F457661

General Info

Members Datasets Scaffolds Average Seq Length
514 254 513 348

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10002597|JGI25406J46586_100025973
Length 372
Sequence MSEPYVLPFAGVGRQDVGVAGGKGASLGELCRAGIRVPPGFVVTTAAFRDVAERLPDGGARAVEKRIAALDPDDHTTVAAVTASVRDLFTSAPLPQPLETAIRDGYAQLSERGLLDRHQGXAGPSPLPVAVRSSATSEDSADASFAGLQDTFLWVRGADDIVEHVRCCWASLYSVESVTYRLRRKLPEEGLAIAVVVQQMVDARCSGVMFTRSPLTGDRSVIVLEASWGLGSAVVGGEVTPDSWVVNKVTGEVLRRTISRKLHRHVADPSGRGVRVEDVPEGLQESPALDDAALRKLVAVGRAVERHYGAPQDIEWAWAAGDDQPFLLQSRPETVWSTRPAPPIATAAANPFDHVLALLSKPGARPGGEAPR

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
166 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
167 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
244 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
245 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
246 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
250 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.19
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 4.47
Rhizosphere 85.6
Stem 0
Stem Tuber 0
Unclassified 8.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_244457 2162886006 Unclassified 1365
2 JGI24752J21851_1001581 3300001976 Bacteria 3065
3 JGI24750J21931_1000603 3300002070 Bacteria 5430
4 JGI24748J21848_1000109 3300002074 Bacteria 17572
5 JGI24749J21850_1001361 3300002076 Bacteria 3462
6 JGI24034J26672_10000060 3300002239 Bacteria 41095
7 JGI24751J29686_10000254 3300002459 Bacteria 20892
8 JGI25406J46586_10002597 3300003203 Bacteria 8525
9 JGI25406J46586_10004413 3300003203 Bacteria 6553
10 JGI25406J46586_10006724 3300003203 Bacteria 5283
11 JGI25406J46586_10028320 3300003203 Bacteria 2136
12 Ga0065707_10004111 3300005295 Bacteria 7478
13 Ga0065707_10082048 3300005295 Bacteria 23588
14 Ga0065707_10089827 3300005295 Bacteria 4271
15 Ga0070690_100000477 3300005330 Bacteria 20163
16 Ga0070690_100203541 3300005330 Bacteria 1379
17 Ga0070670_100011691 3300005331 Bacteria 7508
18 Ga0070670_100087270 3300005331 Bacteria 2681
19 Ga0070666_10000069 3300005335 Bacteria 75768
20 Ga0070666_10001463 3300005335 Bacteria 14338
21 Ga0070666_10002062 3300005335 Bacteria 12202
22 Ga0070680_100015948 3300005336 Bacteria 5902
23 Ga0070680_100184497 3300005336 Bacteria 1757
24 Ga0070682_100286919 3300005337 Bacteria 1202
25 Ga0068868_100061832 3300005338 Bacteria 2967
26 Ga0070689_100023946 3300005340 Bacteria 4576
27 Ga0070687_100203618 3300005343 Bacteria 1201
28 Ga0070668_100034582 3300005347 Bacteria 3852
29 Ga0070669_100001464 3300005353 Bacteria 17088
30 Ga0070675_100012163 3300005354 Bacteria 6747
31 Ga0070671_100000201 3300005355 Bacteria 39892
32 Ga0070671_100016940 3300005355 Bacteria 5894
33 Ga0070671_100071614 3300005355 Bacteria 2893
34 Ga0070673_100112519 3300005364 Bacteria 2260
35 Ga0070688_100001347 3300005365 Bacteria 12201
36 Ga0070667_100000564 3300005367 Bacteria 36686
37 Ga0070667_100092108 3300005367 Bacteria 2607
38 Ga0070667_100119544 3300005367 Bacteria 2291
39 Ga0070667_100299667 3300005367 Bacteria 1447
40 Ga0070709_10005771 3300005434 Bacteria 6714
41 Ga0070714_100021134 3300005435 Bacteria 5321
42 Ga0070714_100189668 3300005435 Bacteria 1875
43 Ga0070713_100002972 3300005436 Bacteria 11131
44 Ga0070700_100021039 3300005441 Bacteria 3789
45 Ga0070681_10009287 3300005458 Bacteria 9671
46 Ga0070681_10032878 3300005458 Bacteria 5207
47 Ga0070681_10041478 3300005458 Bacteria 4613
48 Ga0070681_10144445 3300005458 Unclassified 2309
49 Ga0068867_100045567 3300005459 Bacteria 3217
50 Ga0070685_10000036 3300005466 Bacteria 80641
51 Ga0070679_100000605 3300005530 Bacteria 30538
52 Ga0070679_100045793 3300005530 Bacteria 4359
53 Ga0070679_100134978 3300005530 Bacteria 2449
54 Ga0070679_100425217 3300005530 Bacteria 1274
55 Ga0068853_100000732 3300005539 Bacteria 22719
56 Ga0068853_100274902 3300005539 Bacteria 1552
57 Ga0070686_100000045 3300005544 Bacteria 101988
58 Ga0070686_100012129 3300005544 Bacteria 4903
59 Ga0070665_100000042 3300005548 Bacteria 292582
60 Ga0070665_100005884 3300005548 Bacteria 12563
61 Ga0070665_100016476 3300005548 Bacteria 7410
62 Ga0070665_100020320 3300005548 Bacteria 6669
63 Ga0070665_100036879 3300005548 Bacteria 4916
64 Ga0070665_100044467 3300005548 Bacteria 4460
65 Ga0070665_100045147 3300005548 Bacteria 4425
66 Ga0070665_100086382 3300005548 Bacteria 3142
67 Ga0070665_100168514 3300005548 Bacteria 2192
68 Ga0068855_100004606 3300005563 Bacteria 16832
69 Ga0068855_100007206 3300005563 Bacteria 13495
70 Ga0068855_100052307 3300005563 Bacteria 4809
71 Ga0068855_100335078 3300005563 Bacteria 1669
72 Ga0070664_100016596 3300005564 Bacteria 6040
73 Ga0068856_100034668 3300005614 Bacteria 4943
74 Ga0068856_100109271 3300005614 Bacteria 2762
75 Ga0068859_100000238 3300005617 Bacteria 54568
76 Ga0068859_100030049 3300005617 Bacteria 5452
77 Ga0068859_100067629 3300005617 Bacteria 3607
78 Ga0068859_100163749 3300005617 Bacteria 2303
79 Ga0068859_100480597 3300005617 Bacteria 1338
80 Ga0068864_100000503 3300005618 Bacteria 33698
81 Ga0068864_100009265 3300005618 Bacteria 8118
82 Ga0068864_100075105 3300005618 Bacteria 2950
83 Ga0068861_100075441 3300005719 Bacteria 2625
84 Ga0068863_100000158 3300005841 Bacteria 71918
85 Ga0068863_100000955 3300005841 Bacteria 28986
86 Ga0068863_100009831 3300005841 Bacteria 9319
87 Ga0068863_100010199 3300005841 Bacteria 9136
88 Ga0068863_100026755 3300005841 Bacteria 5500
89 Ga0068858_100000659 3300005842 Bacteria 36067
90 Ga0068858_100000661 3300005842 Bacteria 35996
91 Ga0068858_100000746 3300005842 Bacteria 34090
92 Ga0068858_100005184 3300005842 Bacteria 12764
93 Ga0068858_100012153 3300005842 Bacteria 8119
94 Ga0068858_100014775 3300005842 Bacteria 7347
95 Ga0068860_100000182 3300005843 Bacteria 100888
96 Ga0068860_100000475 3300005843 Bacteria 49893
97 Ga0068860_100004120 3300005843 Bacteria 14895
98 Ga0068860_100044017 3300005843 Bacteria 4256
99 Ga0068860_100461597 3300005843 Bacteria 1264
100 Ga0068862_100010842 3300005844 Bacteria 7525
101 Ga0081455_10001456 3300005937 Bacteria 29298
102 Ga0081539_10000028 3300005985 Bacteria 328182
103 Ga0081539_10000123 3300005985 Bacteria 181245
104 Ga0081539_10001877 3300005985 Bacteria 32940
105 Ga0070717_10072724 3300006028 Bacteria 2871
106 Ga0075432_10021275 3300006058 Bacteria 2217
107 Ga0070715_10035074 3300006163 Bacteria 2061
108 Ga0070715_10097583 3300006163 Unclassified 1364
109 Ga0070716_100079989 3300006173 Bacteria 1947
110 Ga0070716_100112458 3300006173 Bacteria 1690
111 Ga0070712_100004776 3300006175 Bacteria 8375
112 Ga0070712_100185810 3300006175 Bacteria 1623
113 Ga0097621_100011674 3300006237 Bacteria 6482
114 Ga0097621_100142325 3300006237 Bacteria 2050
115 Ga0097621_100144413 3300006237 Bacteria 2036
116 Ga0097621_100320425 3300006237 Bacteria 1373
117 Ga0068871_100088479 3300006358 Bacteria 2577
118 Ga0075428_100008172 3300006844 Bacteria 11611
119 Ga0075428_100037841 3300006844 Bacteria 5309
120 Ga0075428_100399279 3300006844 Bacteria 1474
121 Ga0075433_10022222 3300006852 Bacteria 5324
122 Ga0068865_100014609 3300006881 Bacteria 4992
123 Ga0075436_100013945 3300006914 Bacteria 5500
124 Ga0097620_100000238 3300006931 Bacteria 54568
125 Ga0097620_100030047 3300006931 Bacteria 5452
126 Ga0097620_100067623 3300006931 Bacteria 3607
127 Ga0097620_100163754 3300006931 Bacteria 2303
128 Ga0097620_100480615 3300006931 Bacteria 1338
129 Ga0105251_10081524 3300009011 Bacteria 1495
130 Ga0105250_10000014 3300009092 Bacteria 268458
131 Ga0105250_10006683 3300009092 Bacteria 5017
132 Ga0105240_10007240 3300009093 Bacteria 16152
133 Ga0105240_10013104 3300009093 Bacteria 11410
134 Ga0105240_10016706 3300009093 Bacteria 9926
135 Ga0105240_10016790 3300009093 Bacteria 9900
136 Ga0105240_10025594 3300009093 Bacteria 7750
137 Ga0105240_10026583 3300009093 Bacteria 7594
138 Ga0105240_10079534 3300009093 Bacteria 4034
139 Ga0105240_10341923 3300009093 Bacteria 1700
140 Ga0111539_10517130 3300009094 Bacteria 1390
141 Ga0105245_10016500 3300009098 Bacteria 6444
142 Ga0105245_10020195 3300009098 Bacteria 5839
143 Ga0105245_10095718 3300009098 Bacteria 2739
144 Ga0105247_10000157 3300009101 Bacteria 66480
145 Ga0105247_10014370 3300009101 Bacteria 4750
146 Ga0105247_10036486 3300009101 Bacteria 2996
147 Ga0105247_10214336 3300009101 Unclassified 1300
148 Ga0105241_10048142 3300009174 Bacteria 3243
149 Ga0105242_10004933 3300009176 Bacteria 10333
150 Ga0105248_10006277 3300009177 Bacteria 13037
151 Ga0105248_10007964 3300009177 Bacteria 11650
152 Ga0105248_10018831 3300009177 Bacteria 7635
153 Ga0105248_10072143 3300009177 Bacteria 3880
154 Ga0105248_10236408 3300009177 Unclassified 2057
155 Ga0105237_10027260 3300009545 Bacteria 5834
156 Ga0105237_10031000 3300009545 Bacteria 5423
157 Ga0105237_10057995 3300009545 Bacteria 3875
158 Ga0105237_10225321 3300009545 Unclassified 1875
159 Ga0105237_10369160 3300009545 Unclassified 1440
160 Ga0105238_10003749 3300009551 Bacteria 15100
161 Ga0105238_10045883 3300009551 Bacteria 4414
162 Ga0105238_10070624 3300009551 Bacteria 3491
163 Ga0105249_10000012 3300009553 Bacteria 292640
164 Ga0105249_10005825 3300009553 Bacteria 10661
165 Ga0105249_10015437 3300009553 Bacteria 6760
166 Ga0105249_10022215 3300009553 Bacteria 5682
167 Ga0105249_10046698 3300009553 Bacteria 3942
168 Ga0105249_10161564 3300009553 Bacteria 2165
169 Ga0099796_10002150 3300010159 Bacteria 4246
170 Ga0105239_10160926 3300010375 Bacteria 2508
171 Ga0157370_10002168 3300013104 Bacteria 23945
172 Ga0157370_10266187 3300013104 Bacteria 1584
173 Ga0157369_10004809 3300013105 Bacteria 15866
174 Ga0157369_10046339 3300013105 Bacteria 4725
175 Ga0157369_10222108 3300013105 Bacteria 1977
176 Ga0157369_10251005 3300013105 Bacteria 1846
177 Ga0157374_10077160 3300013296 Bacteria 3152
178 Ga0157378_10024457 3300013297 Bacteria 5315
179 Ga0157378_10031027 3300013297 Bacteria 4720
180 Ga0163162_10022475 3300013306 Bacteria 6214
181 Ga0163162_10044469 3300013306 Bacteria 4448
182 Ga0163162_10051957 3300013306 Bacteria 4114
183 Ga0157372_10088786 3300013307 Bacteria 3510
184 Ga0157372_10216573 3300013307 Bacteria 2219
185 Ga0157372_10329082 3300013307 Bacteria 1779
186 Ga0157375_10002928 3300013308 Bacteria 14809
187 Ga0163163_10008759 3300014325 Bacteria 9004
188 Ga0163163_10045680 3300014325 Bacteria 4300
189 Ga0163163_10098096 3300014325 Bacteria 2951
190 Ga0163163_10498829 3300014325 Bacteria 1279
191 Ga0157380_10008495 3300014326 Bacteria 7336
192 Ga0157380_10023951 3300014326 Bacteria 4613
193 Ga0157380_10030055 3300014326 Bacteria 4157
194 Ga0157379_10000278 3300014968 Bacteria 40420
195 Ga0157379_10000899 3300014968 Bacteria 24055
196 Ga0157379_10001605 3300014968 Bacteria 18651
197 Ga0157379_10013393 3300014968 Bacteria 7183
198 Ga0157379_10051310 3300014968 Bacteria 3685
199 Ga0157376_10000910 3300014969 Bacteria 19232
200 Ga0163161_10000387 3300017792 Bacteria 36952
201 Ga0213876_10049154 3300021384 Bacteria 2228
202 Ga0213876_10058219 3300021384 Bacteria 2040
203 Ga0207672_1001259 3300025223 Bacteria 2128
204 Ga0207696_1000087 3300025711 Bacteria 194367
205 Ga0207710_10000211 3300025900 Bacteria 52161
206 Ga0207710_10077019 3300025900 Unclassified 1540
207 Ga0207680_10000012 3300025903 Bacteria 293810
208 Ga0207680_10006833 3300025903 Bacteria 5538
209 Ga0207685_10107226 3300025905 Bacteria 1205
210 Ga0207699_10016844 3300025906 Bacteria 3833
211 Ga0207699_10133925 3300025906 Unclassified 1620
212 Ga0207707_10000052 3300025912 Bacteria 117200
213 Ga0207707_10032766 3300025912 Bacteria 4548
214 Ga0207707_10033352 3300025912 Bacteria 4506
215 Ga0207707_10037879 3300025912 Bacteria 4213
216 Ga0207707_10080800 3300025912 Bacteria 2838
217 Ga0207695_10004526 3300025913 Bacteria 18921
218 Ga0207695_10022830 3300025913 Bacteria 7088
219 Ga0207695_10059994 3300025913 Bacteria 3941
220 Ga0207695_10240216 3300025913 Bacteria 1713
221 Ga0207695_10384790 3300025913 Bacteria 1288
222 Ga0207695_10427513 3300025913 Bacteria 1208
223 Ga0207671_10054293 3300025914 Bacteria 2969
224 Ga0207671_10231843 3300025914 Unclassified 1448
225 Ga0207671_10233706 3300025914 Bacteria 1443
226 Ga0207693_10000068 3300025915 Bacteria 91004
227 Ga0207693_10023094 3300025915 Bacteria 4939
228 Ga0207693_10225008 3300025915 Bacteria 1474
229 Ga0207660_10030573 3300025917 Bacteria 3703
230 Ga0207660_10254264 3300025917 Bacteria 1387
231 Ga0207649_10156095 3300025920 Bacteria 1577
232 Ga0207652_10001360 3300025921 Bacteria 21746
233 Ga0207652_10038665 3300025921 Bacteria 4047
234 Ga0207652_10091589 3300025921 Bacteria 2674
235 Ga0207652_10221606 3300025921 Bacteria 1704
236 Ga0207652_10234212 3300025921 Bacteria 1655
237 Ga0207681_10000789 3300025923 Bacteria 20864
238 Ga0207681_10127922 3300025923 Bacteria 1874
239 Ga0207694_10008773 3300025924 Bacteria 7627
240 Ga0207694_10116818 3300025924 Bacteria 2126
241 Ga0207650_10000008 3300025925 Bacteria 498534
242 Ga0207650_10024429 3300025925 Bacteria 4296
243 Ga0207659_10135993 3300025926 Unclassified 1902
244 Ga0207700_10013028 3300025928 Bacteria 5392
245 Ga0207644_10000984 3300025931 Bacteria 18201
246 Ga0207644_10144561 3300025931 Bacteria 1835
247 Ga0207670_10052029 3300025936 Unclassified 2753
248 Ga0207665_10089478 3300025939 Bacteria 2132
249 Ga0207665_10204176 3300025939 Bacteria 1441
250 Ga0207691_10003462 3300025940 Bacteria 15357
251 Ga0207711_10003442 3300025941 Bacteria 13693
252 Ga0207711_10003727 3300025941 Bacteria 13139
253 Ga0207711_10005222 3300025941 Bacteria 11005
254 Ga0207711_10007110 3300025941 Bacteria 9379
255 Ga0207711_10027393 3300025941 Bacteria 4786
256 Ga0207711_10086955 3300025941 Bacteria 2741
257 Ga0207667_10001737 3300025949 Bacteria 27400
258 Ga0207667_10002121 3300025949 Bacteria 24834
259 Ga0207667_10034818 3300025949 Bacteria 5404
260 Ga0207667_10175326 3300025949 Bacteria 2203
261 Ga0207667_10221218 3300025949 Bacteria 1940
262 Ga0207712_10000021 3300025961 Bacteria 292649
263 Ga0207712_10025287 3300025961 Bacteria 3944
264 Ga0207712_10085307 3300025961 Bacteria 2310
265 Ga0207712_10104402 3300025961 Bacteria 2113
266 Ga0207668_10003767 3300025972 Bacteria 8931
267 Ga0207658_10000826 3300025986 Bacteria 25872
268 Ga0207658_10001537 3300025986 Bacteria 17899
269 Ga0207658_10072920 3300025986 Bacteria 2604
270 Ga0207658_10191464 3300025986 Bacteria 1700
271 Ga0207703_10000598 3300026035 Bacteria 36651
272 Ga0207703_10000835 3300026035 Bacteria 30300
273 Ga0207703_10003208 3300026035 Bacteria 13760
274 Ga0207703_10004010 3300026035 Bacteria 12189
275 Ga0207703_10005491 3300026035 Bacteria 10191
276 Ga0207703_10006054 3300026035 Bacteria 9674
277 Ga0207639_10003079 3300026041 Bacteria 11204
278 Ga0207639_10263549 3300026041 Bacteria 1508
279 Ga0207708_10007487 3300026075 Bacteria 8070
280 Ga0207702_10123805 3300026078 Bacteria 2318
281 Ga0207641_10000410 3300026088 Bacteria 50167
282 Ga0207641_10000687 3300026088 Bacteria 36473
283 Ga0207641_10001145 3300026088 Bacteria 26648
284 Ga0207648_10104394 3300026089 Bacteria 2485
285 Ga0207676_10001060 3300026095 Bacteria 20944
286 Ga0207676_10005223 3300026095 Bacteria 9193
287 Ga0207676_10120313 3300026095 Unclassified 2213
288 Ga0207675_100014279 3300026118 Bacteria 7402
289 Ga0207675_100016593 3300026118 Bacteria 6878
290 Ga0207675_100040576 3300026118 Bacteria 4347
291 Ga0207675_100043825 3300026118 Bacteria 4179
292 Ga0207683_10004921 3300026121 Bacteria 11492
293 Ga0268266_10000054 3300028379 Bacteria 292717
294 Ga0268266_10001861 3300028379 Bacteria 23842
295 Ga0268266_10013408 3300028379 Bacteria 7059
296 Ga0268266_10020712 3300028379 Bacteria 5605
297 Ga0268266_10043416 3300028379 Bacteria 3842
298 Ga0268266_10388307 3300028379 Bacteria 1318
299 Ga0268265_10000278 3300028380 Bacteria 58293
300 Ga0268265_10001366 3300028380 Bacteria 20776
301 Ga0268264_10000452 3300028381 Bacteria 56001
302 Ga0268264_10000764 3300028381 Bacteria 35781
303 Ga0268264_10132305 3300028381 Unclassified 2213
304 Ga0268264_10244470 3300028381 Bacteria 1664
305 Ga0265319_1013175 3300028563 Bacteria 3303
306 Ga0265318_10019126 3300028577 Bacteria 2781
307 Ga0307515_10042996 3300028794 Bacteria 7042
308 Ga0265338_10023510 3300028800 Bacteria 6333
309 Ga0265338_10036900 3300028800 Bacteria 4665
310 Ga0307511_10000052 3300030521 Bacteria 96724
311 Ga0265762_1000082 3300030760 Bacteria 12686
312 Ga0265320_10001142 3300031240 Bacteria 19529
313 Ga0265320_10088522 3300031240 Bacteria 1436
314 Ga0265325_10046329 3300031241 Bacteria 2256
315 Ga0265340_10050925 3300031247 Bacteria 2007
316 Ga0265339_10027547 3300031249 Bacteria 3242
317 Ga0307513_10100182 3300031456 Bacteria 2923
318 Ga0307509_10000030 3300031507 Bacteria 206541
319 Ga0307509_10000038 3300031507 Bacteria 188458
320 Ga0307408_100107788 3300031548 Bacteria 2134
321 Ga0265314_10001476 3300031711 Bacteria 26149
322 Ga0265314_10016642 3300031711 Bacteria 5799
323 Ga0265342_10223072 3300031712 Bacteria 1015
324 Ga0316576_10064543 3300031727 Bacteria 2690
325 Ga0307516_10297726 3300031730 Bacteria 1290
326 Ga0307410_10008996 3300031852 Bacteria 5575
327 Ga0307406_10025159 3300031901 Bacteria 3562
328 Ga0307412_10009432 3300031911 Bacteria 5601
329 Ga0307409_100017022 3300031995 Bacteria 4831
330 Ga0307416_100030796 3300032002 Bacteria 4030
331 Ga0307411_10075443 3300032005 Bacteria 2302
332 Ga0307415_100049989 3300032126 Bacteria 2830
333 Ga0307510_10000001 3300033180 Bacteria 1172244
334 Ga0307510_10039625 3300033180 Bacteria 5187
335 Ga0373936_0003657 3300035113 Bacteria 5771
336 Ga0373939_0003891 3300035114 Bacteria 3514
337 Ga0373956_0108432 3300035119 Bacteria 1291
338 Ga0373955_0023147 3300035172 Bacteria 3161
339 Ga0373924_0086719 3300035410 Unclassified 1336
340 Ga0373927_0004671 3300035695 Bacteria 9549
341 Ga0373937_0042746 3300036401 Bacteria 4134
342 Ga0373937_0071450 3300036401 Bacteria 3201
343 Ga0373937_0151201 3300036401 Bacteria 2174
344 Ga0373937_0209312 3300036401 Bacteria 1835
345 Ga0373937_0291747 3300036401 Unclassified 1541
346 Ga0373925_0132890 3300037068 Bacteria 1942
347 Ga0373925_0296847 3300037068 Unclassified 1304
348 Ga0395899_0056083 3300037312 Bacteria 2913
349 Ga0395898_0002975 3300037466 Bacteria 19261
350 Ga0436364_1543409 3300037853 Bacteria 1941
351 Ga0395901_0023745 3300038443 Bacteria 6287
352 Ga0395901_0099439 3300038443 Bacteria 3050
353 Ga0436365_0663773 3300039437 Unclassified 1917
354 Ga0436365_0704614 3300039437 Bacteria 2674
355 Ga0436365_1314214 3300039437 Bacteria 2592
356 Ga0436365_1532621 3300039437 Bacteria 4878
357 Ga0439436_0006197 3300041404 Bacteria 3671
358 Ga0439439_0006671 3300041406 Bacteria 2674
359 Ga0439457_000901 3300042014 Bacteria 8970
360 Ga0466969_0002840 3300044656 Bacteria 9267
361 Ga0466969_0062200 3300044656 Bacteria 1812
362 Ga0466961_0098368 3300044693 Bacteria 1844
363 Ga0466963_0182896 3300044694 Bacteria 1464
364 Ga0466964_0006235 3300044706 Bacteria 4444
365 Ga0466964_0028375 3300044706 Bacteria 2205
366 Ga0466971_0039341 3300044719 Unclassified 2122
367 Ga0466957_0047879 3300044842 Bacteria 2598
368 Ga0466960_0022492 3300044901 Bacteria 2819
369 Ga0466960_0040119 3300044901 Bacteria 2212
370 Ga0466959_0033955 3300045049 Bacteria 3774
371 Ga0466959_0171424 3300045049 Bacteria 1522
372 Ga0466967_0089650 3300045976 Bacteria 2792
373 Ga0495592_0037734 3300046454 Bacteria 3637
374 Ga0495590_0022124 3300046457 Bacteria 2250
375 Ga0495629_0025064 3300046459 Bacteria 4242
376 Ga0495651_0139927 3300046462 Bacteria 1756
377 Ga0495653_0020380 3300046463 Bacteria 5377
378 Ga0495653_0124380 3300046463 Bacteria 1833
379 Ga0495580_0005250 3300046472 Bacteria 10764
380 Ga0495616_0007532 3300046513 Bacteria 6516
381 Ga0495628_0046335 3300046516 Bacteria 3454
382 Ga0495643_0060219 3300046522 Bacteria 2016
383 Ga0495652_0030687 3300046529 Bacteria 4711
384 Ga0495587_0063438 3300046536 Bacteria 2161
385 Ga0495645_0139249 3300046543 Unclassified 1694
386 Ga0495667_0006844 3300046559 Bacteria 7739
387 Ga0495625_0065419 3300046660 Bacteria 2563
388 Ga0495623_0077532 3300046679 Bacteria 2060
389 Ga0495604_0147679 3300047317 Bacteria 1674
390 Ga0495674_0065988 3300047319 Bacteria 3142
391 Ga0495680_0026972 3300047322 Bacteria 4727
392 Ga0495680_0032363 3300047322 Bacteria 4246
393 Ga0495680_0316517 3300047322 Bacteria 1093
394 Ga0495675_0112324 3300047444 Bacteria 1700
395 Ga0495602_0038639 3300048088 Bacteria 4410
396 Ga0495602_0107670 3300048088 Bacteria 2271
397 Ga0496100_0029273 3300048903 Bacteria 3404
398 Ga0496100_0042337 3300048903 Bacteria 2909
399 Ga0496101_0005953 3300048904 Bacteria 7814
400 Ga0496102_0004550 3300048905 Bacteria 11721
401 Ga0496102_0148953 3300048905 Bacteria 2198
402 Ga0496102_0169615 3300048905 Bacteria 2054
403 Ga0496103_0010364 3300048906 Bacteria 5515
404 Ga0496104_0008673 3300048907 Bacteria 9042
405 Ga0496104_0033716 3300048907 Bacteria 4771
406 Ga0496104_0071784 3300048907 Bacteria 3291
407 Ga0496105_0003391 3300048908 Bacteria 11779
408 Ga0496105_0021391 3300048908 Bacteria 5234
409 Ga0496108_0004690 3300048911 Bacteria 11020
410 Ga0496108_0103155 3300048911 Bacteria 2433
411 Ga0496108_0455658 3300048911 Unclassified 1117
412 Ga0496109_0003527 3300048912 Bacteria 13056
413 Ga0496109_0028915 3300048912 Bacteria 4962
414 Ga0496109_0173442 3300048912 Bacteria 2024
415 Ga0496110_0005766 3300048913 Bacteria 9729
416 Ga0496110_0057114 3300048913 Bacteria 3435
417 Ga0496111_0019835 3300048914 Bacteria 4675
418 Ga0496111_0133567 3300048914 Bacteria 1837
419 Ga0496113_0048558 3300048916 Bacteria 3158
420 Ga0496116_0016159 3300048919 Bacteria 5858
421 Ga0496116_0054658 3300048919 Bacteria 2628
422 Ga0496117_0000102 3300048920 Bacteria 189959
423 Ga0496117_0000243 3300048920 Bacteria 103093
424 Ga0496117_0063369 3300048920 Bacteria 2527
425 Ga0496118_0000038 3300048921 Bacteria 315464
426 Ga0496118_0000064 3300048921 Bacteria 212626
427 Ga0496118_0038217 3300048921 Bacteria 3850
428 Ga0496118_0041037 3300048921 Bacteria 3670
429 Ga0496118_0159783 3300048921 Bacteria 1395
430 Ga0496119_0012169 3300048922 Bacteria 7020
431 Ga0496119_0026733 3300048922 Bacteria 3991
432 Ga0496119_0027381 3300048922 Bacteria 3918
433 Ga0496119_0027952 3300048922 Bacteria 3863
434 Ga0496120_0007792 3300048923 Bacteria 7909
435 Ga0496121_0000009 3300048924 Bacteria 836971
436 Ga0496121_0001266 3300048924 Bacteria 43597
437 Ga0496121_0116197 3300048924 Bacteria 2030
438 Ga0496121_0180687 3300048924 Bacteria 1523
439 Ga0496124_0011497 3300048927 Bacteria 8840
440 Ga0496125_0001517 3300048928 Bacteria 33276
441 Ga0496125_0005299 3300048928 Bacteria 14426
442 Ga0496125_0028238 3300048928 Bacteria 5073
443 Ga0496125_0062327 3300048928 Bacteria 2983
444 Ga0496126_0001431 3300048929 Bacteria 37495
445 Ga0496126_0017620 3300048929 Bacteria 7115
446 Ga0496126_0285087 3300048929 Unclassified 1367
447 Ga0501033_0015436 3300049570 Bacteria 5795
448 Ga0501036_0009960 3300049572 Bacteria 7827
449 Ga0501038_0009562 3300049574 Bacteria 8894
450 Ga0501038_0057938 3300049574 Bacteria 3324
451 Ga0501039_0004427 3300049575 Bacteria 10605
452 Ga0501039_0047346 3300049575 Bacteria 3323
453 Ga0501039_0138858 3300049575 Bacteria 1908
454 Ga0501040_0000385 3300049576 Bacteria 25982
455 Ga0501040_0000935 3300049576 Bacteria 18371
456 Ga0501040_0036964 3300049576 Bacteria 3315
457 Ga0501041_0000783 3300049577 Bacteria 17044
458 Ga0501041_0053709 3300049577 Bacteria 2457
459 Ga0501042_0006031 3300049578 Bacteria 7846
460 Ga0501042_0013005 3300049578 Bacteria 5655
461 Ga0501042_0060233 3300049578 Bacteria 2711
462 Ga0501043_0095034 3300049579 Bacteria 2343
463 Ga0501046_0005749 3300049580 Bacteria 11068
464 Ga0501048_0011210 3300049582 Bacteria 6682
465 Ga0501048_0026240 3300049582 Bacteria 4242
466 Ga0501068_0014136 3300049584 Bacteria 4558
467 Ga0501070_0350509 3300049586 Bacteria 1198
468 Ga0501071_0000011 3300049587 Bacteria 63363
469 Ga0501071_0003323 3300049587 Bacteria 10045
470 Ga0501071_0026836 3300049587 Bacteria 4046
471 Ga0501072_0000640 3300049588 Bacteria 25105
472 Ga0501072_0007087 3300049588 Bacteria 8509
473 Ga0501072_0008703 3300049588 Bacteria 7705
474 Ga0501074_0013146 3300049590 Bacteria 6020
475 Ga0501075_0000086 3300049591 Bacteria 42180
476 Ga0501075_0013981 3300049591 Bacteria 5744
477 Ga0501075_0058277 3300049591 Bacteria 2908
478 Ga0501075_0071879 3300049591 Bacteria 2615
479 Ga0501076_0000277 3300049592 Bacteria 31910
480 Ga0501076_0006663 3300049592 Bacteria 8378
481 Ga0501076_0033975 3300049592 Bacteria 3983
482 Ga0501077_0002412 3300049593 Bacteria 11223
483 Ga0501077_0052145 3300049593 Bacteria 2598
484 Ga0501079_0000209 3300049741 Bacteria 34318
485 Ga0501080_0007768 3300049742 Bacteria 9696
486 Ga0501081_0001058 3300049743 Bacteria 16514
487 Ga0501081_0194491 3300049743 Bacteria 1469
488 Ga0501083_0013635 3300049744 Bacteria 5683
489 Ga0501083_0100217 3300049744 Bacteria 1910
490 Ga0501035_0045820 3300049822 Bacteria 3934
491 Ga0501035_0079672 3300049822 Bacteria 2893
492 Ga0501045_0000055 3300049824 Bacteria 51250
493 Ga0501045_0052740 3300049824 Bacteria 2970
494 Ga0501045_0149932 3300049824 Bacteria 1735
495 nmdc:mga08y16_365800_c1 3300050511 Bacteria 1480
496 Ga0495619_0021174 3300053085 Bacteria 4149
497 Ga0495619_0062923 3300053085 Bacteria 2471
498 Ga0500583_0017966 3300053092 Bacteria 2864
499 Ga0500556_0060132 3300053104 Bacteria 1398
500 Ga0500608_067126 3300053122 Bacteria 1709
501 Ga0500588_0005597 3300053146 Bacteria 2799
502 Ga0500588_0052154 3300053146 Bacteria 1279
503 Ga0500616_0000011 3300053153 Bacteria 732880
504 Ga0500622_0003625 3300053156 Bacteria 10146
505 Ga0500637_0028948 3300053178 Bacteria 3069
506 Ga0500645_005378 3300053730 Bacteria 4727
507 Ga0501084_0008126 3300054114 Bacteria 8645
508 Ga0501084_0010556 3300054114 Bacteria 7640
509 Ga0501084_0022271 3300054114 Bacteria 5288
510 Ga0501082_0000298 3300060353 Bacteria 43791
511 Ga0501082_0028612 3300060353 Bacteria 4800
512 Ga0466962_0011940 3300061719 Bacteria 4179
513 Ga0530510_0000228 3300061734 Bacteria 35067

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0350509 Ga0501070_0350509_385_1188 262
2 3300044694 Ga0466963_0182896 Ga0466963_0182896_171_1079 297
3 3300045976 Ga0466967_0089650 Ga0466967_0089650_138_1046 297
4 3300028563 Ga0265319_1013175 Ga0265319_10131752 301
5 3300031240 Ga0265320_10088522 Ga0265320_100885222 301
6 3300031712 Ga0265342_10223072 Ga0265342_102230721 301
7 3300047319 Ga0495674_0065988 Ga0495674_0065988_2128_3063 301
8 3300047322 Ga0495680_0316517 Ga0495680_0316517_58_993 301
9 3300005441 Ga0070700_100021039 Ga0070700_1000210393 311
10 3300005719 Ga0068861_100075441 Ga0068861_1000754412 311
11 3300026075 Ga0207708_10007487 Ga0207708_100074873 311
12 3300026089 Ga0207648_10104394 Ga0207648_101043942 312
13 3300048929 Ga0496126_0001431 Ga0496126_0001431_15641_16705 312
14 3300053156 Ga0500622_0003625 Ga0500622_0003625_9193_10134 312
15 3300046459 Ga0495629_0025064 Ga0495629_0025064_2549_3520 313
16 3300046463 Ga0495653_0020380 Ga0495653_0020380_2204_3175 313
17 3300047322 Ga0495680_0032363 Ga0495680_0032363_2055_3026 313
18 3300053085 Ga0495619_0021174 Ga0495619_0021174_397_1368 313
19 3300009094 Ga0111539_10517130 Ga0111539_105171302 316
20 3300050511 nmdc:mga08y16_365800_c1 nmdc:mga08y16_365800_c1_133_1182 316
21 3300028577 Ga0265318_10019126 Ga0265318_100191262 319
22 3300006163 Ga0070715_10035074 Ga0070715_100350743 320
23 3300025905 Ga0207685_10107226 Ga0207685_101072262 320
24 3300025914 Ga0207671_10231843 Ga0207671_102318432 320
25 3300005354 Ga0070675_100012163 Ga0070675_1000121632 322
26 3300014326 Ga0157380_10023951 Ga0157380_100239514 322
27 3300025926 Ga0207659_10135993 Ga0207659_101359932 322
28 3300009553 Ga0105249_10161564 Ga0105249_101615642 323
29 3300013306 Ga0163162_10044469 Ga0163162_100444693 323
30 3300005548 Ga0070665_100005884 Ga0070665_1000058843 324
31 3300005617 Ga0068859_100480597 Ga0068859_1004805972 324
32 3300006931 Ga0097620_100480615 Ga0097620_1004806152 324
33 3300028379 Ga0268266_10001861 Ga0268266_100018618 324
34 3300009553 Ga0105249_10005825 Ga0105249_100058252 326
35 3300005530 Ga0070679_100134978 Ga0070679_1001349782 328
36 3300025921 Ga0207652_10221606 Ga0207652_102216062 328
37 3300005614 Ga0068856_100109271 Ga0068856_1001092712 329
38 3300005841 Ga0068863_100009831 Ga0068863_1000098316 329
39 3300005843 Ga0068860_100000475 Ga0068860_10000047521 329
40 3300025986 Ga0207658_10191464 Ga0207658_101914642 329
41 3300026078 Ga0207702_10123805 Ga0207702_101238052 329
42 3300026088 Ga0207641_10001145 Ga0207641_100011457 329
43 3300028381 Ga0268264_10000452 Ga0268264_1000045213 329
44 3300048903 Ga0496100_0042337 Ga0496100_0042337_764_1804 329
45 3300005353 Ga0070669_100001464 Ga0070669_10000146412 331
46 3300025923 Ga0207681_10000789 Ga0207681_1000078916 331
47 3300013307 Ga0157372_10216573 Ga0157372_102165732 333
48 3300046516 Ga0495628_0046335 Ga0495628_0046335_2096_3151 333
49 3300005539 Ga0068853_100274902 Ga0068853_1002749022 334
50 3300005530 Ga0070679_100425217 Ga0070679_1004252172 335
51 3300005548 Ga0070665_100036879 Ga0070665_1000368793 335
52 3300013105 Ga0157369_10222108 Ga0157369_102221083 335
53 3300025917 Ga0207660_10254264 Ga0207660_102542642 335
54 3300025921 Ga0207652_10234212 Ga0207652_102342121 335
55 3300028379 Ga0268266_10020712 Ga0268266_100207123 335
56 3300031456 Ga0307513_10100182 Ga0307513_101001823 335
57 3300038443 Ga0395901_0023745 Ga0395901_0023745_1146_2177 335
58 3300044901 Ga0466960_0040119 Ga0466960_0040119_762_1793 335
59 3300002076 JGI24749J21850_1001361 JGI24749J21850_10013613 336
60 3300002459 JGI24751J29686_10000254 JGI24751J29686_1000025416 336
61 3300005331 Ga0070670_100011691 Ga0070670_1000116912 336
62 3300005367 Ga0070667_100092108 Ga0070667_1000921083 336
63 3300005617 Ga0068859_100030049 Ga0068859_1000300493 336
64 3300005618 Ga0068864_100075105 Ga0068864_1000751052 336
65 3300006931 Ga0097620_100030047 Ga0097620_1000300473 336
66 3300009177 Ga0105248_10018831 Ga0105248_100188317 336
67 3300025925 Ga0207650_10000008 Ga0207650_10000008410 336
68 3300025941 Ga0207711_10086955 Ga0207711_100869552 336
69 3300025986 Ga0207658_10072920 Ga0207658_100729203 336
70 3300026095 Ga0207676_10001060 Ga0207676_1000106015 336
71 3300031548 Ga0307408_100107788 Ga0307408_1001077882 336
72 3300031852 Ga0307410_10008996 Ga0307410_100089963 336
73 3300031901 Ga0307406_10025159 Ga0307406_100251593 336
74 3300031995 Ga0307409_100017022 Ga0307409_1000170223 336
75 3300032002 Ga0307416_100030796 Ga0307416_1000307963 336
76 3300032005 Ga0307411_10075443 Ga0307411_100754432 336
77 3300032126 Ga0307415_100049989 Ga0307415_1000499893 336
78 3300005458 Ga0070681_10144445 Ga0070681_101444452 337
79 3300037312 Ga0395899_0056083 Ga0395899_0056083_783_1826 337
80 3300038443 Ga0395901_0099439 Ga0395901_0099439_34_1077 337
81 3300006237 Ga0097621_100144413 Ga0097621_1001444132 338
82 3300006358 Ga0068871_100088479 Ga0068871_1000884791 338
83 3300033180 Ga0307510_10000001 Ga0307510_10000001578 338
84 3300046536 Ga0495587_0063438 Ga0495587_0063438_847_1902 338
85 iso_pu_bacteria 2896253425 2896255827 338
86 3300031249 Ga0265339_10027547 Ga0265339_100275472 340
87 3300035410 Ga0373924_0086719 Ga0373924_0086719_247_1296 340
88 3300036401 Ga0373937_0291747 Ga0373937_0291747_347_1396 340
89 3300044901 Ga0466960_0022492 Ga0466960_0022492_1413_2516 340
90 3300003203 JGI25406J46586_10002597 JGI25406J46586_100025973 341
91 3300005985 Ga0081539_10001877 Ga0081539_1000187725 341
92 3300013105 Ga0157369_10251005 Ga0157369_102510051 341
93 3300021384 Ga0213876_10049154 Ga0213876_100491543 341
94 3300031240 Ga0265320_10001142 Ga0265320_100011422 341
95 3300031241 Ga0265325_10046329 Ga0265325_100463292 341
96 3300039437 Ga0436365_0704614 Ga0436365_0704614_1207_2271 341
97 3300028800 Ga0265338_10036900 Ga0265338_100369003 342
98 3300031711 Ga0265314_10001476 Ga0265314_1000147629 342
99 3300031711 Ga0265314_10016642 Ga0265314_100166424 342
100 3300035114 Ga0373939_0003891 Ga0373939_0003891_61_1122 342
101 3300005563 Ga0068855_100052307 Ga0068855_1000523072 344
102 3300005563 Ga0068855_100335078 Ga0068855_1003350782 344
103 3300006175 Ga0070712_100185810 Ga0070712_1001858102 344
104 3300009093 Ga0105240_10341923 Ga0105240_103419233 344
105 3300021384 Ga0213876_10058219 Ga0213876_100582192 344
106 3300025915 Ga0207693_10225008 Ga0207693_102250082 344
107 3300025928 Ga0207700_10013028 Ga0207700_100130285 344
108 3300025949 Ga0207667_10175326 Ga0207667_101753261 344
109 3300039437 Ga0436365_1532621 Ga0436365_1532621_2145_3188 344
110 3300044656 Ga0466969_0062200 Ga0466969_0062200_95_1135 344
111 3300044706 Ga0466964_0028375 Ga0466964_0028375_434_1513 344
112 3300046457 Ga0495590_0022124 Ga0495590_0022124_935_1969 344
113 3300046513 Ga0495616_0007532 Ga0495616_0007532_4131_5168 344
114 3300046543 Ga0495645_0139249 Ga0495645_0139249_532_1635 344
115 3300046660 Ga0495625_0065419 Ga0495625_0065419_228_1265 344
116 3300003203 JGI25406J46586_10028320 JGI25406J46586_100283202 345
117 3300005985 Ga0081539_10000028 Ga0081539_1000002868 345
118 3300025923 Ga0207681_10127922 Ga0207681_101279222 345
119 3300028794 Ga0307515_10042996 Ga0307515_100429963 345
120 3300035119 Ga0373956_0108432 Ga0373956_0108432_190_1266 345
121 3300036401 Ga0373937_0042746 Ga0373937_0042746_2583_3665 345
122 3300036401 Ga0373937_0151201 Ga0373937_0151201_806_1882 345
123 3300037466 Ga0395898_0002975 Ga0395898_0002975_11372_12418 345
124 3300037853 Ga0436364_1543409 Ga0436364_1543409_704_1789 345
125 3300039437 Ga0436365_1314214 Ga0436365_1314214_584_1669 345
126 3300046454 Ga0495592_0037734 Ga0495592_0037734_1263_2339 345
127 3300046462 Ga0495651_0139927 Ga0495651_0139927_456_1538 345
128 3300046463 Ga0495653_0124380 Ga0495653_0124380_563_1639 345
129 3300046522 Ga0495643_0060219 Ga0495643_0060219_118_1161 345
130 3300046529 Ga0495652_0030687 Ga0495652_0030687_51_1127 345
131 3300046559 Ga0495667_0006844 Ga0495667_0006844_4903_5979 345
132 3300046679 Ga0495623_0077532 Ga0495623_0077532_802_1878 345
133 3300047317 Ga0495604_0147679 Ga0495604_0147679_455_1531 345
134 3300047322 Ga0495680_0026972 Ga0495680_0026972_709_1785 345
135 3300047444 Ga0495675_0112324 Ga0495675_0112324_579_1655 345
136 3300048088 Ga0495602_0038639 Ga0495602_0038639_2422_3504 345
137 3300048088 Ga0495602_0107670 Ga0495602_0107670_578_1654 345
138 3300053085 Ga0495619_0062923 Ga0495619_0062923_619_1695 345
139 3300001976 JGI24752J21851_1001581 JGI24752J21851_10015812 346
140 3300002070 JGI24750J21931_1000603 JGI24750J21931_10006032 346
141 3300002074 JGI24748J21848_1000109 JGI24748J21848_100010915 346
142 3300002239 JGI24034J26672_10000060 JGI24034J26672_1000006040 346
143 3300005295 Ga0065707_10004111 Ga0065707_100041112 346
144 3300005330 Ga0070690_100000477 Ga0070690_10000047724 346
145 3300005335 Ga0070666_10000069 Ga0070666_1000006971 346
146 3300005340 Ga0070689_100023946 Ga0070689_1000239463 346
147 3300005343 Ga0070687_100203618 Ga0070687_1002036181 346
148 3300005347 Ga0070668_100034582 Ga0070668_1000345822 346
149 3300005355 Ga0070671_100071614 Ga0070671_1000716142 346
150 3300005365 Ga0070688_100001347 Ga0070688_1000013478 346
151 3300005367 Ga0070667_100119544 Ga0070667_1001195443 346
152 3300005459 Ga0068867_100045567 Ga0068867_1000455672 346
153 3300005466 Ga0070685_10000036 Ga0070685_100000364 346
154 3300005544 Ga0070686_100000045 Ga0070686_1000000457 346
155 3300005544 Ga0070686_100012129 Ga0070686_1000121292 346
156 3300005548 Ga0070665_100000042 Ga0070665_100000042284 346
157 3300005617 Ga0068859_100067629 Ga0068859_1000676293 346
158 3300005618 Ga0068864_100009265 Ga0068864_1000092655 346
159 3300005841 Ga0068863_100000955 Ga0068863_10000095530 346
160 3300005842 Ga0068858_100000659 Ga0068858_1000006597 346
161 3300005842 Ga0068858_100014775 Ga0068858_1000147753 346
162 3300005843 Ga0068860_100000182 Ga0068860_1000001827 346
163 3300005843 Ga0068860_100461597 Ga0068860_1004615972 346
164 3300005844 Ga0068862_100010842 Ga0068862_1000108422 346
165 3300006931 Ga0097620_100067623 Ga0097620_1000676233 346
166 3300009011 Ga0105251_10081524 Ga0105251_100815242 346
167 3300009101 Ga0105247_10036486 Ga0105247_100364863 346
168 3300009553 Ga0105249_10000012 Ga0105249_100000127 346
169 3300014325 Ga0163163_10098096 Ga0163163_100980962 346
170 3300014326 Ga0157380_10030055 Ga0157380_100300554 346
171 3300014968 Ga0157379_10013393 Ga0157379_100133932 346
172 3300017792 Ga0163161_10000387 Ga0163161_1000038732 346
173 3300025223 Ga0207672_1001259 Ga0207672_10012593 346
174 3300025903 Ga0207680_10000012 Ga0207680_10000012279 346
175 3300025936 Ga0207670_10052029 Ga0207670_100520292 346
176 3300025941 Ga0207711_10007110 Ga0207711_100071107 346
177 3300025941 Ga0207711_10027393 Ga0207711_100273933 346
178 3300025961 Ga0207712_10000021 Ga0207712_10000021279 346
179 3300025972 Ga0207668_10003767 Ga0207668_100037675 346
180 3300025986 Ga0207658_10000826 Ga0207658_1000082629 346
181 3300026035 Ga0207703_10004010 Ga0207703_100040107 346
182 3300026088 Ga0207641_10000410 Ga0207641_100004107 346
183 3300026095 Ga0207676_10005223 Ga0207676_100052233 346
184 3300026118 Ga0207675_100014279 Ga0207675_1000142792 346
185 3300026118 Ga0207675_100016593 Ga0207675_1000165936 346
186 3300028379 Ga0268266_10000054 Ga0268266_10000054278 346
187 3300028380 Ga0268265_10000278 Ga0268265_100002783 346
188 3300028380 Ga0268265_10001366 Ga0268265_1000136616 346
189 3300028381 Ga0268264_10000764 Ga0268264_100007647 346
190 3300028381 Ga0268264_10244470 Ga0268264_102444702 346
191 3300031727 Ga0316576_10064543 Ga0316576_100645431 346
192 3300031911 Ga0307412_10009432 Ga0307412_100094324 346
193 3300048906 Ga0496103_0010364 Ga0496103_0010364_2620_3660 346
194 3300048912 Ga0496109_0173442 Ga0496109_0173442_751_1791 346
195 3300048920 Ga0496117_0063369 Ga0496117_0063369_483_1523 346
196 3300048921 Ga0496118_0159783 Ga0496118_0159783_132_1172 346
197 3300048922 Ga0496119_0027952 Ga0496119_0027952_2362_3402 346
198 3300048924 Ga0496121_0180687 Ga0496121_0180687_421_1461 346
199 3300049591 Ga0501075_0071879 Ga0501075_0071879_1427_2467 346
200 3300049824 Ga0501045_0149932 Ga0501045_0149932_671_1711 346
201 3300005331 Ga0070670_100087270 Ga0070670_1000872702 347
202 3300005336 Ga0070680_100015948 Ga0070680_1000159482 347
203 3300005336 Ga0070680_100184497 Ga0070680_1001844972 347
204 3300005458 Ga0070681_10009287 Ga0070681_100092877 347
205 3300005458 Ga0070681_10032878 Ga0070681_100328784 347
206 3300005458 Ga0070681_10041478 Ga0070681_100414784 347
207 3300005530 Ga0070679_100000605 Ga0070679_10000060513 347
208 3300005618 Ga0068864_100000503 Ga0068864_10000050328 347
209 3300005841 Ga0068863_100000158 Ga0068863_10000015849 347
210 3300005842 Ga0068858_100000746 Ga0068858_10000074628 347
211 3300005937 Ga0081455_10001456 Ga0081455_1000145634 347
212 3300006058 Ga0075432_10021275 Ga0075432_100212752 347
213 3300006173 Ga0070716_100112458 Ga0070716_1001124582 347
214 3300006844 Ga0075428_100399279 Ga0075428_1003992792 347
215 3300006852 Ga0075433_10022222 Ga0075433_100222225 347
216 3300006914 Ga0075436_100013945 Ga0075436_1000139452 347
217 3300009092 Ga0105250_10006683 Ga0105250_100066833 347
218 3300009093 Ga0105240_10007240 Ga0105240_100072404 347
219 3300009093 Ga0105240_10025594 Ga0105240_100255943 347
220 3300009177 Ga0105248_10007964 Ga0105248_100079646 347
221 3300009177 Ga0105248_10236408 Ga0105248_102364082 347
222 3300009551 Ga0105238_10003749 Ga0105238_100037493 347
223 3300009551 Ga0105238_10070624 Ga0105238_100706242 347
224 3300013104 Ga0157370_10002168 Ga0157370_100021688 347
225 3300013104 Ga0157370_10266187 Ga0157370_102661872 347
226 3300013105 Ga0157369_10046339 Ga0157369_100463394 347
227 3300025912 Ga0207707_10000052 Ga0207707_1000005256 347
228 3300025912 Ga0207707_10032766 Ga0207707_100327662 347
229 3300025912 Ga0207707_10033352 Ga0207707_100333522 347
230 3300025912 Ga0207707_10080800 Ga0207707_100808002 347
231 3300025913 Ga0207695_10004526 Ga0207695_100045267 347
232 3300025913 Ga0207695_10240216 Ga0207695_102402162 347
233 3300025917 Ga0207660_10030573 Ga0207660_100305734 347
234 3300025920 Ga0207649_10156095 Ga0207649_101560952 347
235 3300025921 Ga0207652_10001360 Ga0207652_1000136011 347
236 3300025921 Ga0207652_10038665 Ga0207652_100386654 347
237 3300025924 Ga0207694_10008773 Ga0207694_100087733 347
238 3300025924 Ga0207694_10116818 Ga0207694_101168182 347
239 3300025925 Ga0207650_10024429 Ga0207650_100244293 347
240 3300025939 Ga0207665_10204176 Ga0207665_102041762 347
241 3300025941 Ga0207711_10003727 Ga0207711_100037276 347
242 3300025941 Ga0207711_10005222 Ga0207711_1000522210 347
243 3300025949 Ga0207667_10002121 Ga0207667_1000212111 347
244 3300026035 Ga0207703_10000598 Ga0207703_1000059828 347
245 3300026088 Ga0207641_10000687 Ga0207641_1000068728 347
246 3300031730 Ga0307516_10297726 Ga0307516_102977262 347
247 3300035113 Ga0373936_0003657 Ga0373936_0003657_3190_4236 347
248 3300037068 Ga0373925_0132890 Ga0373925_0132890_213_1259 347
249 3300048907 Ga0496104_0033716 Ga0496104_0033716_3580_4626 347
250 3300048919 Ga0496116_0016159 Ga0496116_0016159_1747_2937 347
251 3300048920 Ga0496117_0000102 Ga0496117_0000102_61351_62541 347
252 3300048921 Ga0496118_0000038 Ga0496118_0000038_252897_254087 347
253 3300048921 Ga0496118_0041037 Ga0496118_0041037_372_1424 347
254 3300048922 Ga0496119_0026733 Ga0496119_0026733_526_1578 347
255 3300048924 Ga0496121_0000009 Ga0496121_0000009_373672_374724 347
256 3300049574 Ga0501038_0057938 Ga0501038_0057938_1344_2450 347
257 3300049575 Ga0501039_0138858 Ga0501039_0138858_469_1575 347
258 3300049576 Ga0501040_0036964 Ga0501040_0036964_2081_3187 347
259 3300049578 Ga0501042_0013005 Ga0501042_0013005_2830_3936 347
260 3300049587 Ga0501071_0003323 Ga0501071_0003323_6721_7827 347
261 3300049588 Ga0501072_0007087 Ga0501072_0007087_2957_4063 347
262 3300049590 Ga0501074_0013146 Ga0501074_0013146_1105_2211 347
263 3300049591 Ga0501075_0013981 Ga0501075_0013981_2663_3769 347
264 3300049592 Ga0501076_0006663 Ga0501076_0006663_1422_2528 347
265 3300049593 Ga0501077_0052145 Ga0501077_0052145_18_1124 347
266 3300049743 Ga0501081_0194491 Ga0501081_0194491_86_1192 347
267 3300049822 Ga0501035_0079672 Ga0501035_0079672_1152_2258 347
268 3300053104 Ga0500556_0060132 Ga0500556_0060132_247_1299 347
269 3300053146 Ga0500588_0052154 Ga0500588_0052154_122_1174 347
270 3300053730 Ga0500645_005378 Ga0500645_005378_1144_2187 347
271 3300054114 Ga0501084_0022271 Ga0501084_0022271_3945_5051 347
272 3300003203 JGI25406J46586_10004413 JGI25406J46586_100044133 348
273 3300003203 JGI25406J46586_10006724 JGI25406J46586_100067243 348
274 3300005367 Ga0070667_100299667 Ga0070667_1002996671 348
275 3300005435 Ga0070714_100189668 Ga0070714_1001896682 348
276 3300005548 Ga0070665_100086382 Ga0070665_1000863823 348
277 3300005563 Ga0068855_100004606 Ga0068855_10000460613 348
278 3300005842 Ga0068858_100005184 Ga0068858_1000051844 348
279 3300005842 Ga0068858_100012153 Ga0068858_1000121532 348
280 3300005985 Ga0081539_10000123 Ga0081539_10000123139 348
281 3300009093 Ga0105240_10016790 Ga0105240_100167905 348
282 3300009101 Ga0105247_10014370 Ga0105247_100143705 348
283 3300009545 Ga0105237_10057995 Ga0105237_100579952 348
284 3300009551 Ga0105238_10045883 Ga0105238_100458834 348
285 3300013105 Ga0157369_10004809 Ga0157369_100048098 348
286 3300013307 Ga0157372_10088786 Ga0157372_100887863 348
287 3300013307 Ga0157372_10329082 Ga0157372_103290822 348
288 3300014968 Ga0157379_10051310 Ga0157379_100513102 348
289 3300025900 Ga0207710_10077019 Ga0207710_100770192 348
290 3300025913 Ga0207695_10022830 Ga0207695_100228305 348
291 3300025913 Ga0207695_10384790 Ga0207695_103847901 348
292 3300025913 Ga0207695_10427513 Ga0207695_104275131 348
293 3300025914 Ga0207671_10054293 Ga0207671_100542931 348
294 3300025949 Ga0207667_10001737 Ga0207667_100017372 348
295 3300026035 Ga0207703_10003208 Ga0207703_100032086 348
296 3300026035 Ga0207703_10005491 Ga0207703_100054914 348
297 3300026118 Ga0207675_100043825 Ga0207675_1000438253 348
298 3300028379 Ga0268266_10043416 Ga0268266_100434162 348
299 3300030760 Ga0265762_1000082 Ga0265762_10000823 348
300 3300039437 Ga0436365_0663773 Ga0436365_0663773_265_1314 348
301 3300048905 Ga0496102_0004550 Ga0496102_0004550_5017_6069 348
302 3300048919 Ga0496116_0054658 Ga0496116_0054658_788_1840 348
303 3300048920 Ga0496117_0000243 Ga0496117_0000243_45485_46537 348
304 3300048921 Ga0496118_0000064 Ga0496118_0000064_76428_77480 348
305 3300048922 Ga0496119_0027381 Ga0496119_0027381_954_2006 348
306 3300048923 Ga0496120_0007792 Ga0496120_0007792_4516_5568 348
307 3300048927 Ga0496124_0011497 Ga0496124_0011497_2267_3319 348
308 3300048928 Ga0496125_0001517 Ga0496125_0001517_22922_23977 348
309 3300048928 Ga0496125_0028238 Ga0496125_0028238_3663_4715 348
310 3300048929 Ga0496126_0017620 Ga0496126_0017620_2560_3612 348
311 3300048929 Ga0496126_0285087 Ga0496126_0285087_63_1118 348
312 3300053122 Ga0500608_067126 Ga0500608_067126_300_1370 348
313 3300005335 Ga0070666_10001463 Ga0070666_1000146310 349
314 3300005337 Ga0070682_100286919 Ga0070682_1002869191 349
315 3300005338 Ga0068868_100061832 Ga0068868_1000618322 349
316 3300005364 Ga0070673_100112519 Ga0070673_1001125192 349
317 3300005530 Ga0070679_100045793 Ga0070679_1000457933 349
318 3300005539 Ga0068853_100000732 Ga0068853_10000073211 349
319 3300005548 Ga0070665_100020320 Ga0070665_1000203203 349
320 3300005548 Ga0070665_100044467 Ga0070665_1000444674 349
321 3300005548 Ga0070665_100045147 Ga0070665_1000451475 349
322 3300005564 Ga0070664_100016596 Ga0070664_1000165964 349
323 3300005617 Ga0068859_100163749 Ga0068859_1001637493 349
324 3300005843 Ga0068860_100004120 Ga0068860_1000041205 349
325 3300006237 Ga0097621_100142325 Ga0097621_1001423252 349
326 3300006237 Ga0097621_100320425 Ga0097621_1003204252 349
327 3300006931 Ga0097620_100163754 Ga0097620_1001637543 349
328 3300009093 Ga0105240_10013104 Ga0105240_100131042 349
329 3300009093 Ga0105240_10026583 Ga0105240_100265833 349
330 3300009093 Ga0105240_10079534 Ga0105240_100795342 349
331 3300009098 Ga0105245_10020195 Ga0105245_100201952 349
332 3300009098 Ga0105245_10095718 Ga0105245_100957181 349
333 3300009101 Ga0105247_10214336 Ga0105247_102143361 349
334 3300009177 Ga0105248_10006277 Ga0105248_100062778 349
335 3300009545 Ga0105237_10225321 Ga0105237_102253212 349
336 3300009553 Ga0105249_10015437 Ga0105249_100154371 349
337 3300009553 Ga0105249_10022215 Ga0105249_100222153 349
338 3300009553 Ga0105249_10046698 Ga0105249_100466983 349
339 3300010375 Ga0105239_10160926 Ga0105239_101609261 349
340 3300013296 Ga0157374_10077160 Ga0157374_100771602 349
341 3300013297 Ga0157378_10024457 Ga0157378_100244572 349
342 3300013308 Ga0157375_10002928 Ga0157375_1000292811 349
343 3300014325 Ga0163163_10008759 Ga0163163_100087592 349
344 3300014325 Ga0163163_10498829 Ga0163163_104988292 349
345 3300014968 Ga0157379_10001605 Ga0157379_100016054 349
346 3300014969 Ga0157376_10000910 Ga0157376_1000091014 349
347 3300025903 Ga0207680_10006833 Ga0207680_100068334 349
348 3300025912 Ga0207707_10037879 Ga0207707_100378794 349
349 3300025913 Ga0207695_10059994 Ga0207695_100599942 349
350 3300025914 Ga0207671_10233706 Ga0207671_102337062 349
351 3300025921 Ga0207652_10091589 Ga0207652_100915893 349
352 3300025931 Ga0207644_10144561 Ga0207644_101445612 349
353 3300025940 Ga0207691_10003462 Ga0207691_100034625 349
354 3300025941 Ga0207711_10003442 Ga0207711_100034422 349
355 3300025949 Ga0207667_10221218 Ga0207667_102212182 349
356 3300025961 Ga0207712_10025287 Ga0207712_100252873 349
357 3300025961 Ga0207712_10085307 Ga0207712_100853072 349
358 3300026035 Ga0207703_10006054 Ga0207703_100060546 349
359 3300026041 Ga0207639_10003079 Ga0207639_100030798 349
360 3300026041 Ga0207639_10263549 Ga0207639_102635492 349
361 3300026095 Ga0207676_10120313 Ga0207676_101203132 349
362 3300026118 Ga0207675_100040576 Ga0207675_1000405763 349
363 3300028379 Ga0268266_10013408 Ga0268266_100134085 349
364 3300028379 Ga0268266_10388307 Ga0268266_103883071 349
365 3300028381 Ga0268264_10132305 Ga0268264_101323052 349
366 3300028800 Ga0265338_10023510 Ga0265338_100235103 349
367 3300031247 Ga0265340_10050925 Ga0265340_100509252 349
368 3300031507 Ga0307509_10000030 Ga0307509_10000030142 349
369 3300031507 Ga0307509_10000038 Ga0307509_10000038110 349
370 3300033180 Ga0307510_10039625 Ga0307510_100396252 349
371 3300036401 Ga0373937_0071450 Ga0373937_0071450_1705_2817 349
372 3300036401 Ga0373937_0209312 Ga0373937_0209312_686_1738 349
373 3300044842 Ga0466957_0047879 Ga0466957_0047879_497_1675 349
374 3300045049 Ga0466959_0171424 Ga0466959_0171424_21_1076 349
375 3300048907 Ga0496104_0008673 Ga0496104_0008673_4945_5997 349
376 3300048908 Ga0496105_0003391 Ga0496105_0003391_6073_7125 349
377 3300048911 Ga0496108_0004690 Ga0496108_0004690_3400_4452 349
378 3300048912 Ga0496109_0003527 Ga0496109_0003527_5365_6417 349
379 3300048913 Ga0496110_0005766 Ga0496110_0005766_8007_9059 349
380 3300048914 Ga0496111_0019835 Ga0496111_0019835_1225_2277 349
381 3300049570 Ga0501033_0015436 Ga0501033_0015436_1902_2954 349
382 3300049572 Ga0501036_0009960 Ga0501036_0009960_1803_2855 349
383 3300049574 Ga0501038_0009562 Ga0501038_0009562_723_1775 349
384 3300049575 Ga0501039_0004427 Ga0501039_0004427_978_2030 349
385 3300049575 Ga0501039_0047346 Ga0501039_0047346_1217_2269 349
386 3300049576 Ga0501040_0000385 Ga0501040_0000385_8903_9955 349
387 3300049576 Ga0501040_0000935 Ga0501040_0000935_9274_10326 349
388 3300049577 Ga0501041_0000783 Ga0501041_0000783_10469_11521 349
389 3300049577 Ga0501041_0053709 Ga0501041_0053709_642_1694 349
390 3300049578 Ga0501042_0006031 Ga0501042_0006031_6781_7833 349
391 3300049578 Ga0501042_0060233 Ga0501042_0060233_901_1953 349
392 3300049579 Ga0501043_0095034 Ga0501043_0095034_558_1610 349
393 3300049580 Ga0501046_0005749 Ga0501046_0005749_3332_4384 349
394 3300049582 Ga0501048_0011210 Ga0501048_0011210_2360_3412 349
395 3300049582 Ga0501048_0026240 Ga0501048_0026240_276_1328 349
396 3300049584 Ga0501068_0014136 Ga0501068_0014136_1656_2708 349
397 3300049587 Ga0501071_0000011 Ga0501071_0000011_14884_15936 349
398 3300049587 Ga0501071_0026836 Ga0501071_0026836_1199_2251 349
399 3300049588 Ga0501072_0000640 Ga0501072_0000640_15907_16959 349
400 3300049588 Ga0501072_0008703 Ga0501072_0008703_4715_5767 349
401 3300049591 Ga0501075_0000086 Ga0501075_0000086_14180_15232 349
402 3300049591 Ga0501075_0058277 Ga0501075_0058277_691_1743 349
403 3300049592 Ga0501076_0000277 Ga0501076_0000277_13223_14275 349
404 3300049592 Ga0501076_0033975 Ga0501076_0033975_2900_3952 349
405 3300049593 Ga0501077_0002412 Ga0501077_0002412_5054_6106 349
406 3300049741 Ga0501079_0000209 Ga0501079_0000209_15623_16675 349
407 3300049742 Ga0501080_0007768 Ga0501080_0007768_6781_7833 349
408 3300049743 Ga0501081_0001058 Ga0501081_0001058_9463_10515 349
409 3300049744 Ga0501083_0013635 Ga0501083_0013635_1911_2963 349
410 3300049744 Ga0501083_0100217 Ga0501083_0100217_690_1742 349
411 3300049822 Ga0501035_0045820 Ga0501035_0045820_1316_2368 349
412 3300049824 Ga0501045_0000055 Ga0501045_0000055_26789_27841 349
413 3300049824 Ga0501045_0052740 Ga0501045_0052740_288_1340 349
414 3300053092 Ga0500583_0017966 Ga0500583_0017966_990_2042 349
415 3300053146 Ga0500588_0005597 Ga0500588_0005597_67_1134 349
416 3300053153 Ga0500616_0000011 Ga0500616_0000011_90058_91110 349
417 3300053178 Ga0500637_0028948 Ga0500637_0028948_1176_2228 349
418 3300054114 Ga0501084_0008126 Ga0501084_0008126_2652_3704 349
419 3300054114 Ga0501084_0010556 Ga0501084_0010556_1768_2820 349
420 3300060353 Ga0501082_0000298 Ga0501082_0000298_17725_18777 349
421 3300060353 Ga0501082_0028612 Ga0501082_0028612_2600_3652 349
422 3300061734 Ga0530510_0000228 Ga0530510_0000228_28492_29544 349
423 2162886006 SwRhRL3b_contig_244457 SwRhRL3b_0716.00000890 350
424 3300005295 Ga0065707_10082048 Ga0065707_100820482 350
425 3300005295 Ga0065707_10089827 Ga0065707_100898271 350
426 3300005330 Ga0070690_100203541 Ga0070690_1002035412 350
427 3300005335 Ga0070666_10002062 Ga0070666_100020626 350
428 3300005355 Ga0070671_100000201 Ga0070671_10000020116 350
429 3300005355 Ga0070671_100016940 Ga0070671_1000169403 350
430 3300005367 Ga0070667_100000564 Ga0070667_10000056416 350
431 3300005434 Ga0070709_10005771 Ga0070709_100057716 350
432 3300005435 Ga0070714_100021134 Ga0070714_1000211345 350
433 3300005436 Ga0070713_100002972 Ga0070713_1000029724 350
434 3300005548 Ga0070665_100016476 Ga0070665_1000164765 350
435 3300005548 Ga0070665_100168514 Ga0070665_1001685143 350
436 3300005563 Ga0068855_100007206 Ga0068855_1000072064 350
437 3300005614 Ga0068856_100034668 Ga0068856_1000346683 350
438 3300005617 Ga0068859_100000238 Ga0068859_10000023823 350
439 3300005841 Ga0068863_100010199 Ga0068863_1000101997 350
440 3300005841 Ga0068863_100026755 Ga0068863_1000267554 350
441 3300005842 Ga0068858_100000661 Ga0068858_10000066118 350
442 3300005843 Ga0068860_100044017 Ga0068860_1000440172 350
443 3300006028 Ga0070717_10072724 Ga0070717_100727242 350
444 3300006163 Ga0070715_10097583 Ga0070715_100975832 350
445 3300006173 Ga0070716_100079989 Ga0070716_1000799892 350
446 3300006175 Ga0070712_100004776 Ga0070712_1000047762 350
447 3300006237 Ga0097621_100011674 Ga0097621_1000116747 350
448 3300006844 Ga0075428_100008172 Ga0075428_1000081729 350
449 3300006844 Ga0075428_100037841 Ga0075428_1000378415 350
450 3300006881 Ga0068865_100014609 Ga0068865_1000146094 350
451 3300006931 Ga0097620_100000238 Ga0097620_10000023823 350
452 3300009092 Ga0105250_10000014 Ga0105250_100000146 350
453 3300009093 Ga0105240_10016706 Ga0105240_100167065 350
454 3300009098 Ga0105245_10016500 Ga0105245_100165002 350
455 3300009101 Ga0105247_10000157 Ga0105247_1000015722 350
456 3300009174 Ga0105241_10048142 Ga0105241_100481422 350
457 3300009176 Ga0105242_10004933 Ga0105242_100049334 350
458 3300009177 Ga0105248_10072143 Ga0105248_100721433 350
459 3300009545 Ga0105237_10027260 Ga0105237_100272603 350
460 3300009545 Ga0105237_10031000 Ga0105237_100310002 350
461 3300009545 Ga0105237_10369160 Ga0105237_103691601 350
462 3300010159 Ga0099796_10002150 Ga0099796_100021503 350
463 3300013297 Ga0157378_10031027 Ga0157378_100310273 350
464 3300013306 Ga0163162_10022475 Ga0163162_100224752 350
465 3300013306 Ga0163162_10051957 Ga0163162_100519575 350
466 3300014325 Ga0163163_10045680 Ga0163163_100456803 350
467 3300014326 Ga0157380_10008495 Ga0157380_100084952 350
468 3300014968 Ga0157379_10000278 Ga0157379_100002787 350
469 3300014968 Ga0157379_10000899 Ga0157379_1000089918 350
470 3300025711 Ga0207696_1000087 Ga0207696_10000876 350
471 3300025900 Ga0207710_10000211 Ga0207710_1000021140 350
472 3300025906 Ga0207699_10016844 Ga0207699_100168442 350
473 3300025906 Ga0207699_10133925 Ga0207699_101339252 350
474 3300025915 Ga0207693_10000068 Ga0207693_1000006810 350
475 3300025915 Ga0207693_10023094 Ga0207693_100230944 350
476 3300025931 Ga0207644_10000984 Ga0207644_100009842 350
477 3300025939 Ga0207665_10089478 Ga0207665_100894782 350
478 3300025949 Ga0207667_10034818 Ga0207667_100348185 350
479 3300025961 Ga0207712_10104402 Ga0207712_101044022 350
480 3300025986 Ga0207658_10001537 Ga0207658_1000153712 350
481 3300026035 Ga0207703_10000835 Ga0207703_1000083510 350
482 3300026121 Ga0207683_10004921 Ga0207683_100049215 350
483 3300030521 Ga0307511_10000052 Ga0307511_1000005222 350
484 3300035172 Ga0373955_0023147 Ga0373955_0023147_878_1936 350
485 3300035695 Ga0373927_0004671 Ga0373927_0004671_6035_7093 350
486 3300037068 Ga0373925_0296847 Ga0373925_0296847_212_1270 350
487 3300041404 Ga0439436_0006197 Ga0439436_0006197_358_1458 350
488 3300041406 Ga0439439_0006671 Ga0439439_0006671_775_1875 350
489 3300042014 Ga0439457_000901 Ga0439457_000901_5647_6747 350
490 3300044656 Ga0466969_0002840 Ga0466969_0002840_1529_2608 350
491 3300044693 Ga0466961_0098368 Ga0466961_0098368_256_1401 350
492 3300044706 Ga0466964_0006235 Ga0466964_0006235_1487_2566 350
493 3300044719 Ga0466971_0039341 Ga0466971_0039341_476_1555 350
494 3300045049 Ga0466959_0033955 Ga0466959_0033955_900_1952 350
495 3300046472 Ga0495580_0005250 Ga0495580_0005250_5672_6730 350
496 3300048903 Ga0496100_0029273 Ga0496100_0029273_2215_3273 350
497 3300048904 Ga0496101_0005953 Ga0496101_0005953_3032_4090 350
498 3300048905 Ga0496102_0148953 Ga0496102_0148953_421_1479 350
499 3300048905 Ga0496102_0169615 Ga0496102_0169615_230_1282 350
500 3300048907 Ga0496104_0071784 Ga0496104_0071784_2102_3160 350
501 3300048908 Ga0496105_0021391 Ga0496105_0021391_3155_4213 350
502 3300048911 Ga0496108_0103155 Ga0496108_0103155_392_1444 350
503 3300048911 Ga0496108_0455658 Ga0496108_0455658_33_1091 350
504 3300048912 Ga0496109_0028915 Ga0496109_0028915_3800_4858 350
505 3300048913 Ga0496110_0057114 Ga0496110_0057114_2225_3283 350
506 3300048914 Ga0496111_0133567 Ga0496111_0133567_34_1092 350
507 3300048916 Ga0496113_0048558 Ga0496113_0048558_118_1176 350
508 3300048921 Ga0496118_0038217 Ga0496118_0038217_2762_3814 350
509 3300048922 Ga0496119_0012169 Ga0496119_0012169_3923_5074 350
510 3300048924 Ga0496121_0001266 Ga0496121_0001266_21482_22534 350
511 3300048924 Ga0496121_0116197 Ga0496121_0116197_249_1301 350
512 3300048928 Ga0496125_0005299 Ga0496125_0005299_5732_6925 350
513 3300048928 Ga0496125_0062327 Ga0496125_0062327_1592_2644 350
514 3300061719 Ga0466962_0011940 Ga0466962_0011940_1414_2493 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01326

PPDK_N

Pyruvate phosphate dikinase, AMP/ATP-binding domain

17

350

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hv6-assembly1.cif.gz_A the atp binding domain of rifampin phosphotransferase from listeria monocytogenes 0.9445 4 319
5hv6-assembly1.cif.gz_A the atp binding domain of rifampin phosphotransferase from listeria monocytogenes 0.9357 4 319
5hv6-assembly2.cif.gz_B the atp binding domain of rifampin phosphotransferase from listeria monocytogenes 0.9322 2 319
5hv6-assembly2.cif.gz_B the atp binding domain of rifampin phosphotransferase from listeria monocytogenes 0.9291 2 319
5hv2-assembly1.cif.gz_A rifampin phosphotransferase g527y mutant from listeria monocytogenes 0.9245 2 319
ID Description Score Start End Superfamily
5hv6B02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9583 189 319 3.30.470.20
5hv6B02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9508 189 319 3.30.470.20
2olsA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9431 193 322 3.30.470.20
af_Q57962_11_199_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9387 3 189 3.30.1490.20
af_Q57962_11_199_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9244 3 189 3.30.1490.20
ID Description Score Start End GO Terms
AF-A0A1V2MFC9-F1-model_v4 Phosphoenolpyruvate synthase 0.9739 186 319 GO:0005524
GO:0016301
AF-A0A534EJ00-F1-model_v4 Phosphoenolpyruvate synthase (EC 2.7.9.2) (Pyruvate, water dikinase) 0.9671 1 156 GO:0005524
GO:0006090
GO:0006094
GO:0008986
GO:0046872
AF-A0A3B8LMA1-F1-model_v4 Phosphoenolpyruvate synthase (EC 2.7.9.2) (Pyruvate, water dikinase) 0.9659 4 256 GO:0005524
GO:0006090
GO:0006094
GO:0008986
GO:0046872
AF-A0A843DHJ5-F1-model_v4 deleted 0.9652 1 319
AF-A0A2H0SEX6-F1-model_v4 Phosphoenolpyruvate synthase (EC 2.7.9.2) (Pyruvate, water dikinase) 0.9649 3 321 GO:0005524
GO:0006090
GO:0006094
GO:0008986
GO:0046872

Feature Viewer

pLDDT pTM Quality
87.76 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map