F457661
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 514 | 254 | 513 | 348 |
Family's Representative Sequence
| Representative Sequence | 3300003203|JGI25406J46586_10002597|JGI25406J46586_100025973 |
| Length | 372 |
| Sequence | MSEPYVLPFAGVGRQDVGVAGGKGASLGELCRAGIRVPPGFVVTTAAFRDVAERLPDGGARAVEKRIAALDPDDHTTVAAVTASVRDLFTSAPLPQPLETAIRDGYAQLSERGLLDRHQGXAGPSPLPVAVRSSATSEDSADASFAGLQDTFLWVRGADDIVEHVRCCWASLYSVESVTYRLRRKLPEEGLAIAVVVQQMVDARCSGVMFTRSPLTGDRSVIVLEASWGLGSAVVGGEVTPDSWVVNKVTGEVLRRTISRKLHRHVADPSGRGVRVEDVPEGLQESPALDDAALRKLVAVGRAVERHYGAPQDIEWAWAAGDDQPFLLQSRPETVWSTRPAPPIATAAANPFDHVLALLSKPGARPGGEAPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 88 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 128 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 129 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 132 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 135 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 136 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 138 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 139 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 140 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 142 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 143 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 150 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 151 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 152 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 153 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 154 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 156 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 157 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 161 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 162 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 163 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 164 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 165 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 166 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 167 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 168 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 169 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 170 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 171 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 172 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 173 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 174 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 175 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 200 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 201 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 202 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 203 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 206 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 207 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 208 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 209 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 210 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 211 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 212 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 213 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 214 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 215 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 216 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 217 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 244 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 245 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 246 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 247 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 248 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 249 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 250 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 251 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 254 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.61 |
| Metatranscriptomes | 0.19 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.75 |
| Nodule | 0 |
| Rhizoplane | 4.47 |
| Rhizosphere | 85.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_244457 | 2162886006 | Unclassified | 1365 |
| 2 | JGI24752J21851_1001581 | 3300001976 | Bacteria | 3065 |
| 3 | JGI24750J21931_1000603 | 3300002070 | Bacteria | 5430 |
| 4 | JGI24748J21848_1000109 | 3300002074 | Bacteria | 17572 |
| 5 | JGI24749J21850_1001361 | 3300002076 | Bacteria | 3462 |
| 6 | JGI24034J26672_10000060 | 3300002239 | Bacteria | 41095 |
| 7 | JGI24751J29686_10000254 | 3300002459 | Bacteria | 20892 |
| 8 | JGI25406J46586_10002597 | 3300003203 | Bacteria | 8525 |
| 9 | JGI25406J46586_10004413 | 3300003203 | Bacteria | 6553 |
| 10 | JGI25406J46586_10006724 | 3300003203 | Bacteria | 5283 |
| 11 | JGI25406J46586_10028320 | 3300003203 | Bacteria | 2136 |
| 12 | Ga0065707_10004111 | 3300005295 | Bacteria | 7478 |
| 13 | Ga0065707_10082048 | 3300005295 | Bacteria | 23588 |
| 14 | Ga0065707_10089827 | 3300005295 | Bacteria | 4271 |
| 15 | Ga0070690_100000477 | 3300005330 | Bacteria | 20163 |
| 16 | Ga0070690_100203541 | 3300005330 | Bacteria | 1379 |
| 17 | Ga0070670_100011691 | 3300005331 | Bacteria | 7508 |
| 18 | Ga0070670_100087270 | 3300005331 | Bacteria | 2681 |
| 19 | Ga0070666_10000069 | 3300005335 | Bacteria | 75768 |
| 20 | Ga0070666_10001463 | 3300005335 | Bacteria | 14338 |
| 21 | Ga0070666_10002062 | 3300005335 | Bacteria | 12202 |
| 22 | Ga0070680_100015948 | 3300005336 | Bacteria | 5902 |
| 23 | Ga0070680_100184497 | 3300005336 | Bacteria | 1757 |
| 24 | Ga0070682_100286919 | 3300005337 | Bacteria | 1202 |
| 25 | Ga0068868_100061832 | 3300005338 | Bacteria | 2967 |
| 26 | Ga0070689_100023946 | 3300005340 | Bacteria | 4576 |
| 27 | Ga0070687_100203618 | 3300005343 | Bacteria | 1201 |
| 28 | Ga0070668_100034582 | 3300005347 | Bacteria | 3852 |
| 29 | Ga0070669_100001464 | 3300005353 | Bacteria | 17088 |
| 30 | Ga0070675_100012163 | 3300005354 | Bacteria | 6747 |
| 31 | Ga0070671_100000201 | 3300005355 | Bacteria | 39892 |
| 32 | Ga0070671_100016940 | 3300005355 | Bacteria | 5894 |
| 33 | Ga0070671_100071614 | 3300005355 | Bacteria | 2893 |
| 34 | Ga0070673_100112519 | 3300005364 | Bacteria | 2260 |
| 35 | Ga0070688_100001347 | 3300005365 | Bacteria | 12201 |
| 36 | Ga0070667_100000564 | 3300005367 | Bacteria | 36686 |
| 37 | Ga0070667_100092108 | 3300005367 | Bacteria | 2607 |
| 38 | Ga0070667_100119544 | 3300005367 | Bacteria | 2291 |
| 39 | Ga0070667_100299667 | 3300005367 | Bacteria | 1447 |
| 40 | Ga0070709_10005771 | 3300005434 | Bacteria | 6714 |
| 41 | Ga0070714_100021134 | 3300005435 | Bacteria | 5321 |
| 42 | Ga0070714_100189668 | 3300005435 | Bacteria | 1875 |
| 43 | Ga0070713_100002972 | 3300005436 | Bacteria | 11131 |
| 44 | Ga0070700_100021039 | 3300005441 | Bacteria | 3789 |
| 45 | Ga0070681_10009287 | 3300005458 | Bacteria | 9671 |
| 46 | Ga0070681_10032878 | 3300005458 | Bacteria | 5207 |
| 47 | Ga0070681_10041478 | 3300005458 | Bacteria | 4613 |
| 48 | Ga0070681_10144445 | 3300005458 | Unclassified | 2309 |
| 49 | Ga0068867_100045567 | 3300005459 | Bacteria | 3217 |
| 50 | Ga0070685_10000036 | 3300005466 | Bacteria | 80641 |
| 51 | Ga0070679_100000605 | 3300005530 | Bacteria | 30538 |
| 52 | Ga0070679_100045793 | 3300005530 | Bacteria | 4359 |
| 53 | Ga0070679_100134978 | 3300005530 | Bacteria | 2449 |
| 54 | Ga0070679_100425217 | 3300005530 | Bacteria | 1274 |
| 55 | Ga0068853_100000732 | 3300005539 | Bacteria | 22719 |
| 56 | Ga0068853_100274902 | 3300005539 | Bacteria | 1552 |
| 57 | Ga0070686_100000045 | 3300005544 | Bacteria | 101988 |
| 58 | Ga0070686_100012129 | 3300005544 | Bacteria | 4903 |
| 59 | Ga0070665_100000042 | 3300005548 | Bacteria | 292582 |
| 60 | Ga0070665_100005884 | 3300005548 | Bacteria | 12563 |
| 61 | Ga0070665_100016476 | 3300005548 | Bacteria | 7410 |
| 62 | Ga0070665_100020320 | 3300005548 | Bacteria | 6669 |
| 63 | Ga0070665_100036879 | 3300005548 | Bacteria | 4916 |
| 64 | Ga0070665_100044467 | 3300005548 | Bacteria | 4460 |
| 65 | Ga0070665_100045147 | 3300005548 | Bacteria | 4425 |
| 66 | Ga0070665_100086382 | 3300005548 | Bacteria | 3142 |
| 67 | Ga0070665_100168514 | 3300005548 | Bacteria | 2192 |
| 68 | Ga0068855_100004606 | 3300005563 | Bacteria | 16832 |
| 69 | Ga0068855_100007206 | 3300005563 | Bacteria | 13495 |
| 70 | Ga0068855_100052307 | 3300005563 | Bacteria | 4809 |
| 71 | Ga0068855_100335078 | 3300005563 | Bacteria | 1669 |
| 72 | Ga0070664_100016596 | 3300005564 | Bacteria | 6040 |
| 73 | Ga0068856_100034668 | 3300005614 | Bacteria | 4943 |
| 74 | Ga0068856_100109271 | 3300005614 | Bacteria | 2762 |
| 75 | Ga0068859_100000238 | 3300005617 | Bacteria | 54568 |
| 76 | Ga0068859_100030049 | 3300005617 | Bacteria | 5452 |
| 77 | Ga0068859_100067629 | 3300005617 | Bacteria | 3607 |
| 78 | Ga0068859_100163749 | 3300005617 | Bacteria | 2303 |
| 79 | Ga0068859_100480597 | 3300005617 | Bacteria | 1338 |
| 80 | Ga0068864_100000503 | 3300005618 | Bacteria | 33698 |
| 81 | Ga0068864_100009265 | 3300005618 | Bacteria | 8118 |
| 82 | Ga0068864_100075105 | 3300005618 | Bacteria | 2950 |
| 83 | Ga0068861_100075441 | 3300005719 | Bacteria | 2625 |
| 84 | Ga0068863_100000158 | 3300005841 | Bacteria | 71918 |
| 85 | Ga0068863_100000955 | 3300005841 | Bacteria | 28986 |
| 86 | Ga0068863_100009831 | 3300005841 | Bacteria | 9319 |
| 87 | Ga0068863_100010199 | 3300005841 | Bacteria | 9136 |
| 88 | Ga0068863_100026755 | 3300005841 | Bacteria | 5500 |
| 89 | Ga0068858_100000659 | 3300005842 | Bacteria | 36067 |
| 90 | Ga0068858_100000661 | 3300005842 | Bacteria | 35996 |
| 91 | Ga0068858_100000746 | 3300005842 | Bacteria | 34090 |
| 92 | Ga0068858_100005184 | 3300005842 | Bacteria | 12764 |
| 93 | Ga0068858_100012153 | 3300005842 | Bacteria | 8119 |
| 94 | Ga0068858_100014775 | 3300005842 | Bacteria | 7347 |
| 95 | Ga0068860_100000182 | 3300005843 | Bacteria | 100888 |
| 96 | Ga0068860_100000475 | 3300005843 | Bacteria | 49893 |
| 97 | Ga0068860_100004120 | 3300005843 | Bacteria | 14895 |
| 98 | Ga0068860_100044017 | 3300005843 | Bacteria | 4256 |
| 99 | Ga0068860_100461597 | 3300005843 | Bacteria | 1264 |
| 100 | Ga0068862_100010842 | 3300005844 | Bacteria | 7525 |
| 101 | Ga0081455_10001456 | 3300005937 | Bacteria | 29298 |
| 102 | Ga0081539_10000028 | 3300005985 | Bacteria | 328182 |
| 103 | Ga0081539_10000123 | 3300005985 | Bacteria | 181245 |
| 104 | Ga0081539_10001877 | 3300005985 | Bacteria | 32940 |
| 105 | Ga0070717_10072724 | 3300006028 | Bacteria | 2871 |
| 106 | Ga0075432_10021275 | 3300006058 | Bacteria | 2217 |
| 107 | Ga0070715_10035074 | 3300006163 | Bacteria | 2061 |
| 108 | Ga0070715_10097583 | 3300006163 | Unclassified | 1364 |
| 109 | Ga0070716_100079989 | 3300006173 | Bacteria | 1947 |
| 110 | Ga0070716_100112458 | 3300006173 | Bacteria | 1690 |
| 111 | Ga0070712_100004776 | 3300006175 | Bacteria | 8375 |
| 112 | Ga0070712_100185810 | 3300006175 | Bacteria | 1623 |
| 113 | Ga0097621_100011674 | 3300006237 | Bacteria | 6482 |
| 114 | Ga0097621_100142325 | 3300006237 | Bacteria | 2050 |
| 115 | Ga0097621_100144413 | 3300006237 | Bacteria | 2036 |
| 116 | Ga0097621_100320425 | 3300006237 | Bacteria | 1373 |
| 117 | Ga0068871_100088479 | 3300006358 | Bacteria | 2577 |
| 118 | Ga0075428_100008172 | 3300006844 | Bacteria | 11611 |
| 119 | Ga0075428_100037841 | 3300006844 | Bacteria | 5309 |
| 120 | Ga0075428_100399279 | 3300006844 | Bacteria | 1474 |
| 121 | Ga0075433_10022222 | 3300006852 | Bacteria | 5324 |
| 122 | Ga0068865_100014609 | 3300006881 | Bacteria | 4992 |
| 123 | Ga0075436_100013945 | 3300006914 | Bacteria | 5500 |
| 124 | Ga0097620_100000238 | 3300006931 | Bacteria | 54568 |
| 125 | Ga0097620_100030047 | 3300006931 | Bacteria | 5452 |
| 126 | Ga0097620_100067623 | 3300006931 | Bacteria | 3607 |
| 127 | Ga0097620_100163754 | 3300006931 | Bacteria | 2303 |
| 128 | Ga0097620_100480615 | 3300006931 | Bacteria | 1338 |
| 129 | Ga0105251_10081524 | 3300009011 | Bacteria | 1495 |
| 130 | Ga0105250_10000014 | 3300009092 | Bacteria | 268458 |
| 131 | Ga0105250_10006683 | 3300009092 | Bacteria | 5017 |
| 132 | Ga0105240_10007240 | 3300009093 | Bacteria | 16152 |
| 133 | Ga0105240_10013104 | 3300009093 | Bacteria | 11410 |
| 134 | Ga0105240_10016706 | 3300009093 | Bacteria | 9926 |
| 135 | Ga0105240_10016790 | 3300009093 | Bacteria | 9900 |
| 136 | Ga0105240_10025594 | 3300009093 | Bacteria | 7750 |
| 137 | Ga0105240_10026583 | 3300009093 | Bacteria | 7594 |
| 138 | Ga0105240_10079534 | 3300009093 | Bacteria | 4034 |
| 139 | Ga0105240_10341923 | 3300009093 | Bacteria | 1700 |
| 140 | Ga0111539_10517130 | 3300009094 | Bacteria | 1390 |
| 141 | Ga0105245_10016500 | 3300009098 | Bacteria | 6444 |
| 142 | Ga0105245_10020195 | 3300009098 | Bacteria | 5839 |
| 143 | Ga0105245_10095718 | 3300009098 | Bacteria | 2739 |
| 144 | Ga0105247_10000157 | 3300009101 | Bacteria | 66480 |
| 145 | Ga0105247_10014370 | 3300009101 | Bacteria | 4750 |
| 146 | Ga0105247_10036486 | 3300009101 | Bacteria | 2996 |
| 147 | Ga0105247_10214336 | 3300009101 | Unclassified | 1300 |
| 148 | Ga0105241_10048142 | 3300009174 | Bacteria | 3243 |
| 149 | Ga0105242_10004933 | 3300009176 | Bacteria | 10333 |
| 150 | Ga0105248_10006277 | 3300009177 | Bacteria | 13037 |
| 151 | Ga0105248_10007964 | 3300009177 | Bacteria | 11650 |
| 152 | Ga0105248_10018831 | 3300009177 | Bacteria | 7635 |
| 153 | Ga0105248_10072143 | 3300009177 | Bacteria | 3880 |
| 154 | Ga0105248_10236408 | 3300009177 | Unclassified | 2057 |
| 155 | Ga0105237_10027260 | 3300009545 | Bacteria | 5834 |
| 156 | Ga0105237_10031000 | 3300009545 | Bacteria | 5423 |
| 157 | Ga0105237_10057995 | 3300009545 | Bacteria | 3875 |
| 158 | Ga0105237_10225321 | 3300009545 | Unclassified | 1875 |
| 159 | Ga0105237_10369160 | 3300009545 | Unclassified | 1440 |
| 160 | Ga0105238_10003749 | 3300009551 | Bacteria | 15100 |
| 161 | Ga0105238_10045883 | 3300009551 | Bacteria | 4414 |
| 162 | Ga0105238_10070624 | 3300009551 | Bacteria | 3491 |
| 163 | Ga0105249_10000012 | 3300009553 | Bacteria | 292640 |
| 164 | Ga0105249_10005825 | 3300009553 | Bacteria | 10661 |
| 165 | Ga0105249_10015437 | 3300009553 | Bacteria | 6760 |
| 166 | Ga0105249_10022215 | 3300009553 | Bacteria | 5682 |
| 167 | Ga0105249_10046698 | 3300009553 | Bacteria | 3942 |
| 168 | Ga0105249_10161564 | 3300009553 | Bacteria | 2165 |
| 169 | Ga0099796_10002150 | 3300010159 | Bacteria | 4246 |
| 170 | Ga0105239_10160926 | 3300010375 | Bacteria | 2508 |
| 171 | Ga0157370_10002168 | 3300013104 | Bacteria | 23945 |
| 172 | Ga0157370_10266187 | 3300013104 | Bacteria | 1584 |
| 173 | Ga0157369_10004809 | 3300013105 | Bacteria | 15866 |
| 174 | Ga0157369_10046339 | 3300013105 | Bacteria | 4725 |
| 175 | Ga0157369_10222108 | 3300013105 | Bacteria | 1977 |
| 176 | Ga0157369_10251005 | 3300013105 | Bacteria | 1846 |
| 177 | Ga0157374_10077160 | 3300013296 | Bacteria | 3152 |
| 178 | Ga0157378_10024457 | 3300013297 | Bacteria | 5315 |
| 179 | Ga0157378_10031027 | 3300013297 | Bacteria | 4720 |
| 180 | Ga0163162_10022475 | 3300013306 | Bacteria | 6214 |
| 181 | Ga0163162_10044469 | 3300013306 | Bacteria | 4448 |
| 182 | Ga0163162_10051957 | 3300013306 | Bacteria | 4114 |
| 183 | Ga0157372_10088786 | 3300013307 | Bacteria | 3510 |
| 184 | Ga0157372_10216573 | 3300013307 | Bacteria | 2219 |
| 185 | Ga0157372_10329082 | 3300013307 | Bacteria | 1779 |
| 186 | Ga0157375_10002928 | 3300013308 | Bacteria | 14809 |
| 187 | Ga0163163_10008759 | 3300014325 | Bacteria | 9004 |
| 188 | Ga0163163_10045680 | 3300014325 | Bacteria | 4300 |
| 189 | Ga0163163_10098096 | 3300014325 | Bacteria | 2951 |
| 190 | Ga0163163_10498829 | 3300014325 | Bacteria | 1279 |
| 191 | Ga0157380_10008495 | 3300014326 | Bacteria | 7336 |
| 192 | Ga0157380_10023951 | 3300014326 | Bacteria | 4613 |
| 193 | Ga0157380_10030055 | 3300014326 | Bacteria | 4157 |
| 194 | Ga0157379_10000278 | 3300014968 | Bacteria | 40420 |
| 195 | Ga0157379_10000899 | 3300014968 | Bacteria | 24055 |
| 196 | Ga0157379_10001605 | 3300014968 | Bacteria | 18651 |
| 197 | Ga0157379_10013393 | 3300014968 | Bacteria | 7183 |
| 198 | Ga0157379_10051310 | 3300014968 | Bacteria | 3685 |
| 199 | Ga0157376_10000910 | 3300014969 | Bacteria | 19232 |
| 200 | Ga0163161_10000387 | 3300017792 | Bacteria | 36952 |
| 201 | Ga0213876_10049154 | 3300021384 | Bacteria | 2228 |
| 202 | Ga0213876_10058219 | 3300021384 | Bacteria | 2040 |
| 203 | Ga0207672_1001259 | 3300025223 | Bacteria | 2128 |
| 204 | Ga0207696_1000087 | 3300025711 | Bacteria | 194367 |
| 205 | Ga0207710_10000211 | 3300025900 | Bacteria | 52161 |
| 206 | Ga0207710_10077019 | 3300025900 | Unclassified | 1540 |
| 207 | Ga0207680_10000012 | 3300025903 | Bacteria | 293810 |
| 208 | Ga0207680_10006833 | 3300025903 | Bacteria | 5538 |
| 209 | Ga0207685_10107226 | 3300025905 | Bacteria | 1205 |
| 210 | Ga0207699_10016844 | 3300025906 | Bacteria | 3833 |
| 211 | Ga0207699_10133925 | 3300025906 | Unclassified | 1620 |
| 212 | Ga0207707_10000052 | 3300025912 | Bacteria | 117200 |
| 213 | Ga0207707_10032766 | 3300025912 | Bacteria | 4548 |
| 214 | Ga0207707_10033352 | 3300025912 | Bacteria | 4506 |
| 215 | Ga0207707_10037879 | 3300025912 | Bacteria | 4213 |
| 216 | Ga0207707_10080800 | 3300025912 | Bacteria | 2838 |
| 217 | Ga0207695_10004526 | 3300025913 | Bacteria | 18921 |
| 218 | Ga0207695_10022830 | 3300025913 | Bacteria | 7088 |
| 219 | Ga0207695_10059994 | 3300025913 | Bacteria | 3941 |
| 220 | Ga0207695_10240216 | 3300025913 | Bacteria | 1713 |
| 221 | Ga0207695_10384790 | 3300025913 | Bacteria | 1288 |
| 222 | Ga0207695_10427513 | 3300025913 | Bacteria | 1208 |
| 223 | Ga0207671_10054293 | 3300025914 | Bacteria | 2969 |
| 224 | Ga0207671_10231843 | 3300025914 | Unclassified | 1448 |
| 225 | Ga0207671_10233706 | 3300025914 | Bacteria | 1443 |
| 226 | Ga0207693_10000068 | 3300025915 | Bacteria | 91004 |
| 227 | Ga0207693_10023094 | 3300025915 | Bacteria | 4939 |
| 228 | Ga0207693_10225008 | 3300025915 | Bacteria | 1474 |
| 229 | Ga0207660_10030573 | 3300025917 | Bacteria | 3703 |
| 230 | Ga0207660_10254264 | 3300025917 | Bacteria | 1387 |
| 231 | Ga0207649_10156095 | 3300025920 | Bacteria | 1577 |
| 232 | Ga0207652_10001360 | 3300025921 | Bacteria | 21746 |
| 233 | Ga0207652_10038665 | 3300025921 | Bacteria | 4047 |
| 234 | Ga0207652_10091589 | 3300025921 | Bacteria | 2674 |
| 235 | Ga0207652_10221606 | 3300025921 | Bacteria | 1704 |
| 236 | Ga0207652_10234212 | 3300025921 | Bacteria | 1655 |
| 237 | Ga0207681_10000789 | 3300025923 | Bacteria | 20864 |
| 238 | Ga0207681_10127922 | 3300025923 | Bacteria | 1874 |
| 239 | Ga0207694_10008773 | 3300025924 | Bacteria | 7627 |
| 240 | Ga0207694_10116818 | 3300025924 | Bacteria | 2126 |
| 241 | Ga0207650_10000008 | 3300025925 | Bacteria | 498534 |
| 242 | Ga0207650_10024429 | 3300025925 | Bacteria | 4296 |
| 243 | Ga0207659_10135993 | 3300025926 | Unclassified | 1902 |
| 244 | Ga0207700_10013028 | 3300025928 | Bacteria | 5392 |
| 245 | Ga0207644_10000984 | 3300025931 | Bacteria | 18201 |
| 246 | Ga0207644_10144561 | 3300025931 | Bacteria | 1835 |
| 247 | Ga0207670_10052029 | 3300025936 | Unclassified | 2753 |
| 248 | Ga0207665_10089478 | 3300025939 | Bacteria | 2132 |
| 249 | Ga0207665_10204176 | 3300025939 | Bacteria | 1441 |
| 250 | Ga0207691_10003462 | 3300025940 | Bacteria | 15357 |
| 251 | Ga0207711_10003442 | 3300025941 | Bacteria | 13693 |
| 252 | Ga0207711_10003727 | 3300025941 | Bacteria | 13139 |
| 253 | Ga0207711_10005222 | 3300025941 | Bacteria | 11005 |
| 254 | Ga0207711_10007110 | 3300025941 | Bacteria | 9379 |
| 255 | Ga0207711_10027393 | 3300025941 | Bacteria | 4786 |
| 256 | Ga0207711_10086955 | 3300025941 | Bacteria | 2741 |
| 257 | Ga0207667_10001737 | 3300025949 | Bacteria | 27400 |
| 258 | Ga0207667_10002121 | 3300025949 | Bacteria | 24834 |
| 259 | Ga0207667_10034818 | 3300025949 | Bacteria | 5404 |
| 260 | Ga0207667_10175326 | 3300025949 | Bacteria | 2203 |
| 261 | Ga0207667_10221218 | 3300025949 | Bacteria | 1940 |
| 262 | Ga0207712_10000021 | 3300025961 | Bacteria | 292649 |
| 263 | Ga0207712_10025287 | 3300025961 | Bacteria | 3944 |
| 264 | Ga0207712_10085307 | 3300025961 | Bacteria | 2310 |
| 265 | Ga0207712_10104402 | 3300025961 | Bacteria | 2113 |
| 266 | Ga0207668_10003767 | 3300025972 | Bacteria | 8931 |
| 267 | Ga0207658_10000826 | 3300025986 | Bacteria | 25872 |
| 268 | Ga0207658_10001537 | 3300025986 | Bacteria | 17899 |
| 269 | Ga0207658_10072920 | 3300025986 | Bacteria | 2604 |
| 270 | Ga0207658_10191464 | 3300025986 | Bacteria | 1700 |
| 271 | Ga0207703_10000598 | 3300026035 | Bacteria | 36651 |
| 272 | Ga0207703_10000835 | 3300026035 | Bacteria | 30300 |
| 273 | Ga0207703_10003208 | 3300026035 | Bacteria | 13760 |
| 274 | Ga0207703_10004010 | 3300026035 | Bacteria | 12189 |
| 275 | Ga0207703_10005491 | 3300026035 | Bacteria | 10191 |
| 276 | Ga0207703_10006054 | 3300026035 | Bacteria | 9674 |
| 277 | Ga0207639_10003079 | 3300026041 | Bacteria | 11204 |
| 278 | Ga0207639_10263549 | 3300026041 | Bacteria | 1508 |
| 279 | Ga0207708_10007487 | 3300026075 | Bacteria | 8070 |
| 280 | Ga0207702_10123805 | 3300026078 | Bacteria | 2318 |
| 281 | Ga0207641_10000410 | 3300026088 | Bacteria | 50167 |
| 282 | Ga0207641_10000687 | 3300026088 | Bacteria | 36473 |
| 283 | Ga0207641_10001145 | 3300026088 | Bacteria | 26648 |
| 284 | Ga0207648_10104394 | 3300026089 | Bacteria | 2485 |
| 285 | Ga0207676_10001060 | 3300026095 | Bacteria | 20944 |
| 286 | Ga0207676_10005223 | 3300026095 | Bacteria | 9193 |
| 287 | Ga0207676_10120313 | 3300026095 | Unclassified | 2213 |
| 288 | Ga0207675_100014279 | 3300026118 | Bacteria | 7402 |
| 289 | Ga0207675_100016593 | 3300026118 | Bacteria | 6878 |
| 290 | Ga0207675_100040576 | 3300026118 | Bacteria | 4347 |
| 291 | Ga0207675_100043825 | 3300026118 | Bacteria | 4179 |
| 292 | Ga0207683_10004921 | 3300026121 | Bacteria | 11492 |
| 293 | Ga0268266_10000054 | 3300028379 | Bacteria | 292717 |
| 294 | Ga0268266_10001861 | 3300028379 | Bacteria | 23842 |
| 295 | Ga0268266_10013408 | 3300028379 | Bacteria | 7059 |
| 296 | Ga0268266_10020712 | 3300028379 | Bacteria | 5605 |
| 297 | Ga0268266_10043416 | 3300028379 | Bacteria | 3842 |
| 298 | Ga0268266_10388307 | 3300028379 | Bacteria | 1318 |
| 299 | Ga0268265_10000278 | 3300028380 | Bacteria | 58293 |
| 300 | Ga0268265_10001366 | 3300028380 | Bacteria | 20776 |
| 301 | Ga0268264_10000452 | 3300028381 | Bacteria | 56001 |
| 302 | Ga0268264_10000764 | 3300028381 | Bacteria | 35781 |
| 303 | Ga0268264_10132305 | 3300028381 | Unclassified | 2213 |
| 304 | Ga0268264_10244470 | 3300028381 | Bacteria | 1664 |
| 305 | Ga0265319_1013175 | 3300028563 | Bacteria | 3303 |
| 306 | Ga0265318_10019126 | 3300028577 | Bacteria | 2781 |
| 307 | Ga0307515_10042996 | 3300028794 | Bacteria | 7042 |
| 308 | Ga0265338_10023510 | 3300028800 | Bacteria | 6333 |
| 309 | Ga0265338_10036900 | 3300028800 | Bacteria | 4665 |
| 310 | Ga0307511_10000052 | 3300030521 | Bacteria | 96724 |
| 311 | Ga0265762_1000082 | 3300030760 | Bacteria | 12686 |
| 312 | Ga0265320_10001142 | 3300031240 | Bacteria | 19529 |
| 313 | Ga0265320_10088522 | 3300031240 | Bacteria | 1436 |
| 314 | Ga0265325_10046329 | 3300031241 | Bacteria | 2256 |
| 315 | Ga0265340_10050925 | 3300031247 | Bacteria | 2007 |
| 316 | Ga0265339_10027547 | 3300031249 | Bacteria | 3242 |
| 317 | Ga0307513_10100182 | 3300031456 | Bacteria | 2923 |
| 318 | Ga0307509_10000030 | 3300031507 | Bacteria | 206541 |
| 319 | Ga0307509_10000038 | 3300031507 | Bacteria | 188458 |
| 320 | Ga0307408_100107788 | 3300031548 | Bacteria | 2134 |
| 321 | Ga0265314_10001476 | 3300031711 | Bacteria | 26149 |
| 322 | Ga0265314_10016642 | 3300031711 | Bacteria | 5799 |
| 323 | Ga0265342_10223072 | 3300031712 | Bacteria | 1015 |
| 324 | Ga0316576_10064543 | 3300031727 | Bacteria | 2690 |
| 325 | Ga0307516_10297726 | 3300031730 | Bacteria | 1290 |
| 326 | Ga0307410_10008996 | 3300031852 | Bacteria | 5575 |
| 327 | Ga0307406_10025159 | 3300031901 | Bacteria | 3562 |
| 328 | Ga0307412_10009432 | 3300031911 | Bacteria | 5601 |
| 329 | Ga0307409_100017022 | 3300031995 | Bacteria | 4831 |
| 330 | Ga0307416_100030796 | 3300032002 | Bacteria | 4030 |
| 331 | Ga0307411_10075443 | 3300032005 | Bacteria | 2302 |
| 332 | Ga0307415_100049989 | 3300032126 | Bacteria | 2830 |
| 333 | Ga0307510_10000001 | 3300033180 | Bacteria | 1172244 |
| 334 | Ga0307510_10039625 | 3300033180 | Bacteria | 5187 |
| 335 | Ga0373936_0003657 | 3300035113 | Bacteria | 5771 |
| 336 | Ga0373939_0003891 | 3300035114 | Bacteria | 3514 |
| 337 | Ga0373956_0108432 | 3300035119 | Bacteria | 1291 |
| 338 | Ga0373955_0023147 | 3300035172 | Bacteria | 3161 |
| 339 | Ga0373924_0086719 | 3300035410 | Unclassified | 1336 |
| 340 | Ga0373927_0004671 | 3300035695 | Bacteria | 9549 |
| 341 | Ga0373937_0042746 | 3300036401 | Bacteria | 4134 |
| 342 | Ga0373937_0071450 | 3300036401 | Bacteria | 3201 |
| 343 | Ga0373937_0151201 | 3300036401 | Bacteria | 2174 |
| 344 | Ga0373937_0209312 | 3300036401 | Bacteria | 1835 |
| 345 | Ga0373937_0291747 | 3300036401 | Unclassified | 1541 |
| 346 | Ga0373925_0132890 | 3300037068 | Bacteria | 1942 |
| 347 | Ga0373925_0296847 | 3300037068 | Unclassified | 1304 |
| 348 | Ga0395899_0056083 | 3300037312 | Bacteria | 2913 |
| 349 | Ga0395898_0002975 | 3300037466 | Bacteria | 19261 |
| 350 | Ga0436364_1543409 | 3300037853 | Bacteria | 1941 |
| 351 | Ga0395901_0023745 | 3300038443 | Bacteria | 6287 |
| 352 | Ga0395901_0099439 | 3300038443 | Bacteria | 3050 |
| 353 | Ga0436365_0663773 | 3300039437 | Unclassified | 1917 |
| 354 | Ga0436365_0704614 | 3300039437 | Bacteria | 2674 |
| 355 | Ga0436365_1314214 | 3300039437 | Bacteria | 2592 |
| 356 | Ga0436365_1532621 | 3300039437 | Bacteria | 4878 |
| 357 | Ga0439436_0006197 | 3300041404 | Bacteria | 3671 |
| 358 | Ga0439439_0006671 | 3300041406 | Bacteria | 2674 |
| 359 | Ga0439457_000901 | 3300042014 | Bacteria | 8970 |
| 360 | Ga0466969_0002840 | 3300044656 | Bacteria | 9267 |
| 361 | Ga0466969_0062200 | 3300044656 | Bacteria | 1812 |
| 362 | Ga0466961_0098368 | 3300044693 | Bacteria | 1844 |
| 363 | Ga0466963_0182896 | 3300044694 | Bacteria | 1464 |
| 364 | Ga0466964_0006235 | 3300044706 | Bacteria | 4444 |
| 365 | Ga0466964_0028375 | 3300044706 | Bacteria | 2205 |
| 366 | Ga0466971_0039341 | 3300044719 | Unclassified | 2122 |
| 367 | Ga0466957_0047879 | 3300044842 | Bacteria | 2598 |
| 368 | Ga0466960_0022492 | 3300044901 | Bacteria | 2819 |
| 369 | Ga0466960_0040119 | 3300044901 | Bacteria | 2212 |
| 370 | Ga0466959_0033955 | 3300045049 | Bacteria | 3774 |
| 371 | Ga0466959_0171424 | 3300045049 | Bacteria | 1522 |
| 372 | Ga0466967_0089650 | 3300045976 | Bacteria | 2792 |
| 373 | Ga0495592_0037734 | 3300046454 | Bacteria | 3637 |
| 374 | Ga0495590_0022124 | 3300046457 | Bacteria | 2250 |
| 375 | Ga0495629_0025064 | 3300046459 | Bacteria | 4242 |
| 376 | Ga0495651_0139927 | 3300046462 | Bacteria | 1756 |
| 377 | Ga0495653_0020380 | 3300046463 | Bacteria | 5377 |
| 378 | Ga0495653_0124380 | 3300046463 | Bacteria | 1833 |
| 379 | Ga0495580_0005250 | 3300046472 | Bacteria | 10764 |
| 380 | Ga0495616_0007532 | 3300046513 | Bacteria | 6516 |
| 381 | Ga0495628_0046335 | 3300046516 | Bacteria | 3454 |
| 382 | Ga0495643_0060219 | 3300046522 | Bacteria | 2016 |
| 383 | Ga0495652_0030687 | 3300046529 | Bacteria | 4711 |
| 384 | Ga0495587_0063438 | 3300046536 | Bacteria | 2161 |
| 385 | Ga0495645_0139249 | 3300046543 | Unclassified | 1694 |
| 386 | Ga0495667_0006844 | 3300046559 | Bacteria | 7739 |
| 387 | Ga0495625_0065419 | 3300046660 | Bacteria | 2563 |
| 388 | Ga0495623_0077532 | 3300046679 | Bacteria | 2060 |
| 389 | Ga0495604_0147679 | 3300047317 | Bacteria | 1674 |
| 390 | Ga0495674_0065988 | 3300047319 | Bacteria | 3142 |
| 391 | Ga0495680_0026972 | 3300047322 | Bacteria | 4727 |
| 392 | Ga0495680_0032363 | 3300047322 | Bacteria | 4246 |
| 393 | Ga0495680_0316517 | 3300047322 | Bacteria | 1093 |
| 394 | Ga0495675_0112324 | 3300047444 | Bacteria | 1700 |
| 395 | Ga0495602_0038639 | 3300048088 | Bacteria | 4410 |
| 396 | Ga0495602_0107670 | 3300048088 | Bacteria | 2271 |
| 397 | Ga0496100_0029273 | 3300048903 | Bacteria | 3404 |
| 398 | Ga0496100_0042337 | 3300048903 | Bacteria | 2909 |
| 399 | Ga0496101_0005953 | 3300048904 | Bacteria | 7814 |
| 400 | Ga0496102_0004550 | 3300048905 | Bacteria | 11721 |
| 401 | Ga0496102_0148953 | 3300048905 | Bacteria | 2198 |
| 402 | Ga0496102_0169615 | 3300048905 | Bacteria | 2054 |
| 403 | Ga0496103_0010364 | 3300048906 | Bacteria | 5515 |
| 404 | Ga0496104_0008673 | 3300048907 | Bacteria | 9042 |
| 405 | Ga0496104_0033716 | 3300048907 | Bacteria | 4771 |
| 406 | Ga0496104_0071784 | 3300048907 | Bacteria | 3291 |
| 407 | Ga0496105_0003391 | 3300048908 | Bacteria | 11779 |
| 408 | Ga0496105_0021391 | 3300048908 | Bacteria | 5234 |
| 409 | Ga0496108_0004690 | 3300048911 | Bacteria | 11020 |
| 410 | Ga0496108_0103155 | 3300048911 | Bacteria | 2433 |
| 411 | Ga0496108_0455658 | 3300048911 | Unclassified | 1117 |
| 412 | Ga0496109_0003527 | 3300048912 | Bacteria | 13056 |
| 413 | Ga0496109_0028915 | 3300048912 | Bacteria | 4962 |
| 414 | Ga0496109_0173442 | 3300048912 | Bacteria | 2024 |
| 415 | Ga0496110_0005766 | 3300048913 | Bacteria | 9729 |
| 416 | Ga0496110_0057114 | 3300048913 | Bacteria | 3435 |
| 417 | Ga0496111_0019835 | 3300048914 | Bacteria | 4675 |
| 418 | Ga0496111_0133567 | 3300048914 | Bacteria | 1837 |
| 419 | Ga0496113_0048558 | 3300048916 | Bacteria | 3158 |
| 420 | Ga0496116_0016159 | 3300048919 | Bacteria | 5858 |
| 421 | Ga0496116_0054658 | 3300048919 | Bacteria | 2628 |
| 422 | Ga0496117_0000102 | 3300048920 | Bacteria | 189959 |
| 423 | Ga0496117_0000243 | 3300048920 | Bacteria | 103093 |
| 424 | Ga0496117_0063369 | 3300048920 | Bacteria | 2527 |
| 425 | Ga0496118_0000038 | 3300048921 | Bacteria | 315464 |
| 426 | Ga0496118_0000064 | 3300048921 | Bacteria | 212626 |
| 427 | Ga0496118_0038217 | 3300048921 | Bacteria | 3850 |
| 428 | Ga0496118_0041037 | 3300048921 | Bacteria | 3670 |
| 429 | Ga0496118_0159783 | 3300048921 | Bacteria | 1395 |
| 430 | Ga0496119_0012169 | 3300048922 | Bacteria | 7020 |
| 431 | Ga0496119_0026733 | 3300048922 | Bacteria | 3991 |
| 432 | Ga0496119_0027381 | 3300048922 | Bacteria | 3918 |
| 433 | Ga0496119_0027952 | 3300048922 | Bacteria | 3863 |
| 434 | Ga0496120_0007792 | 3300048923 | Bacteria | 7909 |
| 435 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 436 | Ga0496121_0001266 | 3300048924 | Bacteria | 43597 |
| 437 | Ga0496121_0116197 | 3300048924 | Bacteria | 2030 |
| 438 | Ga0496121_0180687 | 3300048924 | Bacteria | 1523 |
| 439 | Ga0496124_0011497 | 3300048927 | Bacteria | 8840 |
| 440 | Ga0496125_0001517 | 3300048928 | Bacteria | 33276 |
| 441 | Ga0496125_0005299 | 3300048928 | Bacteria | 14426 |
| 442 | Ga0496125_0028238 | 3300048928 | Bacteria | 5073 |
| 443 | Ga0496125_0062327 | 3300048928 | Bacteria | 2983 |
| 444 | Ga0496126_0001431 | 3300048929 | Bacteria | 37495 |
| 445 | Ga0496126_0017620 | 3300048929 | Bacteria | 7115 |
| 446 | Ga0496126_0285087 | 3300048929 | Unclassified | 1367 |
| 447 | Ga0501033_0015436 | 3300049570 | Bacteria | 5795 |
| 448 | Ga0501036_0009960 | 3300049572 | Bacteria | 7827 |
| 449 | Ga0501038_0009562 | 3300049574 | Bacteria | 8894 |
| 450 | Ga0501038_0057938 | 3300049574 | Bacteria | 3324 |
| 451 | Ga0501039_0004427 | 3300049575 | Bacteria | 10605 |
| 452 | Ga0501039_0047346 | 3300049575 | Bacteria | 3323 |
| 453 | Ga0501039_0138858 | 3300049575 | Bacteria | 1908 |
| 454 | Ga0501040_0000385 | 3300049576 | Bacteria | 25982 |
| 455 | Ga0501040_0000935 | 3300049576 | Bacteria | 18371 |
| 456 | Ga0501040_0036964 | 3300049576 | Bacteria | 3315 |
| 457 | Ga0501041_0000783 | 3300049577 | Bacteria | 17044 |
| 458 | Ga0501041_0053709 | 3300049577 | Bacteria | 2457 |
| 459 | Ga0501042_0006031 | 3300049578 | Bacteria | 7846 |
| 460 | Ga0501042_0013005 | 3300049578 | Bacteria | 5655 |
| 461 | Ga0501042_0060233 | 3300049578 | Bacteria | 2711 |
| 462 | Ga0501043_0095034 | 3300049579 | Bacteria | 2343 |
| 463 | Ga0501046_0005749 | 3300049580 | Bacteria | 11068 |
| 464 | Ga0501048_0011210 | 3300049582 | Bacteria | 6682 |
| 465 | Ga0501048_0026240 | 3300049582 | Bacteria | 4242 |
| 466 | Ga0501068_0014136 | 3300049584 | Bacteria | 4558 |
| 467 | Ga0501070_0350509 | 3300049586 | Bacteria | 1198 |
| 468 | Ga0501071_0000011 | 3300049587 | Bacteria | 63363 |
| 469 | Ga0501071_0003323 | 3300049587 | Bacteria | 10045 |
| 470 | Ga0501071_0026836 | 3300049587 | Bacteria | 4046 |
| 471 | Ga0501072_0000640 | 3300049588 | Bacteria | 25105 |
| 472 | Ga0501072_0007087 | 3300049588 | Bacteria | 8509 |
| 473 | Ga0501072_0008703 | 3300049588 | Bacteria | 7705 |
| 474 | Ga0501074_0013146 | 3300049590 | Bacteria | 6020 |
| 475 | Ga0501075_0000086 | 3300049591 | Bacteria | 42180 |
| 476 | Ga0501075_0013981 | 3300049591 | Bacteria | 5744 |
| 477 | Ga0501075_0058277 | 3300049591 | Bacteria | 2908 |
| 478 | Ga0501075_0071879 | 3300049591 | Bacteria | 2615 |
| 479 | Ga0501076_0000277 | 3300049592 | Bacteria | 31910 |
| 480 | Ga0501076_0006663 | 3300049592 | Bacteria | 8378 |
| 481 | Ga0501076_0033975 | 3300049592 | Bacteria | 3983 |
| 482 | Ga0501077_0002412 | 3300049593 | Bacteria | 11223 |
| 483 | Ga0501077_0052145 | 3300049593 | Bacteria | 2598 |
| 484 | Ga0501079_0000209 | 3300049741 | Bacteria | 34318 |
| 485 | Ga0501080_0007768 | 3300049742 | Bacteria | 9696 |
| 486 | Ga0501081_0001058 | 3300049743 | Bacteria | 16514 |
| 487 | Ga0501081_0194491 | 3300049743 | Bacteria | 1469 |
| 488 | Ga0501083_0013635 | 3300049744 | Bacteria | 5683 |
| 489 | Ga0501083_0100217 | 3300049744 | Bacteria | 1910 |
| 490 | Ga0501035_0045820 | 3300049822 | Bacteria | 3934 |
| 491 | Ga0501035_0079672 | 3300049822 | Bacteria | 2893 |
| 492 | Ga0501045_0000055 | 3300049824 | Bacteria | 51250 |
| 493 | Ga0501045_0052740 | 3300049824 | Bacteria | 2970 |
| 494 | Ga0501045_0149932 | 3300049824 | Bacteria | 1735 |
| 495 | nmdc:mga08y16_365800_c1 | 3300050511 | Bacteria | 1480 |
| 496 | Ga0495619_0021174 | 3300053085 | Bacteria | 4149 |
| 497 | Ga0495619_0062923 | 3300053085 | Bacteria | 2471 |
| 498 | Ga0500583_0017966 | 3300053092 | Bacteria | 2864 |
| 499 | Ga0500556_0060132 | 3300053104 | Bacteria | 1398 |
| 500 | Ga0500608_067126 | 3300053122 | Bacteria | 1709 |
| 501 | Ga0500588_0005597 | 3300053146 | Bacteria | 2799 |
| 502 | Ga0500588_0052154 | 3300053146 | Bacteria | 1279 |
| 503 | Ga0500616_0000011 | 3300053153 | Bacteria | 732880 |
| 504 | Ga0500622_0003625 | 3300053156 | Bacteria | 10146 |
| 505 | Ga0500637_0028948 | 3300053178 | Bacteria | 3069 |
| 506 | Ga0500645_005378 | 3300053730 | Bacteria | 4727 |
| 507 | Ga0501084_0008126 | 3300054114 | Bacteria | 8645 |
| 508 | Ga0501084_0010556 | 3300054114 | Bacteria | 7640 |
| 509 | Ga0501084_0022271 | 3300054114 | Bacteria | 5288 |
| 510 | Ga0501082_0000298 | 3300060353 | Bacteria | 43791 |
| 511 | Ga0501082_0028612 | 3300060353 | Bacteria | 4800 |
| 512 | Ga0466962_0011940 | 3300061719 | Bacteria | 4179 |
| 513 | Ga0530510_0000228 | 3300061734 | Bacteria | 35067 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049586 | Ga0501070_0350509 | Ga0501070_0350509_385_1188 | 262 |
| 2 | 3300044694 | Ga0466963_0182896 | Ga0466963_0182896_171_1079 | 297 |
| 3 | 3300045976 | Ga0466967_0089650 | Ga0466967_0089650_138_1046 | 297 |
| 4 | 3300028563 | Ga0265319_1013175 | Ga0265319_10131752 | 301 |
| 5 | 3300031240 | Ga0265320_10088522 | Ga0265320_100885222 | 301 |
| 6 | 3300031712 | Ga0265342_10223072 | Ga0265342_102230721 | 301 |
| 7 | 3300047319 | Ga0495674_0065988 | Ga0495674_0065988_2128_3063 | 301 |
| 8 | 3300047322 | Ga0495680_0316517 | Ga0495680_0316517_58_993 | 301 |
| 9 | 3300005441 | Ga0070700_100021039 | Ga0070700_1000210393 | 311 |
| 10 | 3300005719 | Ga0068861_100075441 | Ga0068861_1000754412 | 311 |
| 11 | 3300026075 | Ga0207708_10007487 | Ga0207708_100074873 | 311 |
| 12 | 3300026089 | Ga0207648_10104394 | Ga0207648_101043942 | 312 |
| 13 | 3300048929 | Ga0496126_0001431 | Ga0496126_0001431_15641_16705 | 312 |
| 14 | 3300053156 | Ga0500622_0003625 | Ga0500622_0003625_9193_10134 | 312 |
| 15 | 3300046459 | Ga0495629_0025064 | Ga0495629_0025064_2549_3520 | 313 |
| 16 | 3300046463 | Ga0495653_0020380 | Ga0495653_0020380_2204_3175 | 313 |
| 17 | 3300047322 | Ga0495680_0032363 | Ga0495680_0032363_2055_3026 | 313 |
| 18 | 3300053085 | Ga0495619_0021174 | Ga0495619_0021174_397_1368 | 313 |
| 19 | 3300009094 | Ga0111539_10517130 | Ga0111539_105171302 | 316 |
| 20 | 3300050511 | nmdc:mga08y16_365800_c1 | nmdc:mga08y16_365800_c1_133_1182 | 316 |
| 21 | 3300028577 | Ga0265318_10019126 | Ga0265318_100191262 | 319 |
| 22 | 3300006163 | Ga0070715_10035074 | Ga0070715_100350743 | 320 |
| 23 | 3300025905 | Ga0207685_10107226 | Ga0207685_101072262 | 320 |
| 24 | 3300025914 | Ga0207671_10231843 | Ga0207671_102318432 | 320 |
| 25 | 3300005354 | Ga0070675_100012163 | Ga0070675_1000121632 | 322 |
| 26 | 3300014326 | Ga0157380_10023951 | Ga0157380_100239514 | 322 |
| 27 | 3300025926 | Ga0207659_10135993 | Ga0207659_101359932 | 322 |
| 28 | 3300009553 | Ga0105249_10161564 | Ga0105249_101615642 | 323 |
| 29 | 3300013306 | Ga0163162_10044469 | Ga0163162_100444693 | 323 |
| 30 | 3300005548 | Ga0070665_100005884 | Ga0070665_1000058843 | 324 |
| 31 | 3300005617 | Ga0068859_100480597 | Ga0068859_1004805972 | 324 |
| 32 | 3300006931 | Ga0097620_100480615 | Ga0097620_1004806152 | 324 |
| 33 | 3300028379 | Ga0268266_10001861 | Ga0268266_100018618 | 324 |
| 34 | 3300009553 | Ga0105249_10005825 | Ga0105249_100058252 | 326 |
| 35 | 3300005530 | Ga0070679_100134978 | Ga0070679_1001349782 | 328 |
| 36 | 3300025921 | Ga0207652_10221606 | Ga0207652_102216062 | 328 |
| 37 | 3300005614 | Ga0068856_100109271 | Ga0068856_1001092712 | 329 |
| 38 | 3300005841 | Ga0068863_100009831 | Ga0068863_1000098316 | 329 |
| 39 | 3300005843 | Ga0068860_100000475 | Ga0068860_10000047521 | 329 |
| 40 | 3300025986 | Ga0207658_10191464 | Ga0207658_101914642 | 329 |
| 41 | 3300026078 | Ga0207702_10123805 | Ga0207702_101238052 | 329 |
| 42 | 3300026088 | Ga0207641_10001145 | Ga0207641_100011457 | 329 |
| 43 | 3300028381 | Ga0268264_10000452 | Ga0268264_1000045213 | 329 |
| 44 | 3300048903 | Ga0496100_0042337 | Ga0496100_0042337_764_1804 | 329 |
| 45 | 3300005353 | Ga0070669_100001464 | Ga0070669_10000146412 | 331 |
| 46 | 3300025923 | Ga0207681_10000789 | Ga0207681_1000078916 | 331 |
| 47 | 3300013307 | Ga0157372_10216573 | Ga0157372_102165732 | 333 |
| 48 | 3300046516 | Ga0495628_0046335 | Ga0495628_0046335_2096_3151 | 333 |
| 49 | 3300005539 | Ga0068853_100274902 | Ga0068853_1002749022 | 334 |
| 50 | 3300005530 | Ga0070679_100425217 | Ga0070679_1004252172 | 335 |
| 51 | 3300005548 | Ga0070665_100036879 | Ga0070665_1000368793 | 335 |
| 52 | 3300013105 | Ga0157369_10222108 | Ga0157369_102221083 | 335 |
| 53 | 3300025917 | Ga0207660_10254264 | Ga0207660_102542642 | 335 |
| 54 | 3300025921 | Ga0207652_10234212 | Ga0207652_102342121 | 335 |
| 55 | 3300028379 | Ga0268266_10020712 | Ga0268266_100207123 | 335 |
| 56 | 3300031456 | Ga0307513_10100182 | Ga0307513_101001823 | 335 |
| 57 | 3300038443 | Ga0395901_0023745 | Ga0395901_0023745_1146_2177 | 335 |
| 58 | 3300044901 | Ga0466960_0040119 | Ga0466960_0040119_762_1793 | 335 |
| 59 | 3300002076 | JGI24749J21850_1001361 | JGI24749J21850_10013613 | 336 |
| 60 | 3300002459 | JGI24751J29686_10000254 | JGI24751J29686_1000025416 | 336 |
| 61 | 3300005331 | Ga0070670_100011691 | Ga0070670_1000116912 | 336 |
| 62 | 3300005367 | Ga0070667_100092108 | Ga0070667_1000921083 | 336 |
| 63 | 3300005617 | Ga0068859_100030049 | Ga0068859_1000300493 | 336 |
| 64 | 3300005618 | Ga0068864_100075105 | Ga0068864_1000751052 | 336 |
| 65 | 3300006931 | Ga0097620_100030047 | Ga0097620_1000300473 | 336 |
| 66 | 3300009177 | Ga0105248_10018831 | Ga0105248_100188317 | 336 |
| 67 | 3300025925 | Ga0207650_10000008 | Ga0207650_10000008410 | 336 |
| 68 | 3300025941 | Ga0207711_10086955 | Ga0207711_100869552 | 336 |
| 69 | 3300025986 | Ga0207658_10072920 | Ga0207658_100729203 | 336 |
| 70 | 3300026095 | Ga0207676_10001060 | Ga0207676_1000106015 | 336 |
| 71 | 3300031548 | Ga0307408_100107788 | Ga0307408_1001077882 | 336 |
| 72 | 3300031852 | Ga0307410_10008996 | Ga0307410_100089963 | 336 |
| 73 | 3300031901 | Ga0307406_10025159 | Ga0307406_100251593 | 336 |
| 74 | 3300031995 | Ga0307409_100017022 | Ga0307409_1000170223 | 336 |
| 75 | 3300032002 | Ga0307416_100030796 | Ga0307416_1000307963 | 336 |
| 76 | 3300032005 | Ga0307411_10075443 | Ga0307411_100754432 | 336 |
| 77 | 3300032126 | Ga0307415_100049989 | Ga0307415_1000499893 | 336 |
| 78 | 3300005458 | Ga0070681_10144445 | Ga0070681_101444452 | 337 |
| 79 | 3300037312 | Ga0395899_0056083 | Ga0395899_0056083_783_1826 | 337 |
| 80 | 3300038443 | Ga0395901_0099439 | Ga0395901_0099439_34_1077 | 337 |
| 81 | 3300006237 | Ga0097621_100144413 | Ga0097621_1001444132 | 338 |
| 82 | 3300006358 | Ga0068871_100088479 | Ga0068871_1000884791 | 338 |
| 83 | 3300033180 | Ga0307510_10000001 | Ga0307510_10000001578 | 338 |
| 84 | 3300046536 | Ga0495587_0063438 | Ga0495587_0063438_847_1902 | 338 |
| 85 | iso_pu_bacteria | 2896253425 | 2896255827 | 338 |
| 86 | 3300031249 | Ga0265339_10027547 | Ga0265339_100275472 | 340 |
| 87 | 3300035410 | Ga0373924_0086719 | Ga0373924_0086719_247_1296 | 340 |
| 88 | 3300036401 | Ga0373937_0291747 | Ga0373937_0291747_347_1396 | 340 |
| 89 | 3300044901 | Ga0466960_0022492 | Ga0466960_0022492_1413_2516 | 340 |
| 90 | 3300003203 | JGI25406J46586_10002597 | JGI25406J46586_100025973 | 341 |
| 91 | 3300005985 | Ga0081539_10001877 | Ga0081539_1000187725 | 341 |
| 92 | 3300013105 | Ga0157369_10251005 | Ga0157369_102510051 | 341 |
| 93 | 3300021384 | Ga0213876_10049154 | Ga0213876_100491543 | 341 |
| 94 | 3300031240 | Ga0265320_10001142 | Ga0265320_100011422 | 341 |
| 95 | 3300031241 | Ga0265325_10046329 | Ga0265325_100463292 | 341 |
| 96 | 3300039437 | Ga0436365_0704614 | Ga0436365_0704614_1207_2271 | 341 |
| 97 | 3300028800 | Ga0265338_10036900 | Ga0265338_100369003 | 342 |
| 98 | 3300031711 | Ga0265314_10001476 | Ga0265314_1000147629 | 342 |
| 99 | 3300031711 | Ga0265314_10016642 | Ga0265314_100166424 | 342 |
| 100 | 3300035114 | Ga0373939_0003891 | Ga0373939_0003891_61_1122 | 342 |
| 101 | 3300005563 | Ga0068855_100052307 | Ga0068855_1000523072 | 344 |
| 102 | 3300005563 | Ga0068855_100335078 | Ga0068855_1003350782 | 344 |
| 103 | 3300006175 | Ga0070712_100185810 | Ga0070712_1001858102 | 344 |
| 104 | 3300009093 | Ga0105240_10341923 | Ga0105240_103419233 | 344 |
| 105 | 3300021384 | Ga0213876_10058219 | Ga0213876_100582192 | 344 |
| 106 | 3300025915 | Ga0207693_10225008 | Ga0207693_102250082 | 344 |
| 107 | 3300025928 | Ga0207700_10013028 | Ga0207700_100130285 | 344 |
| 108 | 3300025949 | Ga0207667_10175326 | Ga0207667_101753261 | 344 |
| 109 | 3300039437 | Ga0436365_1532621 | Ga0436365_1532621_2145_3188 | 344 |
| 110 | 3300044656 | Ga0466969_0062200 | Ga0466969_0062200_95_1135 | 344 |
| 111 | 3300044706 | Ga0466964_0028375 | Ga0466964_0028375_434_1513 | 344 |
| 112 | 3300046457 | Ga0495590_0022124 | Ga0495590_0022124_935_1969 | 344 |
| 113 | 3300046513 | Ga0495616_0007532 | Ga0495616_0007532_4131_5168 | 344 |
| 114 | 3300046543 | Ga0495645_0139249 | Ga0495645_0139249_532_1635 | 344 |
| 115 | 3300046660 | Ga0495625_0065419 | Ga0495625_0065419_228_1265 | 344 |
| 116 | 3300003203 | JGI25406J46586_10028320 | JGI25406J46586_100283202 | 345 |
| 117 | 3300005985 | Ga0081539_10000028 | Ga0081539_1000002868 | 345 |
| 118 | 3300025923 | Ga0207681_10127922 | Ga0207681_101279222 | 345 |
| 119 | 3300028794 | Ga0307515_10042996 | Ga0307515_100429963 | 345 |
| 120 | 3300035119 | Ga0373956_0108432 | Ga0373956_0108432_190_1266 | 345 |
| 121 | 3300036401 | Ga0373937_0042746 | Ga0373937_0042746_2583_3665 | 345 |
| 122 | 3300036401 | Ga0373937_0151201 | Ga0373937_0151201_806_1882 | 345 |
| 123 | 3300037466 | Ga0395898_0002975 | Ga0395898_0002975_11372_12418 | 345 |
| 124 | 3300037853 | Ga0436364_1543409 | Ga0436364_1543409_704_1789 | 345 |
| 125 | 3300039437 | Ga0436365_1314214 | Ga0436365_1314214_584_1669 | 345 |
| 126 | 3300046454 | Ga0495592_0037734 | Ga0495592_0037734_1263_2339 | 345 |
| 127 | 3300046462 | Ga0495651_0139927 | Ga0495651_0139927_456_1538 | 345 |
| 128 | 3300046463 | Ga0495653_0124380 | Ga0495653_0124380_563_1639 | 345 |
| 129 | 3300046522 | Ga0495643_0060219 | Ga0495643_0060219_118_1161 | 345 |
| 130 | 3300046529 | Ga0495652_0030687 | Ga0495652_0030687_51_1127 | 345 |
| 131 | 3300046559 | Ga0495667_0006844 | Ga0495667_0006844_4903_5979 | 345 |
| 132 | 3300046679 | Ga0495623_0077532 | Ga0495623_0077532_802_1878 | 345 |
| 133 | 3300047317 | Ga0495604_0147679 | Ga0495604_0147679_455_1531 | 345 |
| 134 | 3300047322 | Ga0495680_0026972 | Ga0495680_0026972_709_1785 | 345 |
| 135 | 3300047444 | Ga0495675_0112324 | Ga0495675_0112324_579_1655 | 345 |
| 136 | 3300048088 | Ga0495602_0038639 | Ga0495602_0038639_2422_3504 | 345 |
| 137 | 3300048088 | Ga0495602_0107670 | Ga0495602_0107670_578_1654 | 345 |
| 138 | 3300053085 | Ga0495619_0062923 | Ga0495619_0062923_619_1695 | 345 |
| 139 | 3300001976 | JGI24752J21851_1001581 | JGI24752J21851_10015812 | 346 |
| 140 | 3300002070 | JGI24750J21931_1000603 | JGI24750J21931_10006032 | 346 |
| 141 | 3300002074 | JGI24748J21848_1000109 | JGI24748J21848_100010915 | 346 |
| 142 | 3300002239 | JGI24034J26672_10000060 | JGI24034J26672_1000006040 | 346 |
| 143 | 3300005295 | Ga0065707_10004111 | Ga0065707_100041112 | 346 |
| 144 | 3300005330 | Ga0070690_100000477 | Ga0070690_10000047724 | 346 |
| 145 | 3300005335 | Ga0070666_10000069 | Ga0070666_1000006971 | 346 |
| 146 | 3300005340 | Ga0070689_100023946 | Ga0070689_1000239463 | 346 |
| 147 | 3300005343 | Ga0070687_100203618 | Ga0070687_1002036181 | 346 |
| 148 | 3300005347 | Ga0070668_100034582 | Ga0070668_1000345822 | 346 |
| 149 | 3300005355 | Ga0070671_100071614 | Ga0070671_1000716142 | 346 |
| 150 | 3300005365 | Ga0070688_100001347 | Ga0070688_1000013478 | 346 |
| 151 | 3300005367 | Ga0070667_100119544 | Ga0070667_1001195443 | 346 |
| 152 | 3300005459 | Ga0068867_100045567 | Ga0068867_1000455672 | 346 |
| 153 | 3300005466 | Ga0070685_10000036 | Ga0070685_100000364 | 346 |
| 154 | 3300005544 | Ga0070686_100000045 | Ga0070686_1000000457 | 346 |
| 155 | 3300005544 | Ga0070686_100012129 | Ga0070686_1000121292 | 346 |
| 156 | 3300005548 | Ga0070665_100000042 | Ga0070665_100000042284 | 346 |
| 157 | 3300005617 | Ga0068859_100067629 | Ga0068859_1000676293 | 346 |
| 158 | 3300005618 | Ga0068864_100009265 | Ga0068864_1000092655 | 346 |
| 159 | 3300005841 | Ga0068863_100000955 | Ga0068863_10000095530 | 346 |
| 160 | 3300005842 | Ga0068858_100000659 | Ga0068858_1000006597 | 346 |
| 161 | 3300005842 | Ga0068858_100014775 | Ga0068858_1000147753 | 346 |
| 162 | 3300005843 | Ga0068860_100000182 | Ga0068860_1000001827 | 346 |
| 163 | 3300005843 | Ga0068860_100461597 | Ga0068860_1004615972 | 346 |
| 164 | 3300005844 | Ga0068862_100010842 | Ga0068862_1000108422 | 346 |
| 165 | 3300006931 | Ga0097620_100067623 | Ga0097620_1000676233 | 346 |
| 166 | 3300009011 | Ga0105251_10081524 | Ga0105251_100815242 | 346 |
| 167 | 3300009101 | Ga0105247_10036486 | Ga0105247_100364863 | 346 |
| 168 | 3300009553 | Ga0105249_10000012 | Ga0105249_100000127 | 346 |
| 169 | 3300014325 | Ga0163163_10098096 | Ga0163163_100980962 | 346 |
| 170 | 3300014326 | Ga0157380_10030055 | Ga0157380_100300554 | 346 |
| 171 | 3300014968 | Ga0157379_10013393 | Ga0157379_100133932 | 346 |
| 172 | 3300017792 | Ga0163161_10000387 | Ga0163161_1000038732 | 346 |
| 173 | 3300025223 | Ga0207672_1001259 | Ga0207672_10012593 | 346 |
| 174 | 3300025903 | Ga0207680_10000012 | Ga0207680_10000012279 | 346 |
| 175 | 3300025936 | Ga0207670_10052029 | Ga0207670_100520292 | 346 |
| 176 | 3300025941 | Ga0207711_10007110 | Ga0207711_100071107 | 346 |
| 177 | 3300025941 | Ga0207711_10027393 | Ga0207711_100273933 | 346 |
| 178 | 3300025961 | Ga0207712_10000021 | Ga0207712_10000021279 | 346 |
| 179 | 3300025972 | Ga0207668_10003767 | Ga0207668_100037675 | 346 |
| 180 | 3300025986 | Ga0207658_10000826 | Ga0207658_1000082629 | 346 |
| 181 | 3300026035 | Ga0207703_10004010 | Ga0207703_100040107 | 346 |
| 182 | 3300026088 | Ga0207641_10000410 | Ga0207641_100004107 | 346 |
| 183 | 3300026095 | Ga0207676_10005223 | Ga0207676_100052233 | 346 |
| 184 | 3300026118 | Ga0207675_100014279 | Ga0207675_1000142792 | 346 |
| 185 | 3300026118 | Ga0207675_100016593 | Ga0207675_1000165936 | 346 |
| 186 | 3300028379 | Ga0268266_10000054 | Ga0268266_10000054278 | 346 |
| 187 | 3300028380 | Ga0268265_10000278 | Ga0268265_100002783 | 346 |
| 188 | 3300028380 | Ga0268265_10001366 | Ga0268265_1000136616 | 346 |
| 189 | 3300028381 | Ga0268264_10000764 | Ga0268264_100007647 | 346 |
| 190 | 3300028381 | Ga0268264_10244470 | Ga0268264_102444702 | 346 |
| 191 | 3300031727 | Ga0316576_10064543 | Ga0316576_100645431 | 346 |
| 192 | 3300031911 | Ga0307412_10009432 | Ga0307412_100094324 | 346 |
| 193 | 3300048906 | Ga0496103_0010364 | Ga0496103_0010364_2620_3660 | 346 |
| 194 | 3300048912 | Ga0496109_0173442 | Ga0496109_0173442_751_1791 | 346 |
| 195 | 3300048920 | Ga0496117_0063369 | Ga0496117_0063369_483_1523 | 346 |
| 196 | 3300048921 | Ga0496118_0159783 | Ga0496118_0159783_132_1172 | 346 |
| 197 | 3300048922 | Ga0496119_0027952 | Ga0496119_0027952_2362_3402 | 346 |
| 198 | 3300048924 | Ga0496121_0180687 | Ga0496121_0180687_421_1461 | 346 |
| 199 | 3300049591 | Ga0501075_0071879 | Ga0501075_0071879_1427_2467 | 346 |
| 200 | 3300049824 | Ga0501045_0149932 | Ga0501045_0149932_671_1711 | 346 |
| 201 | 3300005331 | Ga0070670_100087270 | Ga0070670_1000872702 | 347 |
| 202 | 3300005336 | Ga0070680_100015948 | Ga0070680_1000159482 | 347 |
| 203 | 3300005336 | Ga0070680_100184497 | Ga0070680_1001844972 | 347 |
| 204 | 3300005458 | Ga0070681_10009287 | Ga0070681_100092877 | 347 |
| 205 | 3300005458 | Ga0070681_10032878 | Ga0070681_100328784 | 347 |
| 206 | 3300005458 | Ga0070681_10041478 | Ga0070681_100414784 | 347 |
| 207 | 3300005530 | Ga0070679_100000605 | Ga0070679_10000060513 | 347 |
| 208 | 3300005618 | Ga0068864_100000503 | Ga0068864_10000050328 | 347 |
| 209 | 3300005841 | Ga0068863_100000158 | Ga0068863_10000015849 | 347 |
| 210 | 3300005842 | Ga0068858_100000746 | Ga0068858_10000074628 | 347 |
| 211 | 3300005937 | Ga0081455_10001456 | Ga0081455_1000145634 | 347 |
| 212 | 3300006058 | Ga0075432_10021275 | Ga0075432_100212752 | 347 |
| 213 | 3300006173 | Ga0070716_100112458 | Ga0070716_1001124582 | 347 |
| 214 | 3300006844 | Ga0075428_100399279 | Ga0075428_1003992792 | 347 |
| 215 | 3300006852 | Ga0075433_10022222 | Ga0075433_100222225 | 347 |
| 216 | 3300006914 | Ga0075436_100013945 | Ga0075436_1000139452 | 347 |
| 217 | 3300009092 | Ga0105250_10006683 | Ga0105250_100066833 | 347 |
| 218 | 3300009093 | Ga0105240_10007240 | Ga0105240_100072404 | 347 |
| 219 | 3300009093 | Ga0105240_10025594 | Ga0105240_100255943 | 347 |
| 220 | 3300009177 | Ga0105248_10007964 | Ga0105248_100079646 | 347 |
| 221 | 3300009177 | Ga0105248_10236408 | Ga0105248_102364082 | 347 |
| 222 | 3300009551 | Ga0105238_10003749 | Ga0105238_100037493 | 347 |
| 223 | 3300009551 | Ga0105238_10070624 | Ga0105238_100706242 | 347 |
| 224 | 3300013104 | Ga0157370_10002168 | Ga0157370_100021688 | 347 |
| 225 | 3300013104 | Ga0157370_10266187 | Ga0157370_102661872 | 347 |
| 226 | 3300013105 | Ga0157369_10046339 | Ga0157369_100463394 | 347 |
| 227 | 3300025912 | Ga0207707_10000052 | Ga0207707_1000005256 | 347 |
| 228 | 3300025912 | Ga0207707_10032766 | Ga0207707_100327662 | 347 |
| 229 | 3300025912 | Ga0207707_10033352 | Ga0207707_100333522 | 347 |
| 230 | 3300025912 | Ga0207707_10080800 | Ga0207707_100808002 | 347 |
| 231 | 3300025913 | Ga0207695_10004526 | Ga0207695_100045267 | 347 |
| 232 | 3300025913 | Ga0207695_10240216 | Ga0207695_102402162 | 347 |
| 233 | 3300025917 | Ga0207660_10030573 | Ga0207660_100305734 | 347 |
| 234 | 3300025920 | Ga0207649_10156095 | Ga0207649_101560952 | 347 |
| 235 | 3300025921 | Ga0207652_10001360 | Ga0207652_1000136011 | 347 |
| 236 | 3300025921 | Ga0207652_10038665 | Ga0207652_100386654 | 347 |
| 237 | 3300025924 | Ga0207694_10008773 | Ga0207694_100087733 | 347 |
| 238 | 3300025924 | Ga0207694_10116818 | Ga0207694_101168182 | 347 |
| 239 | 3300025925 | Ga0207650_10024429 | Ga0207650_100244293 | 347 |
| 240 | 3300025939 | Ga0207665_10204176 | Ga0207665_102041762 | 347 |
| 241 | 3300025941 | Ga0207711_10003727 | Ga0207711_100037276 | 347 |
| 242 | 3300025941 | Ga0207711_10005222 | Ga0207711_1000522210 | 347 |
| 243 | 3300025949 | Ga0207667_10002121 | Ga0207667_1000212111 | 347 |
| 244 | 3300026035 | Ga0207703_10000598 | Ga0207703_1000059828 | 347 |
| 245 | 3300026088 | Ga0207641_10000687 | Ga0207641_1000068728 | 347 |
| 246 | 3300031730 | Ga0307516_10297726 | Ga0307516_102977262 | 347 |
| 247 | 3300035113 | Ga0373936_0003657 | Ga0373936_0003657_3190_4236 | 347 |
| 248 | 3300037068 | Ga0373925_0132890 | Ga0373925_0132890_213_1259 | 347 |
| 249 | 3300048907 | Ga0496104_0033716 | Ga0496104_0033716_3580_4626 | 347 |
| 250 | 3300048919 | Ga0496116_0016159 | Ga0496116_0016159_1747_2937 | 347 |
| 251 | 3300048920 | Ga0496117_0000102 | Ga0496117_0000102_61351_62541 | 347 |
| 252 | 3300048921 | Ga0496118_0000038 | Ga0496118_0000038_252897_254087 | 347 |
| 253 | 3300048921 | Ga0496118_0041037 | Ga0496118_0041037_372_1424 | 347 |
| 254 | 3300048922 | Ga0496119_0026733 | Ga0496119_0026733_526_1578 | 347 |
| 255 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_373672_374724 | 347 |
| 256 | 3300049574 | Ga0501038_0057938 | Ga0501038_0057938_1344_2450 | 347 |
| 257 | 3300049575 | Ga0501039_0138858 | Ga0501039_0138858_469_1575 | 347 |
| 258 | 3300049576 | Ga0501040_0036964 | Ga0501040_0036964_2081_3187 | 347 |
| 259 | 3300049578 | Ga0501042_0013005 | Ga0501042_0013005_2830_3936 | 347 |
| 260 | 3300049587 | Ga0501071_0003323 | Ga0501071_0003323_6721_7827 | 347 |
| 261 | 3300049588 | Ga0501072_0007087 | Ga0501072_0007087_2957_4063 | 347 |
| 262 | 3300049590 | Ga0501074_0013146 | Ga0501074_0013146_1105_2211 | 347 |
| 263 | 3300049591 | Ga0501075_0013981 | Ga0501075_0013981_2663_3769 | 347 |
| 264 | 3300049592 | Ga0501076_0006663 | Ga0501076_0006663_1422_2528 | 347 |
| 265 | 3300049593 | Ga0501077_0052145 | Ga0501077_0052145_18_1124 | 347 |
| 266 | 3300049743 | Ga0501081_0194491 | Ga0501081_0194491_86_1192 | 347 |
| 267 | 3300049822 | Ga0501035_0079672 | Ga0501035_0079672_1152_2258 | 347 |
| 268 | 3300053104 | Ga0500556_0060132 | Ga0500556_0060132_247_1299 | 347 |
| 269 | 3300053146 | Ga0500588_0052154 | Ga0500588_0052154_122_1174 | 347 |
| 270 | 3300053730 | Ga0500645_005378 | Ga0500645_005378_1144_2187 | 347 |
| 271 | 3300054114 | Ga0501084_0022271 | Ga0501084_0022271_3945_5051 | 347 |
| 272 | 3300003203 | JGI25406J46586_10004413 | JGI25406J46586_100044133 | 348 |
| 273 | 3300003203 | JGI25406J46586_10006724 | JGI25406J46586_100067243 | 348 |
| 274 | 3300005367 | Ga0070667_100299667 | Ga0070667_1002996671 | 348 |
| 275 | 3300005435 | Ga0070714_100189668 | Ga0070714_1001896682 | 348 |
| 276 | 3300005548 | Ga0070665_100086382 | Ga0070665_1000863823 | 348 |
| 277 | 3300005563 | Ga0068855_100004606 | Ga0068855_10000460613 | 348 |
| 278 | 3300005842 | Ga0068858_100005184 | Ga0068858_1000051844 | 348 |
| 279 | 3300005842 | Ga0068858_100012153 | Ga0068858_1000121532 | 348 |
| 280 | 3300005985 | Ga0081539_10000123 | Ga0081539_10000123139 | 348 |
| 281 | 3300009093 | Ga0105240_10016790 | Ga0105240_100167905 | 348 |
| 282 | 3300009101 | Ga0105247_10014370 | Ga0105247_100143705 | 348 |
| 283 | 3300009545 | Ga0105237_10057995 | Ga0105237_100579952 | 348 |
| 284 | 3300009551 | Ga0105238_10045883 | Ga0105238_100458834 | 348 |
| 285 | 3300013105 | Ga0157369_10004809 | Ga0157369_100048098 | 348 |
| 286 | 3300013307 | Ga0157372_10088786 | Ga0157372_100887863 | 348 |
| 287 | 3300013307 | Ga0157372_10329082 | Ga0157372_103290822 | 348 |
| 288 | 3300014968 | Ga0157379_10051310 | Ga0157379_100513102 | 348 |
| 289 | 3300025900 | Ga0207710_10077019 | Ga0207710_100770192 | 348 |
| 290 | 3300025913 | Ga0207695_10022830 | Ga0207695_100228305 | 348 |
| 291 | 3300025913 | Ga0207695_10384790 | Ga0207695_103847901 | 348 |
| 292 | 3300025913 | Ga0207695_10427513 | Ga0207695_104275131 | 348 |
| 293 | 3300025914 | Ga0207671_10054293 | Ga0207671_100542931 | 348 |
| 294 | 3300025949 | Ga0207667_10001737 | Ga0207667_100017372 | 348 |
| 295 | 3300026035 | Ga0207703_10003208 | Ga0207703_100032086 | 348 |
| 296 | 3300026035 | Ga0207703_10005491 | Ga0207703_100054914 | 348 |
| 297 | 3300026118 | Ga0207675_100043825 | Ga0207675_1000438253 | 348 |
| 298 | 3300028379 | Ga0268266_10043416 | Ga0268266_100434162 | 348 |
| 299 | 3300030760 | Ga0265762_1000082 | Ga0265762_10000823 | 348 |
| 300 | 3300039437 | Ga0436365_0663773 | Ga0436365_0663773_265_1314 | 348 |
| 301 | 3300048905 | Ga0496102_0004550 | Ga0496102_0004550_5017_6069 | 348 |
| 302 | 3300048919 | Ga0496116_0054658 | Ga0496116_0054658_788_1840 | 348 |
| 303 | 3300048920 | Ga0496117_0000243 | Ga0496117_0000243_45485_46537 | 348 |
| 304 | 3300048921 | Ga0496118_0000064 | Ga0496118_0000064_76428_77480 | 348 |
| 305 | 3300048922 | Ga0496119_0027381 | Ga0496119_0027381_954_2006 | 348 |
| 306 | 3300048923 | Ga0496120_0007792 | Ga0496120_0007792_4516_5568 | 348 |
| 307 | 3300048927 | Ga0496124_0011497 | Ga0496124_0011497_2267_3319 | 348 |
| 308 | 3300048928 | Ga0496125_0001517 | Ga0496125_0001517_22922_23977 | 348 |
| 309 | 3300048928 | Ga0496125_0028238 | Ga0496125_0028238_3663_4715 | 348 |
| 310 | 3300048929 | Ga0496126_0017620 | Ga0496126_0017620_2560_3612 | 348 |
| 311 | 3300048929 | Ga0496126_0285087 | Ga0496126_0285087_63_1118 | 348 |
| 312 | 3300053122 | Ga0500608_067126 | Ga0500608_067126_300_1370 | 348 |
| 313 | 3300005335 | Ga0070666_10001463 | Ga0070666_1000146310 | 349 |
| 314 | 3300005337 | Ga0070682_100286919 | Ga0070682_1002869191 | 349 |
| 315 | 3300005338 | Ga0068868_100061832 | Ga0068868_1000618322 | 349 |
| 316 | 3300005364 | Ga0070673_100112519 | Ga0070673_1001125192 | 349 |
| 317 | 3300005530 | Ga0070679_100045793 | Ga0070679_1000457933 | 349 |
| 318 | 3300005539 | Ga0068853_100000732 | Ga0068853_10000073211 | 349 |
| 319 | 3300005548 | Ga0070665_100020320 | Ga0070665_1000203203 | 349 |
| 320 | 3300005548 | Ga0070665_100044467 | Ga0070665_1000444674 | 349 |
| 321 | 3300005548 | Ga0070665_100045147 | Ga0070665_1000451475 | 349 |
| 322 | 3300005564 | Ga0070664_100016596 | Ga0070664_1000165964 | 349 |
| 323 | 3300005617 | Ga0068859_100163749 | Ga0068859_1001637493 | 349 |
| 324 | 3300005843 | Ga0068860_100004120 | Ga0068860_1000041205 | 349 |
| 325 | 3300006237 | Ga0097621_100142325 | Ga0097621_1001423252 | 349 |
| 326 | 3300006237 | Ga0097621_100320425 | Ga0097621_1003204252 | 349 |
| 327 | 3300006931 | Ga0097620_100163754 | Ga0097620_1001637543 | 349 |
| 328 | 3300009093 | Ga0105240_10013104 | Ga0105240_100131042 | 349 |
| 329 | 3300009093 | Ga0105240_10026583 | Ga0105240_100265833 | 349 |
| 330 | 3300009093 | Ga0105240_10079534 | Ga0105240_100795342 | 349 |
| 331 | 3300009098 | Ga0105245_10020195 | Ga0105245_100201952 | 349 |
| 332 | 3300009098 | Ga0105245_10095718 | Ga0105245_100957181 | 349 |
| 333 | 3300009101 | Ga0105247_10214336 | Ga0105247_102143361 | 349 |
| 334 | 3300009177 | Ga0105248_10006277 | Ga0105248_100062778 | 349 |
| 335 | 3300009545 | Ga0105237_10225321 | Ga0105237_102253212 | 349 |
| 336 | 3300009553 | Ga0105249_10015437 | Ga0105249_100154371 | 349 |
| 337 | 3300009553 | Ga0105249_10022215 | Ga0105249_100222153 | 349 |
| 338 | 3300009553 | Ga0105249_10046698 | Ga0105249_100466983 | 349 |
| 339 | 3300010375 | Ga0105239_10160926 | Ga0105239_101609261 | 349 |
| 340 | 3300013296 | Ga0157374_10077160 | Ga0157374_100771602 | 349 |
| 341 | 3300013297 | Ga0157378_10024457 | Ga0157378_100244572 | 349 |
| 342 | 3300013308 | Ga0157375_10002928 | Ga0157375_1000292811 | 349 |
| 343 | 3300014325 | Ga0163163_10008759 | Ga0163163_100087592 | 349 |
| 344 | 3300014325 | Ga0163163_10498829 | Ga0163163_104988292 | 349 |
| 345 | 3300014968 | Ga0157379_10001605 | Ga0157379_100016054 | 349 |
| 346 | 3300014969 | Ga0157376_10000910 | Ga0157376_1000091014 | 349 |
| 347 | 3300025903 | Ga0207680_10006833 | Ga0207680_100068334 | 349 |
| 348 | 3300025912 | Ga0207707_10037879 | Ga0207707_100378794 | 349 |
| 349 | 3300025913 | Ga0207695_10059994 | Ga0207695_100599942 | 349 |
| 350 | 3300025914 | Ga0207671_10233706 | Ga0207671_102337062 | 349 |
| 351 | 3300025921 | Ga0207652_10091589 | Ga0207652_100915893 | 349 |
| 352 | 3300025931 | Ga0207644_10144561 | Ga0207644_101445612 | 349 |
| 353 | 3300025940 | Ga0207691_10003462 | Ga0207691_100034625 | 349 |
| 354 | 3300025941 | Ga0207711_10003442 | Ga0207711_100034422 | 349 |
| 355 | 3300025949 | Ga0207667_10221218 | Ga0207667_102212182 | 349 |
| 356 | 3300025961 | Ga0207712_10025287 | Ga0207712_100252873 | 349 |
| 357 | 3300025961 | Ga0207712_10085307 | Ga0207712_100853072 | 349 |
| 358 | 3300026035 | Ga0207703_10006054 | Ga0207703_100060546 | 349 |
| 359 | 3300026041 | Ga0207639_10003079 | Ga0207639_100030798 | 349 |
| 360 | 3300026041 | Ga0207639_10263549 | Ga0207639_102635492 | 349 |
| 361 | 3300026095 | Ga0207676_10120313 | Ga0207676_101203132 | 349 |
| 362 | 3300026118 | Ga0207675_100040576 | Ga0207675_1000405763 | 349 |
| 363 | 3300028379 | Ga0268266_10013408 | Ga0268266_100134085 | 349 |
| 364 | 3300028379 | Ga0268266_10388307 | Ga0268266_103883071 | 349 |
| 365 | 3300028381 | Ga0268264_10132305 | Ga0268264_101323052 | 349 |
| 366 | 3300028800 | Ga0265338_10023510 | Ga0265338_100235103 | 349 |
| 367 | 3300031247 | Ga0265340_10050925 | Ga0265340_100509252 | 349 |
| 368 | 3300031507 | Ga0307509_10000030 | Ga0307509_10000030142 | 349 |
| 369 | 3300031507 | Ga0307509_10000038 | Ga0307509_10000038110 | 349 |
| 370 | 3300033180 | Ga0307510_10039625 | Ga0307510_100396252 | 349 |
| 371 | 3300036401 | Ga0373937_0071450 | Ga0373937_0071450_1705_2817 | 349 |
| 372 | 3300036401 | Ga0373937_0209312 | Ga0373937_0209312_686_1738 | 349 |
| 373 | 3300044842 | Ga0466957_0047879 | Ga0466957_0047879_497_1675 | 349 |
| 374 | 3300045049 | Ga0466959_0171424 | Ga0466959_0171424_21_1076 | 349 |
| 375 | 3300048907 | Ga0496104_0008673 | Ga0496104_0008673_4945_5997 | 349 |
| 376 | 3300048908 | Ga0496105_0003391 | Ga0496105_0003391_6073_7125 | 349 |
| 377 | 3300048911 | Ga0496108_0004690 | Ga0496108_0004690_3400_4452 | 349 |
| 378 | 3300048912 | Ga0496109_0003527 | Ga0496109_0003527_5365_6417 | 349 |
| 379 | 3300048913 | Ga0496110_0005766 | Ga0496110_0005766_8007_9059 | 349 |
| 380 | 3300048914 | Ga0496111_0019835 | Ga0496111_0019835_1225_2277 | 349 |
| 381 | 3300049570 | Ga0501033_0015436 | Ga0501033_0015436_1902_2954 | 349 |
| 382 | 3300049572 | Ga0501036_0009960 | Ga0501036_0009960_1803_2855 | 349 |
| 383 | 3300049574 | Ga0501038_0009562 | Ga0501038_0009562_723_1775 | 349 |
| 384 | 3300049575 | Ga0501039_0004427 | Ga0501039_0004427_978_2030 | 349 |
| 385 | 3300049575 | Ga0501039_0047346 | Ga0501039_0047346_1217_2269 | 349 |
| 386 | 3300049576 | Ga0501040_0000385 | Ga0501040_0000385_8903_9955 | 349 |
| 387 | 3300049576 | Ga0501040_0000935 | Ga0501040_0000935_9274_10326 | 349 |
| 388 | 3300049577 | Ga0501041_0000783 | Ga0501041_0000783_10469_11521 | 349 |
| 389 | 3300049577 | Ga0501041_0053709 | Ga0501041_0053709_642_1694 | 349 |
| 390 | 3300049578 | Ga0501042_0006031 | Ga0501042_0006031_6781_7833 | 349 |
| 391 | 3300049578 | Ga0501042_0060233 | Ga0501042_0060233_901_1953 | 349 |
| 392 | 3300049579 | Ga0501043_0095034 | Ga0501043_0095034_558_1610 | 349 |
| 393 | 3300049580 | Ga0501046_0005749 | Ga0501046_0005749_3332_4384 | 349 |
| 394 | 3300049582 | Ga0501048_0011210 | Ga0501048_0011210_2360_3412 | 349 |
| 395 | 3300049582 | Ga0501048_0026240 | Ga0501048_0026240_276_1328 | 349 |
| 396 | 3300049584 | Ga0501068_0014136 | Ga0501068_0014136_1656_2708 | 349 |
| 397 | 3300049587 | Ga0501071_0000011 | Ga0501071_0000011_14884_15936 | 349 |
| 398 | 3300049587 | Ga0501071_0026836 | Ga0501071_0026836_1199_2251 | 349 |
| 399 | 3300049588 | Ga0501072_0000640 | Ga0501072_0000640_15907_16959 | 349 |
| 400 | 3300049588 | Ga0501072_0008703 | Ga0501072_0008703_4715_5767 | 349 |
| 401 | 3300049591 | Ga0501075_0000086 | Ga0501075_0000086_14180_15232 | 349 |
| 402 | 3300049591 | Ga0501075_0058277 | Ga0501075_0058277_691_1743 | 349 |
| 403 | 3300049592 | Ga0501076_0000277 | Ga0501076_0000277_13223_14275 | 349 |
| 404 | 3300049592 | Ga0501076_0033975 | Ga0501076_0033975_2900_3952 | 349 |
| 405 | 3300049593 | Ga0501077_0002412 | Ga0501077_0002412_5054_6106 | 349 |
| 406 | 3300049741 | Ga0501079_0000209 | Ga0501079_0000209_15623_16675 | 349 |
| 407 | 3300049742 | Ga0501080_0007768 | Ga0501080_0007768_6781_7833 | 349 |
| 408 | 3300049743 | Ga0501081_0001058 | Ga0501081_0001058_9463_10515 | 349 |
| 409 | 3300049744 | Ga0501083_0013635 | Ga0501083_0013635_1911_2963 | 349 |
| 410 | 3300049744 | Ga0501083_0100217 | Ga0501083_0100217_690_1742 | 349 |
| 411 | 3300049822 | Ga0501035_0045820 | Ga0501035_0045820_1316_2368 | 349 |
| 412 | 3300049824 | Ga0501045_0000055 | Ga0501045_0000055_26789_27841 | 349 |
| 413 | 3300049824 | Ga0501045_0052740 | Ga0501045_0052740_288_1340 | 349 |
| 414 | 3300053092 | Ga0500583_0017966 | Ga0500583_0017966_990_2042 | 349 |
| 415 | 3300053146 | Ga0500588_0005597 | Ga0500588_0005597_67_1134 | 349 |
| 416 | 3300053153 | Ga0500616_0000011 | Ga0500616_0000011_90058_91110 | 349 |
| 417 | 3300053178 | Ga0500637_0028948 | Ga0500637_0028948_1176_2228 | 349 |
| 418 | 3300054114 | Ga0501084_0008126 | Ga0501084_0008126_2652_3704 | 349 |
| 419 | 3300054114 | Ga0501084_0010556 | Ga0501084_0010556_1768_2820 | 349 |
| 420 | 3300060353 | Ga0501082_0000298 | Ga0501082_0000298_17725_18777 | 349 |
| 421 | 3300060353 | Ga0501082_0028612 | Ga0501082_0028612_2600_3652 | 349 |
| 422 | 3300061734 | Ga0530510_0000228 | Ga0530510_0000228_28492_29544 | 349 |
| 423 | 2162886006 | SwRhRL3b_contig_244457 | SwRhRL3b_0716.00000890 | 350 |
| 424 | 3300005295 | Ga0065707_10082048 | Ga0065707_100820482 | 350 |
| 425 | 3300005295 | Ga0065707_10089827 | Ga0065707_100898271 | 350 |
| 426 | 3300005330 | Ga0070690_100203541 | Ga0070690_1002035412 | 350 |
| 427 | 3300005335 | Ga0070666_10002062 | Ga0070666_100020626 | 350 |
| 428 | 3300005355 | Ga0070671_100000201 | Ga0070671_10000020116 | 350 |
| 429 | 3300005355 | Ga0070671_100016940 | Ga0070671_1000169403 | 350 |
| 430 | 3300005367 | Ga0070667_100000564 | Ga0070667_10000056416 | 350 |
| 431 | 3300005434 | Ga0070709_10005771 | Ga0070709_100057716 | 350 |
| 432 | 3300005435 | Ga0070714_100021134 | Ga0070714_1000211345 | 350 |
| 433 | 3300005436 | Ga0070713_100002972 | Ga0070713_1000029724 | 350 |
| 434 | 3300005548 | Ga0070665_100016476 | Ga0070665_1000164765 | 350 |
| 435 | 3300005548 | Ga0070665_100168514 | Ga0070665_1001685143 | 350 |
| 436 | 3300005563 | Ga0068855_100007206 | Ga0068855_1000072064 | 350 |
| 437 | 3300005614 | Ga0068856_100034668 | Ga0068856_1000346683 | 350 |
| 438 | 3300005617 | Ga0068859_100000238 | Ga0068859_10000023823 | 350 |
| 439 | 3300005841 | Ga0068863_100010199 | Ga0068863_1000101997 | 350 |
| 440 | 3300005841 | Ga0068863_100026755 | Ga0068863_1000267554 | 350 |
| 441 | 3300005842 | Ga0068858_100000661 | Ga0068858_10000066118 | 350 |
| 442 | 3300005843 | Ga0068860_100044017 | Ga0068860_1000440172 | 350 |
| 443 | 3300006028 | Ga0070717_10072724 | Ga0070717_100727242 | 350 |
| 444 | 3300006163 | Ga0070715_10097583 | Ga0070715_100975832 | 350 |
| 445 | 3300006173 | Ga0070716_100079989 | Ga0070716_1000799892 | 350 |
| 446 | 3300006175 | Ga0070712_100004776 | Ga0070712_1000047762 | 350 |
| 447 | 3300006237 | Ga0097621_100011674 | Ga0097621_1000116747 | 350 |
| 448 | 3300006844 | Ga0075428_100008172 | Ga0075428_1000081729 | 350 |
| 449 | 3300006844 | Ga0075428_100037841 | Ga0075428_1000378415 | 350 |
| 450 | 3300006881 | Ga0068865_100014609 | Ga0068865_1000146094 | 350 |
| 451 | 3300006931 | Ga0097620_100000238 | Ga0097620_10000023823 | 350 |
| 452 | 3300009092 | Ga0105250_10000014 | Ga0105250_100000146 | 350 |
| 453 | 3300009093 | Ga0105240_10016706 | Ga0105240_100167065 | 350 |
| 454 | 3300009098 | Ga0105245_10016500 | Ga0105245_100165002 | 350 |
| 455 | 3300009101 | Ga0105247_10000157 | Ga0105247_1000015722 | 350 |
| 456 | 3300009174 | Ga0105241_10048142 | Ga0105241_100481422 | 350 |
| 457 | 3300009176 | Ga0105242_10004933 | Ga0105242_100049334 | 350 |
| 458 | 3300009177 | Ga0105248_10072143 | Ga0105248_100721433 | 350 |
| 459 | 3300009545 | Ga0105237_10027260 | Ga0105237_100272603 | 350 |
| 460 | 3300009545 | Ga0105237_10031000 | Ga0105237_100310002 | 350 |
| 461 | 3300009545 | Ga0105237_10369160 | Ga0105237_103691601 | 350 |
| 462 | 3300010159 | Ga0099796_10002150 | Ga0099796_100021503 | 350 |
| 463 | 3300013297 | Ga0157378_10031027 | Ga0157378_100310273 | 350 |
| 464 | 3300013306 | Ga0163162_10022475 | Ga0163162_100224752 | 350 |
| 465 | 3300013306 | Ga0163162_10051957 | Ga0163162_100519575 | 350 |
| 466 | 3300014325 | Ga0163163_10045680 | Ga0163163_100456803 | 350 |
| 467 | 3300014326 | Ga0157380_10008495 | Ga0157380_100084952 | 350 |
| 468 | 3300014968 | Ga0157379_10000278 | Ga0157379_100002787 | 350 |
| 469 | 3300014968 | Ga0157379_10000899 | Ga0157379_1000089918 | 350 |
| 470 | 3300025711 | Ga0207696_1000087 | Ga0207696_10000876 | 350 |
| 471 | 3300025900 | Ga0207710_10000211 | Ga0207710_1000021140 | 350 |
| 472 | 3300025906 | Ga0207699_10016844 | Ga0207699_100168442 | 350 |
| 473 | 3300025906 | Ga0207699_10133925 | Ga0207699_101339252 | 350 |
| 474 | 3300025915 | Ga0207693_10000068 | Ga0207693_1000006810 | 350 |
| 475 | 3300025915 | Ga0207693_10023094 | Ga0207693_100230944 | 350 |
| 476 | 3300025931 | Ga0207644_10000984 | Ga0207644_100009842 | 350 |
| 477 | 3300025939 | Ga0207665_10089478 | Ga0207665_100894782 | 350 |
| 478 | 3300025949 | Ga0207667_10034818 | Ga0207667_100348185 | 350 |
| 479 | 3300025961 | Ga0207712_10104402 | Ga0207712_101044022 | 350 |
| 480 | 3300025986 | Ga0207658_10001537 | Ga0207658_1000153712 | 350 |
| 481 | 3300026035 | Ga0207703_10000835 | Ga0207703_1000083510 | 350 |
| 482 | 3300026121 | Ga0207683_10004921 | Ga0207683_100049215 | 350 |
| 483 | 3300030521 | Ga0307511_10000052 | Ga0307511_1000005222 | 350 |
| 484 | 3300035172 | Ga0373955_0023147 | Ga0373955_0023147_878_1936 | 350 |
| 485 | 3300035695 | Ga0373927_0004671 | Ga0373927_0004671_6035_7093 | 350 |
| 486 | 3300037068 | Ga0373925_0296847 | Ga0373925_0296847_212_1270 | 350 |
| 487 | 3300041404 | Ga0439436_0006197 | Ga0439436_0006197_358_1458 | 350 |
| 488 | 3300041406 | Ga0439439_0006671 | Ga0439439_0006671_775_1875 | 350 |
| 489 | 3300042014 | Ga0439457_000901 | Ga0439457_000901_5647_6747 | 350 |
| 490 | 3300044656 | Ga0466969_0002840 | Ga0466969_0002840_1529_2608 | 350 |
| 491 | 3300044693 | Ga0466961_0098368 | Ga0466961_0098368_256_1401 | 350 |
| 492 | 3300044706 | Ga0466964_0006235 | Ga0466964_0006235_1487_2566 | 350 |
| 493 | 3300044719 | Ga0466971_0039341 | Ga0466971_0039341_476_1555 | 350 |
| 494 | 3300045049 | Ga0466959_0033955 | Ga0466959_0033955_900_1952 | 350 |
| 495 | 3300046472 | Ga0495580_0005250 | Ga0495580_0005250_5672_6730 | 350 |
| 496 | 3300048903 | Ga0496100_0029273 | Ga0496100_0029273_2215_3273 | 350 |
| 497 | 3300048904 | Ga0496101_0005953 | Ga0496101_0005953_3032_4090 | 350 |
| 498 | 3300048905 | Ga0496102_0148953 | Ga0496102_0148953_421_1479 | 350 |
| 499 | 3300048905 | Ga0496102_0169615 | Ga0496102_0169615_230_1282 | 350 |
| 500 | 3300048907 | Ga0496104_0071784 | Ga0496104_0071784_2102_3160 | 350 |
| 501 | 3300048908 | Ga0496105_0021391 | Ga0496105_0021391_3155_4213 | 350 |
| 502 | 3300048911 | Ga0496108_0103155 | Ga0496108_0103155_392_1444 | 350 |
| 503 | 3300048911 | Ga0496108_0455658 | Ga0496108_0455658_33_1091 | 350 |
| 504 | 3300048912 | Ga0496109_0028915 | Ga0496109_0028915_3800_4858 | 350 |
| 505 | 3300048913 | Ga0496110_0057114 | Ga0496110_0057114_2225_3283 | 350 |
| 506 | 3300048914 | Ga0496111_0133567 | Ga0496111_0133567_34_1092 | 350 |
| 507 | 3300048916 | Ga0496113_0048558 | Ga0496113_0048558_118_1176 | 350 |
| 508 | 3300048921 | Ga0496118_0038217 | Ga0496118_0038217_2762_3814 | 350 |
| 509 | 3300048922 | Ga0496119_0012169 | Ga0496119_0012169_3923_5074 | 350 |
| 510 | 3300048924 | Ga0496121_0001266 | Ga0496121_0001266_21482_22534 | 350 |
| 511 | 3300048924 | Ga0496121_0116197 | Ga0496121_0116197_249_1301 | 350 |
| 512 | 3300048928 | Ga0496125_0005299 | Ga0496125_0005299_5732_6925 | 350 |
| 513 | 3300048928 | Ga0496125_0062327 | Ga0496125_0062327_1592_2644 | 350 |
| 514 | 3300061719 | Ga0466962_0011940 | Ga0466962_0011940_1414_2493 | 350 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hv6-assembly1.cif.gz_A | the atp binding domain of rifampin phosphotransferase from listeria monocytogenes | 0.9445 | 4 | 319 |
| 5hv6-assembly1.cif.gz_A | the atp binding domain of rifampin phosphotransferase from listeria monocytogenes | 0.9357 | 4 | 319 |
| 5hv6-assembly2.cif.gz_B | the atp binding domain of rifampin phosphotransferase from listeria monocytogenes | 0.9322 | 2 | 319 |
| 5hv6-assembly2.cif.gz_B | the atp binding domain of rifampin phosphotransferase from listeria monocytogenes | 0.9291 | 2 | 319 |
| 5hv2-assembly1.cif.gz_A | rifampin phosphotransferase g527y mutant from listeria monocytogenes | 0.9245 | 2 | 319 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hv6B02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9583 | 189 | 319 | 3.30.470.20 |
| 5hv6B02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9508 | 189 | 319 | 3.30.470.20 |
| 2olsA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9431 | 193 | 322 | 3.30.470.20 |
| af_Q57962_11_199_3.30.1490.20 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain | 0.9387 | 3 | 189 | 3.30.1490.20 |
| af_Q57962_11_199_3.30.1490.20 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain | 0.9244 | 3 | 189 | 3.30.1490.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V2MFC9-F1-model_v4 | Phosphoenolpyruvate synthase | 0.9739 | 186 | 319 |
GO:0005524
GO:0016301 |
| AF-A0A534EJ00-F1-model_v4 | Phosphoenolpyruvate synthase (EC 2.7.9.2) (Pyruvate, water dikinase) | 0.9671 | 1 | 156 |
GO:0005524
GO:0006090 GO:0006094 GO:0008986 GO:0046872 |
| AF-A0A3B8LMA1-F1-model_v4 | Phosphoenolpyruvate synthase (EC 2.7.9.2) (Pyruvate, water dikinase) | 0.9659 | 4 | 256 |
GO:0005524
GO:0006090 GO:0006094 GO:0008986 GO:0046872 |
| AF-A0A843DHJ5-F1-model_v4 | deleted | 0.9652 | 1 | 319 |
|
| AF-A0A2H0SEX6-F1-model_v4 | Phosphoenolpyruvate synthase (EC 2.7.9.2) (Pyruvate, water dikinase) | 0.9649 | 3 | 321 |
GO:0005524
GO:0006090 GO:0006094 GO:0008986 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar