303 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
304 2643221626 Ensifer sp. Root31 Isolate Unclassified
305 2643221659 Ensifer sp. Root127 Isolate Unclassified
306 2643221698 Ensifer sp. Root142 Isolate Unclassified
307 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
308 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
309 2844163670 Ensifer sp. 1H6 Isolate Unclassified
310 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
311 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
312 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 95.15
Metatranscriptomes 0.19
Isolates 4.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 2.52
Rhizoplane 4.66
Rhizosphere 88.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10036040 3300005937 Bacteria 4410
2 JGI24750J21931_1001717 3300002070 Bacteria 2675
3 JGI24738J21930_10006901 3300002075 Bacteria 2637
4 JGI24738J21930_10006959 3300002075 Bacteria 2628
5 JGI24738J21930_10006961 3300002075 Bacteria 2628
6 Ga0065704_10013126 3300005289 Bacteria 1856
7 Ga0070676_10156416 3300005328 Bacteria 1463
8 Ga0070670_100326714 3300005331 Bacteria 1345
9 Ga0068869_100081780 3300005334 Bacteria 2413
10 Ga0068868_100110975 3300005338 Bacteria 2228
11 Ga0070660_100272900 3300005339 Bacteria 1383
12 Ga0070660_100295258 3300005339 Bacteria 1328
13 Ga0070689_100080940 3300005340 Bacteria 2549
14 Ga0070691_10021375 3300005341 Bacteria 2994
15 Ga0070691_10136918 3300005341 Bacteria 1245
16 Ga0070661_100056395 3300005344 Bacteria 2879
17 Ga0070669_100055967 3300005353 Bacteria 2891
18 Ga0070671_100367502 3300005355 Bacteria 1228
19 Ga0070673_100259796 3300005364 Bacteria 1517
20 Ga0070673_100326774 3300005364 Bacteria 1356
21 Ga0070688_100198347 3300005365 Bacteria 1403
22 Ga0070709_10041420 3300005434 Bacteria 2838
23 Ga0070709_10119004 3300005434 Bacteria 1787
24 Ga0070709_10186117 3300005434 Bacteria 1462
25 Ga0070714_100067462 3300005435 Bacteria 3085
26 Ga0070714_100073229 3300005435 Bacteria 2968
27 Ga0070714_100086854 3300005435 Bacteria 2734
28 Ga0070714_100092648 3300005435 Bacteria 2649
29 Ga0070714_100146605 3300005435 Bacteria 2124
30 Ga0070713_100022202 3300005436 Bacteria 4899
31 Ga0070713_100080856 3300005436 Bacteria 2772
32 Ga0070713_100130340 3300005436 Bacteria 2217
33 Ga0070713_100305869 3300005436 Bacteria 1465
34 Ga0070713_100313763 3300005436 Bacteria 1446
35 Ga0070710_10031744 3300005437 Bacteria 2855
36 Ga0070710_10032468 3300005437 Bacteria 2828
37 Ga0070710_10036308 3300005437 Bacteria 2694
38 Ga0070710_10137305 3300005437 Bacteria 1496
39 Ga0070711_100117939 3300005439 Bacteria 1958
40 Ga0070711_100192439 3300005439 Bacteria 1569
41 Ga0070711_100251075 3300005439 Bacteria 1387
42 Ga0070705_100211698 3300005440 Bacteria 1336
43 Ga0070700_100095889 3300005441 Bacteria 1945
44 Ga0070678_100043403 3300005456 Bacteria 3202
45 Ga0068867_100185762 3300005459 Bacteria 1655
46 Ga0070685_10173939 3300005466 Bacteria 1382
47 Ga0070706_100029571 3300005467 Bacteria 5047
48 Ga0070706_100234964 3300005467 Bacteria 1711
49 Ga0070707_100608200 3300005468 Bacteria 1055
50 Ga0070698_100534880 3300005471 Bacteria 1111
51 Ga0068853_100143614 3300005539 Bacteria 2144
52 Ga0070664_100116109 3300005564 Bacteria 2340
53 Ga0068857_100186295 3300005577 Bacteria 1889
54 Ga0068854_100061439 3300005578 Bacteria 2721
55 Ga0068856_100321064 3300005614 Bacteria 1566
56 Ga0070702_100076456 3300005615 Bacteria 1992
57 Ga0068852_100370715 3300005616 Bacteria 1402
58 Ga0068864_100168173 3300005618 Bacteria 1997
59 Ga0068866_10054288 3300005718 Bacteria 2052
60 Ga0068861_100063849 3300005719 Bacteria 2831
61 Ga0068861_100064852 3300005719 Bacteria 2811
62 Ga0068861_100197449 3300005719 Bacteria 1686
63 Ga0068851_10023322 3300005834 Bacteria 3024
64 Ga0068858_100335756 3300005842 Bacteria 1446
65 Ga0068860_100443528 3300005843 Bacteria 1290
66 Ga0068862_100067697 3300005844 Bacteria 3079
67 Ga0068862_100078826 3300005844 Bacteria 2854
68 Ga0081455_10058520 3300005937 Bacteria 3260
69 Ga0081455_10066495 3300005937 Bacteria 3010
70 Ga0081455_10120420 3300005937 Bacteria 2069
71 Ga0081538_10063186 3300005981 Bacteria 2104
72 Ga0081539_10039530 3300005985 Bacteria 2781
73 Ga0070717_10081263 3300006028 Bacteria 2721
74 Ga0070717_10453238 3300006028 Bacteria 1156
75 Ga0075432_10008763 3300006058 Bacteria 3451
76 Ga0075432_10010967 3300006058 Bacteria 3079
77 Ga0075432_10016890 3300006058 Bacteria 2491
78 Ga0070715_10009958 3300006163 Bacteria 3371
79 Ga0070715_10018405 3300006163 Bacteria 2661
80 Ga0070715_10030460 3300006163 Bacteria 2182
81 Ga0070716_100019587 3300006173 Bacteria 3538
82 Ga0070716_100038350 3300006173 Bacteria 2653
83 Ga0070716_100230921 3300006173 Bacteria 1249
84 Ga0070712_100015717 3300006175 Bacteria 4879
85 Ga0070712_100048077 3300006175 Bacteria 2955
86 Ga0070712_100051615 3300006175 Bacteria 2865
87 Ga0070712_100056706 3300006175 Bacteria 2749
88 Ga0070712_100123110 3300006175 Bacteria 1954
89 Ga0070712_100173687 3300006175 Bacteria 1674
90 Ga0070712_100515865 3300006175 Bacteria 1003
91 Ga0075428_100450579 3300006844 Bacteria 1378
92 Ga0075430_100086719 3300006846 Bacteria 2620
93 Ga0075431_100128305 3300006847 Bacteria 2617
94 Ga0075433_10099141 3300006852 Bacteria 2579
95 Ga0075433_10341130 3300006852 Bacteria 1324
96 Ga0075434_100123598 3300006871 Bacteria 2604
97 Ga0075434_100385429 3300006871 Bacteria 1422
98 Ga0075429_100095444 3300006880 Bacteria 2593
99 Ga0068865_100104363 3300006881 Bacteria 2080
100 Ga0075436_100046438 3300006914 Bacteria 2995
101 Ga0075436_100151309 3300006914 Bacteria 1633
102 Ga0075435_100086655 3300007076 Bacteria 2579
103 Ga0075435_100280499 3300007076 Bacteria 1422
104 Ga0099794_10013354 3300007265 Bacteria 3573
105 Ga0099795_10007038 3300007788 Bacteria 3112
106 Ga0099795_10081160 3300007788 Bacteria 1241
107 Ga0111539_10128960 3300009094 Bacteria 2962
108 Ga0111539_10174595 3300009094 Bacteria 2510
109 Ga0111539_10320383 3300009094 Bacteria 1804
110 Ga0111539_10476604 3300009094 Bacteria 1453
111 Ga0111539_10491473 3300009094 Bacteria 1429
112 Ga0105245_10139297 3300009098 Bacteria 2283
113 Ga0114129_10189660 3300009147 Bacteria 2792
114 Ga0105243_10373585 3300009148 Bacteria 1316
115 Ga0105242_10051762 3300009176 Bacteria 3348
116 Ga0105249_10074762 3300009553 Bacteria 3137
117 Ga0105249_10076398 3300009553 Bacteria 3104
118 Ga0105249_10221772 3300009553 Bacteria 1861
119 Ga0099796_10017427 3300010159 Bacteria 2139
120 Ga0099796_10035433 3300010159 Bacteria 1655
121 Ga0105239_10190900 3300010375 Bacteria 2293
122 Ga0105246_10148717 3300011119 Bacteria 1770
123 Ga0157374_10081301 3300013296 Bacteria 3075
124 Ga0163162_10023570 3300013306 Bacteria 6076
125 Ga0163162_10334692 3300013306 Bacteria 1646
126 Ga0157375_10414633 3300013308 Bacteria 1513
127 Ga0157375_10606178 3300013308 Bacteria 1254
128 Ga0163163_10153708 3300014325 Bacteria 2344
129 Ga0157377_10279587 3300014745 Bacteria 1093
130 Ga0163161_10163879 3300017792 Bacteria 1696
131 Ga0213874_10003893 3300021377 Bacteria 3357
132 Ga0213874_10049521 3300021377 Bacteria 1284
133 Ga0213875_10009320 3300021388 Bacteria 4979
134 Ga0213871_10035105 3300021441 Bacteria 1325
135 Ga0228598_1005021 3300024227 Bacteria 2782
136 Ga0207697_10019608 3300025315 Bacteria 2771
137 Ga0207656_10020345 3300025321 Bacteria 2637
138 Ga0207692_10028161 3300025898 Bacteria 2654
139 Ga0207692_10085575 3300025898 Bacteria 1696
140 Ga0207692_10092294 3300025898 Bacteria 1645
141 Ga0207692_10126853 3300025898 Bacteria 1436
142 Ga0207642_10019588 3300025899 Bacteria 2623
143 Ga0207688_10013315 3300025901 Bacteria 4468
144 Ga0207680_10146442 3300025903 Bacteria 1570
145 Ga0207685_10010940 3300025905 Bacteria 2705
146 Ga0207685_10011581 3300025905 Bacteria 2658
147 Ga0207685_10076523 3300025905 Bacteria 1372
148 Ga0207699_10037105 3300025906 Bacteria 2783
149 Ga0207699_10042339 3300025906 Bacteria 2637
150 Ga0207699_10046369 3300025906 Bacteria 2542
151 Ga0207699_10054696 3300025906 Bacteria 2372
152 Ga0207699_10125991 3300025906 Bacteria 1663
153 Ga0207699_10163915 3300025906 Bacteria 1482
154 Ga0207699_10230703 3300025906 Bacteria 1268
155 Ga0207684_10074823 3300025910 Bacteria 2878
156 Ga0207684_10078590 3300025910 Bacteria 2806
157 Ga0207693_10033030 3300025915 Bacteria 4084
158 Ga0207693_10046130 3300025915 Bacteria 3423
159 Ga0207693_10062879 3300025915 Bacteria 2908
160 Ga0207693_10106123 3300025915 Bacteria 2203
161 Ga0207693_10182972 3300025915 Bacteria 1649
162 Ga0207663_10039125 3300025916 Bacteria 2871
163 Ga0207663_10043682 3300025916 Bacteria 2746
164 Ga0207663_10104997 3300025916 Bacteria 1906
165 Ga0207663_10183837 3300025916 Bacteria 1495
166 Ga0207657_10273053 3300025919 Bacteria 1344
167 Ga0207649_10125826 3300025920 Bacteria 1734
168 Ga0207646_10095769 3300025922 Bacteria 2659
169 Ga0207681_10072295 3300025923 Bacteria 2408
170 Ga0207659_10067715 3300025926 Bacteria 2594
171 Ga0207659_10380844 3300025926 Bacteria 1176
172 Ga0207700_10060951 3300025928 Bacteria 2859
173 Ga0207700_10064535 3300025928 Bacteria 2790
174 Ga0207700_10377990 3300025928 Bacteria 1238
175 Ga0207664_10046332 3300025929 Bacteria 3412
176 Ga0207664_10078520 3300025929 Bacteria 2677
177 Ga0207664_10079698 3300025929 Bacteria 2659
178 Ga0207664_10109051 3300025929 Bacteria 2299
179 Ga0207664_10129648 3300025929 Bacteria 2122
180 Ga0207690_10046084 3300025932 Bacteria 2885
181 Ga0207706_10078796 3300025933 Bacteria 2898
182 Ga0207686_10247686 3300025934 Bacteria 1300
183 Ga0207704_10209224 3300025938 Bacteria 1434
184 Ga0207665_10133033 3300025939 Bacteria 1767
185 Ga0207665_10157809 3300025939 Bacteria 1629
186 Ga0207689_10081093 3300025942 Bacteria 2667
187 Ga0207661_10083976 3300025944 Bacteria 2636
188 Ga0207679_10253881 3300025945 Bacteria 1496
189 Ga0207651_10339545 3300025960 Bacteria 1261
190 Ga0207712_10046253 3300025961 Bacteria 3017
191 Ga0207712_10061023 3300025961 Bacteria 2675
192 Ga0207712_10295888 3300025961 Bacteria 1326
193 Ga0207668_10058567 3300025972 Bacteria 2693
194 Ga0207668_10579399 3300025972 Bacteria 975
195 Ga0207640_10188798 3300025981 Bacteria 1551
196 Ga0207640_10313202 3300025981 Bacteria 1246
197 Ga0207677_10189791 3300026023 Bacteria 1624
198 Ga0207678_10151824 3300026067 Bacteria 1978
199 Ga0207678_10474075 3300026067 Bacteria 1090
200 Ga0207708_10051252 3300026075 Bacteria 3141
201 Ga0207648_10040041 3300026089 Bacteria 4119
202 Ga0207676_10201364 3300026095 Bacteria 1759
203 Ga0207674_10240727 3300026116 Bacteria 1756
204 Ga0207675_100384644 3300026118 Bacteria 1380
205 Ga0207675_100534171 3300026118 Bacteria 1170
206 Ga0207698_10226055 3300026142 Bacteria 1695
207 Ga0209588_1002087 3300027671 Bacteria 5396
208 Ga0207428_10046925 3300027907 Bacteria 3471
209 Ga0207428_10062933 3300027907 Bacteria 2932
210 Ga0207428_10076876 3300027907 Bacteria 2614
211 Ga0207428_10078576 3300027907 Bacteria 2582
212 Ga0207428_10286463 3300027907 Bacteria 1222
213 Ga0207428_10372322 3300027907 Bacteria 1049
214 Ga0268266_10307721 3300028379 Bacteria 1480
215 Ga0268265_10070362 3300028380 Bacteria 2720
216 Ga0316575_10110695 3300031665 Bacteria 1120
217 Ga0316579_10043286 3300031691 Bacteria 2094
218 Ga0316576_10049400 3300031727 Bacteria 3055
219 Ga0316578_10030296 3300031728 Bacteria 3074
220 Ga0316578_10037494 3300031728 Bacteria 2792
221 Ga0316577_10031224 3300031733 Bacteria 2976
222 Ga0316577_10244883 3300031733 Bacteria 1014
223 Ga0307413_10047100 3300031824 Bacteria 2568
224 Ga0307410_10044529 3300031852 Bacteria 2948
225 Ga0307407_10048188 3300031903 Bacteria 2423
226 Ga0307409_100060627 3300031995 Bacteria 2951
227 Ga0307414_10057459 3300032004 Bacteria 2735
228 Ga0307415_100031722 3300032126 Bacteria 3408
229 Ga0316583_10064018 3300032133 Bacteria 1287
230 Ga0316585_10013520 3300032137 Bacteria 2431
231 Ga0316585_10035780 3300032137 Bacteria 1573
232 Ga0316596_1020277 3300033541 Bacteria 1690
233 Ga0373930_0004614 3300034816 Bacteria 2252
234 Ga0373948_0004897 3300034817 Bacteria 2142
235 Ga0373948_0015012 3300034817 Bacteria 1418
236 Ga0373950_0001499 3300034818 Bacteria 3057
237 Ga0373958_0001772 3300034819 Bacteria 2942
238 Ga0373959_0001615 3300034820 Bacteria 3590
239 Ga0373959_0032992 3300034820 Bacteria 1055
240 Ga0373938_0002473 3300034957 Bacteria 2985
241 Ga0373926_0013387 3300035083 Bacteria 2781
242 Ga0373926_0014496 3300035083 Bacteria 2680
243 Ga0373928_0003779 3300035084 Bacteria 2889
244 Ga0373934_0014339 3300035086 Bacteria 3003
245 Ga0373949_0005653 3300035090 Bacteria 2782
246 Ga0373951_0007361 3300035091 Bacteria 2500
247 Ga0373951_0021942 3300035091 Bacteria 1468
248 Ga0373952_0003991 3300035092 Bacteria 2667
249 Ga0373923_0020848 3300035111 Bacteria 2552
250 Ga0373923_0022749 3300035111 Bacteria 2461
251 Ga0373932_0005767 3300035112 Bacteria 2916
252 Ga0373932_0006431 3300035112 Bacteria 2778
253 Ga0373936_0017179 3300035113 Bacteria 2785
254 Ga0373936_0018100 3300035113 Bacteria 2718
255 Ga0373936_0018973 3300035113 Bacteria 2662
256 Ga0373939_0008812 3300035114 Bacteria 2484
257 Ga0373941_0007011 3300035115 Bacteria 2739
258 Ga0373941_0112536 3300035115 Bacteria 961
259 Ga0373945_0012163 3300035116 Bacteria 2854
260 Ga0373945_0012392 3300035116 Bacteria 2831
261 Ga0373953_0012244 3300035117 Bacteria 3032
262 Ga0373954_0019650 3300035118 Bacteria 3049
263 Ga0373956_0017174 3300035119 Bacteria 3048
264 Ga0373956_0021652 3300035119 Bacteria 2743
265 Ga0373957_0014381 3300035120 Bacteria 2704
266 Ga0373960_0006439 3300035121 Bacteria 2754
267 Ga0373960_0008341 3300035121 Bacteria 2481
268 Ga0373943_0020094 3300035170 Bacteria 3076
269 Ga0373943_0022284 3300035170 Bacteria 2933
270 Ga0373943_0024228 3300035170 Bacteria 2828
271 Ga0373943_0026580 3300035170 Bacteria 2712
272 Ga0373946_0013278 3300035171 Bacteria 3094
273 Ga0373946_0042564 3300035171 Bacteria 1867
274 Ga0373955_0033108 3300035172 Bacteria 2719
275 Ga0373942_0006345 3300035207 Bacteria 2730
276 Ga0373942_0008651 3300035207 Bacteria 2376
277 Ga0373961_0006778 3300035241 Bacteria 2755
278 Ga0373962_0007308 3300035242 Bacteria 2702
279 Ga0316574_0018973 3300035398 Bacteria 4051
280 Ga0316574_0033599 3300035398 Bacteria 3122
281 Ga0316574_0054497 3300035398 Bacteria 2497
282 Ga0316574_0128874 3300035398 Bacteria 1627
283 Ga0316574_0188482 3300035398 Bacteria 1326
284 Ga0373924_0016116 3300035410 Bacteria 2850
285 Ga0373931_0012476 3300035691 Bacteria 4116
286 Ga0373931_0031254 3300035691 Bacteria 2747
287 Ga0373931_0033894 3300035691 Bacteria 2647
288 Ga0373931_0213073 3300035691 Bacteria 1159
289 Ga0373935_0040084 3300035692 Bacteria 2938
290 Ga0373927_0032882 3300035695 Bacteria 3377
291 Ga0373927_0033715 3300035695 Bacteria 3332
292 Ga0373927_0051055 3300035695 Bacteria 2674
293 Ga0373927_0053347 3300035695 Bacteria 2615
294 Ga0373927_0081102 3300035695 Bacteria 2102
295 Ga0373933_0027258 3300035724 Bacteria 3288
296 Ga0373933_0177876 3300035724 Bacteria 1356
297 Ga0373933_0206567 3300035724 Bacteria 1258
298 Ga0373933_0218968 3300035724 Bacteria 1221
299 Ga0373947_0030057 3300035725 Bacteria 3190
300 Ga0373947_0041306 3300035725 Bacteria 2749
301 Ga0373947_0233306 3300035725 Bacteria 1212
302 Ga0373937_0072584 3300036401 Bacteria 3174
303 Ga0373937_0364352 3300036401 Bacteria 1370
304 Ga0316582_0038043 3300036647 Bacteria 2987
305 Ga0316582_0051582 3300036647 Bacteria 2610
306 Ga0316582_0071373 3300036647 Bacteria 2249
307 Ga0316582_0284257 3300036647 Bacteria 1135
308 Ga0316584_0014317 3300036712 Bacteria 5642
309 Ga0316584_0040645 3300036712 Bacteria 3465
310 Ga0316584_0068414 3300036712 Bacteria 2661
311 Ga0316584_0084686 3300036712 Bacteria 2374
312 Ga0373925_0025898 3300037068 Bacteria 4288
313 Ga0373925_0060649 3300037068 Bacteria 2840
314 Ga0373925_0068000 3300037068 Bacteria 2687
315 Ga0436364_1071122 3300037853 Bacteria 2568
316 Ga0242420_002296 3300038996 Bacteria 2713
317 Ga0436365_0217050 3300039437 Bacteria 2543
318 Ga0436365_0438810 3300039437 Bacteria 2016
319 Ga0436360_0192933 3300039438 Bacteria 1296
320 Ga0436360_0307363 3300039438 Bacteria 1455
321 Ga0436361_0050209 3300039447 Bacteria 4848
322 Ga0436361_0990561 3300039447 Bacteria 1007
323 Ga0436363_0149268 3300039450 Bacteria 4062
324 Ga0439465_0030382 3300041413 Bacteria 1719
325 Ga0439442_010704 3300042002 Bacteria 1863
326 Ga0439445_0013714 3300042004 Bacteria 1964
327 Ga0439450_016865 3300042008 Bacteria 1515
328 Ga0439434_0022408 3300042435 Bacteria 1899
329 Ga0439444_0019771 3300042437 Bacteria 1179
330 Ga0439464_0046161 3300042439 Bacteria 1252
331 Ga0439460_0077888 3300042461 Bacteria 1036
332 Ga0466963_0121015 3300044694 Bacteria 1801
333 Ga0495592_0053579 3300046454 Bacteria 2991
334 Ga0495603_0043024 3300046455 Bacteria 2698
335 Ga0495629_0062197 3300046459 Bacteria 2608
336 Ga0495638_0025781 3300046460 Bacteria 3817
337 Ga0495641_0079337 3300046461 Bacteria 1471
338 Ga0495651_0063626 3300046462 Bacteria 2819
339 Ga0495650_0019834 3300046471 Bacteria 3295
340 Ga0495580_0011359 3300046472 Bacteria 6891
341 Ga0495580_0055875 3300046472 Bacteria 2780
342 Ga0495580_0227268 3300046472 Bacteria 1281
343 Ga0495582_0020785 3300046473 Bacteria 3594
344 Ga0495582_0093775 3300046473 Bacteria 1676
345 Ga0495639_0022461 3300046475 Bacteria 2768
346 Ga0495662_0020297 3300046476 Bacteria 3213
347 Ga0495662_0029756 3300046476 Bacteria 2635
348 Ga0495664_0037621 3300046477 Bacteria 2856
349 Ga0495664_0037821 3300046477 Bacteria 2848
350 Ga0495664_0038250 3300046477 Bacteria 2832
351 Ga0495584_0011281 3300046491 Bacteria 4577
352 Ga0495585_0010395 3300046492 Bacteria 5542
353 Ga0495594_0066801 3300046499 Bacteria 1995
354 Ga0495606_0062395 3300046507 Bacteria 2379
355 Ga0495608_0068267 3300046511 Bacteria 2324
356 Ga0495610_0046385 3300046512 Bacteria 2144
357 Ga0495618_0041305 3300046514 Bacteria 2904
358 Ga0495620_0063234 3300046515 Bacteria 1535
359 Ga0495628_0058679 3300046516 Bacteria 3022
360 Ga0495628_0062573 3300046516 Bacteria 2916
361 Ga0495628_0082839 3300046516 Bacteria 2491
362 Ga0495628_0205184 3300046516 Bacteria 1484
363 Ga0495630_0061390 3300046517 Bacteria 2822
364 Ga0495630_0066843 3300046517 Bacteria 2702
365 Ga0495632_0032284 3300046519 Bacteria 2699
366 Ga0495666_0155846 3300046526 Bacteria 1060
367 Ga0495642_0007127 3300046528 Bacteria 4288
368 Ga0495652_0086293 3300046529 Bacteria 2577
369 Ga0495652_0143931 3300046529 Bacteria 1871
370 Ga0495665_0032149 3300046531 Bacteria 2806
371 Ga0495665_0081999 3300046531 Bacteria 1695
372 Ga0495640_0056072 3300046533 Bacteria 2693
373 Ga0495586_0033507 3300046535 Bacteria 2756
374 Ga0495586_0047180 3300046535 Bacteria 2324
375 Ga0495587_0038933 3300046536 Bacteria 2848
376 Ga0495645_0058757 3300046543 Bacteria 2789
377 Ga0495645_0135581 3300046543 Bacteria 1722
378 Ga0495667_0053470 3300046559 Bacteria 2659
379 Ga0495634_0035411 3300046642 Bacteria 3419
380 Ga0495634_0052258 3300046642 Bacteria 2739
381 Ga0495634_0057542 3300046642 Bacteria 2594
382 Ga0495611_0056231 3300046648 Bacteria 1781
383 Ga0495625_0143284 3300046660 Bacteria 1611
384 Ga0495635_0170417 3300046663 Bacteria 1480
385 Ga0495657_0029259 3300046675 Bacteria 3865
386 Ga0495657_0245720 3300046675 Bacteria 1079
387 Ga0495599_0038903 3300046678 Bacteria 2989
388 Ga0495623_0049561 3300046679 Bacteria 2661
389 Ga0495646_0007215 3300046680 Bacteria 7057
390 Ga0495646_0049499 3300046680 Bacteria 2550
391 Ga0495646_0089466 3300046680 Bacteria 1781
392 Ga0495647_0018482 3300046681 Bacteria 2482
393 Ga0495647_0031545 3300046681 Bacteria 1971
394 Ga0495658_0009392 3300046683 Bacteria 4873
395 Ga0495658_0030600 3300046683 Bacteria 2924
396 Ga0495658_0033279 3300046683 Bacteria 2821
397 Ga0495613_0069024 3300046689 Bacteria 2577
398 Ga0495624_0010792 3300046690 Bacteria 6297
399 Ga0495624_0032966 3300046690 Bacteria 3356
400 Ga0495624_0044140 3300046690 Bacteria 2842
401 Ga0495624_0052617 3300046690 Bacteria 2572
402 Ga0495671_0117625 3300046692 Bacteria 1297
403 Ga0495649_0107000 3300046694 Bacteria 1484
404 Ga0495589_0005577 3300046794 Bacteria 6637
405 Ga0495600_0198367 3300046809 Bacteria 1289
406 Ga0495581_0300236 3300047315 Bacteria 939
407 Ga0495604_0063274 3300047317 Bacteria 2822
408 Ga0495674_0023725 3300047319 Bacteria 5649
409 Ga0495674_0071987 3300047319 Bacteria 2982
410 Ga0495674_0094517 3300047319 Bacteria 2549
411 Ga0495674_0199302 3300047319 Bacteria 1661
412 Ga0495676_0067039 3300047321 Bacteria 2778
413 Ga0495676_0117029 3300047321 Bacteria 1945
414 Ga0495680_0069015 3300047322 Bacteria 2698
415 Ga0495683_0036191 3300047323 Bacteria 2506
416 Ga0495687_008494 3300047443 Bacteria 5874
417 Ga0495675_0044043 3300047444 Bacteria 2842
418 Ga0495681_0053309 3300047470 Bacteria 1894
419 Ga0495684_0065668 3300047471 Bacteria 2758
420 Ga0495684_0232573 3300047471 Bacteria 1347
421 Ga0495593_0025226 3300047673 Bacteria 3290
422 Ga0495593_0032983 3300047673 Bacteria 2821
423 Ga0495602_0080722 3300048088 Bacteria 2738
424 Ga0495602_0368373 3300048088 Bacteria 1032
425 Ga0495614_0023358 3300048089 Bacteria 2667
426 Ga0495614_0111578 3300048089 Bacteria 1201
427 Ga0495626_0014296 3300048091 Bacteria 4099
428 Ga0495626_0050341 3300048091 Bacteria 1925
429 Ga0496100_0054062 3300048903 Bacteria 2617
430 Ga0496101_0064857 3300048904 Bacteria 2661
431 Ga0496101_0121785 3300048904 Bacteria 1973
432 Ga0496101_0160747 3300048904 Bacteria 1722
433 Ga0496101_0203315 3300048904 Bacteria 1532
434 Ga0496101_0212063 3300048904 Bacteria 1500
435 Ga0496102_0019346 3300048905 Bacteria 5998
436 Ga0496103_0068025 3300048906 Bacteria 2225
437 Ga0496104_0339924 3300048907 Bacteria 1414
438 Ga0496105_0314421 3300048908 Bacteria 1257
439 Ga0496106_0115685 3300048909 Bacteria 2091
440 Ga0496106_0266379 3300048909 Bacteria 1371
441 Ga0496106_0301557 3300048909 Bacteria 1285
442 Ga0496107_0025660 3300048910 Bacteria 4174
443 Ga0496109_0641649 3300048912 Bacteria 999
444 Ga0496114_0081687 3300048917 Bacteria 2730
445 Ga0496114_0085838 3300048917 Bacteria 2666
446 Ga0496114_0095219 3300048917 Bacteria 2533
447 Ga0496115_0056442 3300048918 Bacteria 3156
448 Ga0496115_0078870 3300048918 Bacteria 2679
449 Ga0496115_0236837 3300048918 Bacteria 1505
450 Ga0496116_0112250 3300048919 Bacteria 1598
451 Ga0496116_0200522 3300048919 Bacteria 1045
452 Ga0496121_0089868 3300048924 Bacteria 2403
453 Ga0496122_0063348 3300048925 Bacteria 2699
454 Ga0501039_0110637 3300049575 Bacteria 2147
455 Ga0501040_0099505 3300049576 Bacteria 2027
456 Ga0501041_0048662 3300049577 Bacteria 2582
457 Ga0501042_0180599 3300049578 Bacteria 1522
458 Ga0501068_0200902 3300049584 Bacteria 1264
459 Ga0501069_0128938 3300049585 Bacteria 1448
460 Ga0501070_0265938 3300049586 Bacteria 1401
461 Ga0501072_0320191 3300049588 Bacteria 1232
462 Ga0501076_0332477 3300049592 Bacteria 1246
463 Ga0501077_0049022 3300049593 Bacteria 2683
464 Ga0501077_0157540 3300049593 Bacteria 1441
465 Ga0501079_0074701 3300049741 Bacteria 2620
466 Ga0501081_0260334 3300049743 Bacteria 1267
467 Ga0501083_0233949 3300049744 Bacteria 1196
468 Ga0501045_0315293 3300049824 Bacteria 1164
469 nmdc:mga05p37_74917_c1 3300050507 Bacteria 4166
470 nmdc:mga09592_21837_c1 3300050508 Bacteria 5278
471 nmdc:mga0qj67_24585_c1 3300050509 Bacteria 4646
472 nmdc:mga06r32_68744_c1 3300050510 Bacteria 3423
473 nmdc:mga08y16_117528_c1 3300050511 Bacteria 2768
474 nmdc:mga08y16_133300_c1 3300050511 Bacteria 2583
475 nmdc:mga08y16_147508_c1 3300050511 Bacteria 2446
476 nmdc:mga08y16_153564_c1 3300050511 Bacteria 2393
477 nmdc:mga08y16_296182_c1 3300050511 Bacteria 1668
478 nmdc:mga08y16_40746_c1 3300050511 Bacteria 4867
479 nmdc:mga0n895_182423_c1 3300050512 Bacteria 2130
480 nmdc:mga0n895_238426_c1 3300050512 Bacteria 1846
481 nmdc:mga0rr50_20271_c1 3300050513 Bacteria 4510
482 nmdc:mga0rr50_218059_c1 3300050513 Bacteria 1575
483 nmdc:mga08x19_32325_c1 3300050514 Bacteria 3296
484 nmdc:mga08x19_56790_c1 3300050514 Bacteria 2528
485 nmdc:mga0a205_215_c1 3300050515 Bacteria 40643
486 Ga0495601_0032408 3300053077 Bacteria 3253
487 Ga0495619_0047471 3300053085 Bacteria 2827
488 Ga0500582_004679 3300053114 Bacteria 2755
489 Ga0500568_0013582 3300053139 Bacteria 3708
490 Ga0501082_0108323 3300060353 Bacteria 2404
491 Ga0530510_0292346 3300061734 Bacteria 1218
492 2509142644 2508501127 Bacteria 7037543
493 2514592669 2513237351 Bacteria 6968952
494 2516204258 2516143018 Bacteria 6951533
495 2516206323 2516143018 Bacteria 6951533
496 2516206480 2516143018 Bacteria 6951533
497 2516207224 2516143018 Bacteria 6951533
498 2516207248 2516143018 Bacteria 6951533
499 2516208032 2516143018 Bacteria 6951533
500 2516208501 2516143018 Bacteria 6951533
501 2517566716 2517487022 Bacteria 7227575
502 2524452614 2524023207 Bacteria 6813453
503 2524453243 2524023207 Bacteria 6813453
504 2551715632 2551306089 Bacteria 7162724
505 2600194261 2599185352 Bacteria 7228948
506 2644151000 2643221626 Bacteria 8069654
507 2644332250 2643221659 Bacteria 7890716
508 2644540051 2643221698 Bacteria 7756764
509 2776264775 2775506901 Bacteria 9631051
510 2838081277 2838074704 Bacteria 6785777
511 2844170241 2844163670 Bacteria 7266046
512 2920825036 2920822456 Bacteria 6897201
513 2937843889 2937843397 Bacteria 5256375
514 642424952 641736151 Bacteria 7477263
515 642427011 641736151 Bacteria 7477263
516 Ga0081455_10036040
517 JGI24750J21931_1001717
518 JGI24738J21930_10006901
519 JGI24738J21930_10006959
520 JGI24738J21930_10006961
521 Ga0065704_10013126
522 Ga0070676_10156416
523 Ga0070670_100326714
524 Ga0068869_100081780
525 Ga0068868_100110975
526 Ga0070660_100272900
527 Ga0070660_100295258
528 Ga0070689_100080940
529 Ga0070691_10021375
530 Ga0070691_10136918
531 Ga0070661_100056395
532 Ga0070669_100055967
533 Ga0070671_100367502
534 Ga0070673_100259796
535 Ga0070673_100326774
536 Ga0070688_100198347
537 Ga0070709_10041420
538 Ga0070709_10119004
539 Ga0070709_10186117
540 Ga0070714_100067462
541 Ga0070714_100073229
542 Ga0070714_100086854
543 Ga0070714_100092648
544 Ga0070714_100146605
545 Ga0070713_100022202
546 Ga0070713_100080856
547 Ga0070713_100130340
548 Ga0070713_100305869
549 Ga0070713_100313763
550 Ga0070710_10031744
551 Ga0070710_10032468
552 Ga0070710_10036308
553 Ga0070710_10137305
554 Ga0070711_100117939
555 Ga0070711_100192439
556 Ga0070711_100251075
557 Ga0070705_100211698
558 Ga0070700_100095889
559 Ga0070678_100043403
560 Ga0068867_100185762
561 Ga0070685_10173939
562 Ga0070706_100029571
563 Ga0070706_100234964
564 Ga0070707_100608200
565 Ga0070698_100534880
566 Ga0068853_100143614
567 Ga0070664_100116109
568 Ga0068857_100186295
569 Ga0068854_100061439
570 Ga0068856_100321064
571 Ga0070702_100076456
572 Ga0068852_100370715
573 Ga0068864_100168173
574 Ga0068866_10054288
575 Ga0068861_100063849
576 Ga0068861_100064852
577 Ga0068861_100197449
578 Ga0068851_10023322
579 Ga0068858_100335756
580 Ga0068860_100443528
581 Ga0068862_100067697
582 Ga0068862_100078826
583 Ga0081455_10058520
584 Ga0081455_10066495
585 Ga0081455_10120420
586 Ga0081538_10063186
587 Ga0081539_10039530
588 Ga0070717_10081263
589 Ga0070717_10453238
590 Ga0075432_10008763
591 Ga0075432_10010967
592 Ga0075432_10016890
593 Ga0070715_10009958
594 Ga0070715_10018405
595 Ga0070715_10030460
596 Ga0070716_100019587
597 Ga0070716_100038350
598 Ga0070716_100230921
599 Ga0070712_100015717
600 Ga0070712_100048077
601 Ga0070712_100051615
602 Ga0070712_100056706
603 Ga0070712_100123110
604 Ga0070712_100173687
605 Ga0070712_100515865
606 Ga0075428_100450579
607 Ga0075430_100086719
608 Ga0075431_100128305
609 Ga0075433_10099141
610 Ga0075433_10341130
611 Ga0075434_100123598
612 Ga0075434_100385429
613 Ga0075429_100095444
614 Ga0068865_100104363
615 Ga0075436_100046438
616 Ga0075436_100151309
617 Ga0075435_100086655
618 Ga0075435_100280499
619 Ga0099794_10013354
620 Ga0099795_10007038
621 Ga0099795_10081160
622 Ga0111539_10128960
623 Ga0111539_10174595
624 Ga0111539_10320383
625 Ga0111539_10476604
626 Ga0111539_10491473
627 Ga0105245_10139297
628 Ga0114129_10189660
629 Ga0105243_10373585
630 Ga0105242_10051762
631 Ga0105249_10074762
632 Ga0105249_10076398
633 Ga0105249_10221772
634 Ga0099796_10017427
635 Ga0099796_10035433
636 Ga0105239_10190900
637 Ga0105246_10148717
638 Ga0157374_10081301
639 Ga0163162_10023570
640 Ga0163162_10334692
641 Ga0157375_10414633
642 Ga0157375_10606178
643 Ga0163163_10153708
644 Ga0157377_10279587
645 Ga0163161_10163879
646 Ga0213874_10003893
647 Ga0213874_10049521
648 Ga0213875_10009320
649 Ga0213871_10035105
650 Ga0228598_1005021
651 Ga0207697_10019608
652 Ga0207656_10020345
653 Ga0207692_10028161
654 Ga0207692_10085575
655 Ga0207692_10092294
656 Ga0207692_10126853
657 Ga0207642_10019588
658 Ga0207688_10013315
659 Ga0207680_10146442
660 Ga0207685_10010940
661 Ga0207685_10011581
662 Ga0207685_10076523
663 Ga0207699_10037105
664 Ga0207699_10042339
665 Ga0207699_10046369
666 Ga0207699_10054696
667 Ga0207699_10125991
668 Ga0207699_10163915
669 Ga0207699_10230703
670 Ga0207684_10074823
671 Ga0207684_10078590
672 Ga0207693_10033030
673 Ga0207693_10046130
674 Ga0207693_10062879
675 Ga0207693_10106123
676 Ga0207693_10182972
677 Ga0207663_10039125
678 Ga0207663_10043682
679 Ga0207663_10104997
680 Ga0207663_10183837
681 Ga0207657_10273053
682 Ga0207649_10125826
683 Ga0207646_10095769
684 Ga0207681_10072295
685 Ga0207659_10067715
686 Ga0207659_10380844
687 Ga0207700_10060951
688 Ga0207700_10064535
689 Ga0207700_10377990
690 Ga0207664_10046332
691 Ga0207664_10078520
692 Ga0207664_10079698
693 Ga0207664_10109051
694 Ga0207664_10129648
695 Ga0207690_10046084
696 Ga0207706_10078796
697 Ga0207686_10247686
698 Ga0207704_10209224
699 Ga0207665_10133033
700 Ga0207665_10157809
701 Ga0207689_10081093
702 Ga0207661_10083976
703 Ga0207679_10253881
704 Ga0207651_10339545
705 Ga0207712_10046253
706 Ga0207712_10061023
707 Ga0207712_10295888
708 Ga0207668_10058567
709 Ga0207668_10579399
710 Ga0207640_10188798
711 Ga0207640_10313202
712 Ga0207677_10189791
713 Ga0207678_10151824
714 Ga0207678_10474075
715 Ga0207708_10051252
716 Ga0207648_10040041
717 Ga0207676_10201364
718 Ga0207674_10240727
719 Ga0207675_100384644
720 Ga0207675_100534171
721 Ga0207698_10226055
722 Ga0209588_1002087
723 Ga0207428_10046925
724 Ga0207428_10062933
725 Ga0207428_10076876
726 Ga0207428_10078576
727 Ga0207428_10286463
728 Ga0207428_10372322
729 Ga0268266_10307721
730 Ga0268265_10070362
731 Ga0316575_10110695
732 Ga0316579_10043286
733 Ga0316576_10049400
734 Ga0316578_10030296
735 Ga0316578_10037494
736 Ga0316577_10031224
737 Ga0316577_10244883
738 Ga0307413_10047100
739 Ga0307410_10044529
740 Ga0307407_10048188
741 Ga0307409_100060627
742 Ga0307414_10057459
743 Ga0307415_100031722
744 Ga0316583_10064018
745 Ga0316585_10013520
746 Ga0316585_10035780
747 Ga0316596_1020277
748 Ga0373930_0004614
749 Ga0373948_0004897
750 Ga0373948_0015012
751 Ga0373950_0001499
752 Ga0373958_0001772
753 Ga0373959_0001615
754 Ga0373959_0032992
755 Ga0373938_0002473
756 Ga0373926_0013387
757 Ga0373926_0014496
758 Ga0373928_0003779
759 Ga0373934_0014339
760 Ga0373949_0005653
761 Ga0373951_0007361
762 Ga0373951_0021942
763 Ga0373952_0003991
764 Ga0373923_0020848
765 Ga0373923_0022749
766 Ga0373932_0005767
767 Ga0373932_0006431
768 Ga0373936_0017179
769 Ga0373936_0018100
770 Ga0373936_0018973
771 Ga0373939_0008812
772 Ga0373941_0007011
773 Ga0373941_0112536
774 Ga0373945_0012163
775 Ga0373945_0012392
776 Ga0373953_0012244
777 Ga0373954_0019650
778 Ga0373956_0017174
779 Ga0373956_0021652
780 Ga0373957_0014381
781 Ga0373960_0006439
782 Ga0373960_0008341
783 Ga0373943_0020094
784 Ga0373943_0022284
785 Ga0373943_0024228
786 Ga0373943_0026580
787 Ga0373946_0013278
788 Ga0373946_0042564
789 Ga0373955_0033108
790 Ga0373942_0006345
791 Ga0373942_0008651
792 Ga0373961_0006778
793 Ga0373962_0007308
794 Ga0316574_0018973
795 Ga0316574_0033599
796 Ga0316574_0054497
797 Ga0316574_0128874
798 Ga0316574_0188482
799 Ga0373924_0016116
800 Ga0373931_0012476
801 Ga0373931_0031254
802 Ga0373931_0033894
803 Ga0373931_0213073
804 Ga0373935_0040084
805 Ga0373927_0032882
806 Ga0373927_0033715
807 Ga0373927_0051055
808 Ga0373927_0053347
809 Ga0373927_0081102
810 Ga0373933_0027258
811 Ga0373933_0177876
812 Ga0373933_0206567
813 Ga0373933_0218968
814 Ga0373947_0030057
815 Ga0373947_0041306
816 Ga0373947_0233306
817 Ga0373937_0072584
818 Ga0373937_0364352
819 Ga0316582_0038043
820 Ga0316582_0051582
821 Ga0316582_0071373
822 Ga0316582_0284257
823 Ga0316584_0014317
824 Ga0316584_0040645
825 Ga0316584_0068414
826 Ga0316584_0084686
827 Ga0373925_0025898
828 Ga0373925_0060649
829 Ga0373925_0068000
830 Ga0436364_1071122
831 Ga0242420_002296
832 Ga0436365_0217050
833 Ga0436365_0438810
834 Ga0436360_0192933
835 Ga0436360_0307363
836 Ga0436361_0050209
837 Ga0436361_0990561
838 Ga0436363_0149268
839 Ga0439465_0030382
840 Ga0439442_010704
841 Ga0439445_0013714
842 Ga0439450_016865
843 Ga0439434_0022408
844 Ga0439444_0019771
845 Ga0439464_0046161
846 Ga0439460_0077888
847 Ga0466963_0121015
848 Ga0495592_0053579
849 Ga0495603_0043024
850 Ga0495629_0062197
851 Ga0495638_0025781
852 Ga0495641_0079337
853 Ga0495651_0063626
854 Ga0495650_0019834
855 Ga0495580_0011359
856 Ga0495580_0055875
857 Ga0495580_0227268
858 Ga0495582_0020785
859 Ga0495582_0093775
860 Ga0495639_0022461
861 Ga0495662_0020297
862 Ga0495662_0029756
863 Ga0495664_0037621
864 Ga0495664_0037821
865 Ga0495664_0038250
866 Ga0495584_0011281
867 Ga0495585_0010395
868 Ga0495594_0066801
869 Ga0495606_0062395
870 Ga0495608_0068267
871 Ga0495610_0046385
872 Ga0495618_0041305
873 Ga0495620_0063234
874 Ga0495628_0058679
875 Ga0495628_0062573
876 Ga0495628_0082839
877 Ga0495628_0205184
878 Ga0495630_0061390
879 Ga0495630_0066843
880 Ga0495632_0032284
881 Ga0495666_0155846
882 Ga0495642_0007127
883 Ga0495652_0086293
884 Ga0495652_0143931
885 Ga0495665_0032149
886 Ga0495665_0081999
887 Ga0495640_0056072
888 Ga0495586_0033507
889 Ga0495586_0047180
890 Ga0495587_0038933
891 Ga0495645_0058757
892 Ga0495645_0135581
893 Ga0495667_0053470
894 Ga0495634_0035411
895 Ga0495634_0052258
896 Ga0495634_0057542
897 Ga0495611_0056231
898 Ga0495625_0143284
899 Ga0495635_0170417
900 Ga0495657_0029259
901 Ga0495657_0245720
902 Ga0495599_0038903
903 Ga0495623_0049561
904 Ga0495646_0007215
905 Ga0495646_0049499
906 Ga0495646_0089466
907 Ga0495647_0018482
908 Ga0495647_0031545
909 Ga0495658_0009392
910 Ga0495658_0030600
911 Ga0495658_0033279
912 Ga0495613_0069024
913 Ga0495624_0010792
914 Ga0495624_0032966
915 Ga0495624_0044140
916 Ga0495624_0052617
917 Ga0495671_0117625
918 Ga0495649_0107000
919 Ga0495589_0005577
920 Ga0495600_0198367
921 Ga0495581_0300236
922 Ga0495604_0063274
923 Ga0495674_0023725
924 Ga0495674_0071987
925 Ga0495674_0094517
926 Ga0495674_0199302
927 Ga0495676_0067039
928 Ga0495676_0117029
929 Ga0495680_0069015
930 Ga0495683_0036191
931 Ga0495687_008494
932 Ga0495675_0044043
933 Ga0495681_0053309
934 Ga0495684_0065668
935 Ga0495684_0232573
936 Ga0495593_0025226
937 Ga0495593_0032983
938 Ga0495602_0080722
939 Ga0495602_0368373
940 Ga0495614_0023358
941 Ga0495614_0111578
942 Ga0495626_0014296
943 Ga0495626_0050341
944 Ga0496100_0054062
945 Ga0496101_0064857
946 Ga0496101_0121785
947 Ga0496101_0160747
948 Ga0496101_0203315
949 Ga0496101_0212063
950 Ga0496102_0019346
951 Ga0496103_0068025
952 Ga0496104_0339924
953 Ga0496105_0314421
954 Ga0496106_0115685
955 Ga0496106_0266379
956 Ga0496106_0301557
957 Ga0496107_0025660
958 Ga0496109_0641649
959 Ga0496114_0081687
960 Ga0496114_0085838
961 Ga0496114_0095219
962 Ga0496115_0056442
963 Ga0496115_0078870
964 Ga0496115_0236837
965 Ga0496116_0112250
966 Ga0496116_0200522
967 Ga0496121_0089868
968 Ga0496122_0063348
969 Ga0501039_0110637
970 Ga0501040_0099505
971 Ga0501041_0048662
972 Ga0501042_0180599
973 Ga0501068_0200902
974 Ga0501069_0128938
975 Ga0501070_0265938
976 Ga0501072_0320191
977 Ga0501076_0332477
978 Ga0501077_0049022
979 Ga0501077_0157540
980 Ga0501079_0074701
981 Ga0501081_0260334
982 Ga0501083_0233949
983 Ga0501045_0315293
984 nmdc:mga05p37_74917_c1
985 nmdc:mga09592_21837_c1
986 nmdc:mga0qj67_24585_c1
987 nmdc:mga06r32_68744_c1
988 nmdc:mga08y16_117528_c1
989 nmdc:mga08y16_133300_c1
990 nmdc:mga08y16_147508_c1
991 nmdc:mga08y16_153564_c1
992 nmdc:mga08y16_296182_c1
993 nmdc:mga08y16_40746_c1
994 nmdc:mga0n895_182423_c1
995 nmdc:mga0n895_238426_c1
996 nmdc:mga0rr50_20271_c1
997 nmdc:mga0rr50_218059_c1
998 nmdc:mga08x19_32325_c1
999 nmdc:mga08x19_56790_c1
1000 nmdc:mga0a205_215_c1
1001 Ga0495601_0032408
1002 Ga0495619_0047471
1003 Ga0500582_004679
1004 Ga0500568_0013582
1005 Ga0501082_0108323
1006 Ga0530510_0292346
1007 2509142644
1008 2514592669
1009 2516204258
1010 2516206323
1011 2516206480
1012 2516207224
1013 2516207248
1014 2516208032
1015 2516208501
1016 2517566716
1017 2524452614
1018 2524453243
1019 2551715632
1020 2600194261
1021 2644151000
1022 2644332250
1023 2644540051
1024 2776264775
1025 2838081277
1026 2844170241
1027 2920825036
1028 2937843889
1029 642424952
1030 642427011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00589

Phage_integrase

Phage integrase family

105

263

0.98

PF13495

Phage_int_SAM_4

Phage integrase, N-terminal SAM-like domain

9

89

0.98

PF04986

Y2_Tnp

Putative transposase

244

292

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dor-assembly2.cif.gz_C p2 integrase catalytic domain in space group p21 0.7781 109 274
5dor-assembly1.cif.gz_B p2 integrase catalytic domain in space group p21 0.7755 110 274
5c6k-assembly1.cif.gz_B bacteriophage p2 integrase catalytic domain 0.7741 109 274
5dor-assembly1.cif.gz_A p2 integrase catalytic domain in space group p21 0.7691 109 274
5c6k-assembly1.cif.gz_A bacteriophage p2 integrase catalytic domain 0.768 109 274
ID Description Score Start End Superfamily
4a8eA02 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.8346 102 283 1.10.443.10
af_P0ADH5_4_190_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.8238 110 282 1.10.443.10
af_Q2FY74_109_289_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.8205 109 282 1.10.443.10
af_Q57813_28_119_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.807 13 96 1.10.150.130
4a8eA02 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.8001 102 283 1.10.443.10
ID Description Score Start End GO Terms
AF-A0A7L8AXS9-F1-model_v4 deleted 0.9416 1 107
AF-A0A0F7PLU9-F1-model_v4 Phage integrase, N-terminal SAM-like domain 0.9343 1 107 GO:0003677
GO:0015074
AF-A0A011QEH0-F1-model_v4 Integrase SAM-like N-terminal domain-containing protein 0.9229 1 110 GO:0003677
GO:0015074
AF-A0A011QEH0-F1-model_v4 Integrase SAM-like N-terminal domain-containing protein 0.9148 1 110 GO:0003677
GO:0015074
AF-A0A7U6H0U3-F1-model_v4 deleted 0.908 119 241

Map