F457628

General Info

Members Datasets Scaffolds Average Seq Length
513 277 1026 131

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0538730|Ga0496108_0538730_288_653
Length 121
Sequence MPRRLISSGSTFERDIGYSRAVVDGEWIFVSGTTGFDYSKMTISDDLKNIHAALDEAGASMRDIVRVTYVLPDAADFPKCWPTLAKYFGEIRPAAMMISAGLSDPRMRIEIQVTARRGSGA

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
184 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
185 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
186 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
187 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
272 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
273 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
274 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
275 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
276 2738543013 Variovorax sp. BT01 Isolate Unclassified
277 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.19
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0.19
Rhizoplane 6.04
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0538730 3300048911 Bacteria 1019
2 MBSR1b_contig_5835153 2162886012 Bacteria 830
3 rootH1_10023584 3300003316 Bacteria 3015
4 rootH1_10365404 3300003323 Bacteria 1730
5 Ga0065712_10002767 3300005290 Archaea 7686
6 Ga0065712_10080893 3300005290 Bacteria 3060
7 Ga0065712_10381586 3300005290 Bacteria 751
8 Ga0065712_10756371 3300005290 Bacteria 514
9 Ga0065715_10227584 3300005293 Bacteria 1246
10 Ga0065715_10228792 3300005293 Bacteria 1242
11 Ga0065715_10275393 3300005293 Bacteria 1100
12 Ga0065707_10247149 3300005295 Unclassified 1137
13 Ga0070676_10021234 3300005328 Bacteria 3634
14 Ga0070676_10223475 3300005328 Bacteria 1245
15 Ga0070683_100080731 3300005329 Bacteria 3045
16 Ga0070683_100142417 3300005329 Bacteria 2272
17 Ga0070683_100967893 3300005329 Bacteria 817
18 Ga0070690_100177557 3300005330 Bacteria 1470
19 Ga0070690_100288771 3300005330 Bacteria 1172
20 Ga0070690_100696963 3300005330 Bacteria 780
21 Ga0070670_100069059 3300005331 Bacteria 3033
22 Ga0070670_100093322 3300005331 Bacteria 2589
23 Ga0070670_100145202 3300005331 Bacteria 2052
24 Ga0070670_100213863 3300005331 Bacteria 1676
25 Ga0070670_101105788 3300005331 Bacteria 723
26 Ga0070677_10055485 3300005333 Bacteria 1617
27 Ga0070666_10005935 3300005335 Bacteria 7499
28 Ga0070666_10238113 3300005335 Bacteria 1287
29 Ga0070682_100184511 3300005337 Bacteria 1460
30 Ga0070682_100741819 3300005337 Bacteria 792
31 Ga0068868_100001055 3300005338 Bacteria 18854
32 Ga0068868_100039328 3300005338 Bacteria 3675
33 Ga0068868_100292350 3300005338 Bacteria 1382
34 Ga0070661_100001073 3300005344 Bacteria 19371
35 Ga0070661_100107183 3300005344 Bacteria 2084
36 Ga0070661_100165719 3300005344 Bacteria 1676
37 Ga0070661_100917427 3300005344 Bacteria 724
38 Ga0070668_100777815 3300005347 Unclassified 849
39 Ga0070669_100150886 3300005353 Bacteria 1799
40 Ga0070675_100009250 3300005354 Bacteria 7654
41 Ga0070675_100081830 3300005354 Bacteria 2693
42 Ga0070675_100209411 3300005354 Bacteria 1694
43 Ga0070675_100472151 3300005354 Bacteria 1127
44 Ga0070671_100017325 3300005355 Bacteria 5834
45 Ga0070671_100021748 3300005355 Bacteria 5238
46 Ga0070671_100033410 3300005355 Bacteria 4254
47 Ga0070671_100408836 3300005355 Bacteria 1162
48 Ga0070671_100704678 3300005355 Bacteria 876
49 Ga0070674_100056961 3300005356 Bacteria 2711
50 Ga0070674_100142042 3300005356 Bacteria 1803
51 Ga0070674_100196141 3300005356 Bacteria 1556
52 Ga0070673_100001034 3300005364 Bacteria 15776
53 Ga0070673_100642684 3300005364 Bacteria 970
54 Ga0070688_100088307 3300005365 Bacteria 2021
55 Ga0070659_100080169 3300005366 Bacteria 2606
56 Ga0070659_100104936 3300005366 Bacteria 2277
57 Ga0070659_100632241 3300005366 Bacteria 922
58 Ga0070667_100017600 3300005367 Bacteria 5921
59 Ga0070667_100049065 3300005367 Bacteria 3555
60 Ga0070667_100109218 3300005367 Bacteria 2397
61 Ga0070667_100282365 3300005367 Bacteria 1491
62 Ga0070667_100779233 3300005367 Bacteria 887
63 Ga0070711_100174247 3300005439 Unclassified 1642
64 Ga0070711_100230366 3300005439 Bacteria 1444
65 Ga0070711_100626357 3300005439 Bacteria 900
66 Ga0070700_100484284 3300005441 Bacteria 948
67 Ga0070700_100934396 3300005441 Bacteria 708
68 Ga0070663_100166309 3300005455 Bacteria 1702
69 Ga0070663_100285180 3300005455 Bacteria 1317
70 Ga0070663_100496398 3300005455 Bacteria 1013
71 Ga0070663_100648456 3300005455 Bacteria 893
72 Ga0070678_100021109 3300005456 Bacteria 4288
73 Ga0070678_100571199 3300005456 Bacteria 1006
74 Ga0070678_101207183 3300005456 Bacteria 701
75 Ga0070662_100045881 3300005457 Bacteria 3138
76 Ga0070662_100069554 3300005457 Bacteria 2591
77 Ga0070662_100865848 3300005457 Bacteria 770
78 Ga0070681_10044922 3300005458 Bacteria 4421
79 Ga0070681_10975983 3300005458 Bacteria 767
80 Ga0068867_101683880 3300005459 Bacteria 594
81 Ga0070685_10012353 3300005466 Bacteria 4486
82 Ga0070698_100351456 3300005471 Bacteria 1406
83 Ga0070698_100981364 3300005471 Bacteria 792
84 Ga0070699_100285497 3300005518 Bacteria 1479
85 Ga0070679_100126247 3300005530 Bacteria 2541
86 Ga0070679_100257298 3300005530 Bacteria 1701
87 Ga0070684_100000938 3300005535 Bacteria 20744
88 Ga0070684_100805016 3300005535 Bacteria 878
89 Ga0070684_101201722 3300005535 Bacteria 713
90 Ga0068853_100507461 3300005539 Unclassified 1139
91 Ga0068853_101845185 3300005539 Bacteria 586
92 Ga0070672_100021253 3300005543 Bacteria 4746
93 Ga0070672_100100115 3300005543 Bacteria 2350
94 Ga0070672_100112301 3300005543 Bacteria 2223
95 Ga0070686_100356172 3300005544 Bacteria 1101
96 Ga0070695_100158565 3300005545 Bacteria 1586
97 Ga0070696_101928265 3300005546 Unclassified 512
98 Ga0070693_100014848 3300005547 Bacteria 4002
99 Ga0070693_100120540 3300005547 Bacteria 1626
100 Ga0070693_100407194 3300005547 Bacteria 945
101 Ga0070693_100505119 3300005547 Bacteria 858
102 Ga0070693_101204645 3300005547 Bacteria 582
103 Ga0070665_100090204 3300005548 Bacteria 3071
104 Ga0070665_100747409 3300005548 Bacteria 991
105 Ga0070665_100833226 3300005548 Bacteria 935
106 Ga0070665_102073830 3300005548 Unclassified 573
107 Ga0068855_100176269 3300005563 Unclassified 2419
108 Ga0068855_100702423 3300005563 Bacteria 1082
109 Ga0070664_100000219 3300005564 Bacteria 40949
110 Ga0070664_100041844 3300005564 Bacteria 3867
111 Ga0070664_100080962 3300005564 Bacteria 2798
112 Ga0070664_100086585 3300005564 Bacteria 2707
113 Ga0070664_100458951 3300005564 Bacteria 1170
114 Ga0070664_100597174 3300005564 Bacteria 1023
115 Ga0070664_100739142 3300005564 Bacteria 918
116 Ga0070664_101147432 3300005564 Bacteria 732
117 Ga0070664_101294845 3300005564 Bacteria 688
118 Ga0068857_102469585 3300005577 Bacteria 510
119 Ga0068854_100062400 3300005578 Bacteria 2702
120 Ga0068854_100354734 3300005578 Bacteria 1201
121 Ga0068854_100600457 3300005578 Bacteria 940
122 Ga0068856_100177070 3300005614 Bacteria 2145
123 Ga0070702_101533701 3300005615 Bacteria 549
124 Ga0068852_100092105 3300005616 Bacteria 2714
125 Ga0068852_100246558 3300005616 Bacteria 1709
126 Ga0068852_100350192 3300005616 Bacteria 1442
127 Ga0068859_100050331 3300005617 Bacteria 4185
128 Ga0068859_100066026 3300005617 Bacteria 3653
129 Ga0068859_100103030 3300005617 Bacteria 2912
130 Ga0068859_102056071 3300005617 Bacteria 631
131 Ga0068864_100000464 3300005618 Bacteria 35141
132 Ga0068864_100061020 3300005618 Bacteria 3265
133 Ga0068864_100412654 3300005618 Bacteria 1285
134 Ga0068864_100497925 3300005618 Bacteria 1172
135 Ga0068864_101069948 3300005618 Bacteria 802
136 Ga0068861_100017532 3300005719 Bacteria 5087
137 Ga0068861_100130515 3300005719 Bacteria 2039
138 Ga0068861_100610870 3300005719 Bacteria 1002
139 Ga0068851_10042861 3300005834 Bacteria 2279
140 Ga0068851_10094589 3300005834 Bacteria 1578
141 Ga0068851_10246254 3300005834 Bacteria 1012
142 Ga0068851_10986897 3300005834 Bacteria 531
143 Ga0068863_100190423 3300005841 Bacteria 1971
144 Ga0068858_100001151 3300005842 Bacteria 27341
145 Ga0068858_100644609 3300005842 Bacteria 1029
146 Ga0068860_100001031 3300005843 Bacteria 30723
147 Ga0068860_100058322 3300005843 Bacteria 3670
148 Ga0068860_100082131 3300005843 Bacteria 3065
149 Ga0068860_100634817 3300005843 Bacteria 1075
150 Ga0068860_102776350 3300005843 Bacteria 508
151 Ga0081455_10047271 3300005937 Bacteria 3728
152 Ga0070717_10420094 3300006028 Bacteria 1203
153 Ga0075368_10314734 3300006042 Bacteria 677
154 Ga0070715_10153677 3300006163 Bacteria 1130
155 Ga0075366_10564955 3300006195 Bacteria 705
156 Ga0097621_100020006 3300006237 Bacteria 5152
157 Ga0097621_100912708 3300006237 Bacteria 818
158 Ga0097621_100932803 3300006237 Bacteria 810
159 Ga0097621_101691003 3300006237 Unclassified 602
160 Ga0075370_10147394 3300006353 Bacteria 1378
161 Ga0068871_100032979 3300006358 Bacteria 4095
162 Ga0068871_100276796 3300006358 Bacteria 1467
163 Ga0075428_100003042 3300006844 Bacteria 18310
164 Ga0075430_100199857 3300006846 Bacteria 1660
165 Ga0075430_100387019 3300006846 Bacteria 1154
166 Ga0075431_100023870 3300006847 Bacteria 6260
167 Ga0075429_100174531 3300006880 Bacteria 1883
168 Ga0075429_100880173 3300006880 Bacteria 784
169 Ga0068865_101419170 3300006881 Bacteria 620
170 Ga0075436_100428097 3300006914 Bacteria 962
171 Ga0075436_100699626 3300006914 Bacteria 751
172 Ga0097620_100050332 3300006931 Bacteria 4185
173 Ga0097620_100066026 3300006931 Bacteria 3653
174 Ga0097620_100103034 3300006931 Bacteria 2912
175 Ga0097620_102055881 3300006931 Bacteria 631
176 Ga0099795_10174226 3300007788 Bacteria 895
177 Ga0105240_10011394 3300009093 Bacteria 12387
178 Ga0105240_10069001 3300009093 Bacteria 4377
179 Ga0111539_10050130 3300009094 Unclassified 4974
180 Ga0105245_11655033 3300009098 Bacteria 692
181 Ga0105247_10036100 3300009101 Bacteria 3014
182 Ga0114129_10042761 3300009147 Bacteria 6377
183 Ga0105243_12240445 3300009148 Bacteria 583
184 Ga0105241_10399594 3300009174 Bacteria 1205
185 Ga0105242_10178199 3300009176 Unclassified 1873
186 Ga0105242_11753354 3300009176 Bacteria 658
187 Ga0105248_10003492 3300009177 Bacteria 17444
188 Ga0105248_10494355 3300009177 Bacteria 1379
189 Ga0105248_10559239 3300009177 Bacteria 1290
190 Ga0105248_11171482 3300009177 Bacteria 869
191 Ga0105237_11131363 3300009545 Bacteria 790
192 Ga0105238_10584570 3300009551 Bacteria 1123
193 Ga0105249_10032435 3300009553 Bacteria 4726
194 Ga0105249_10728976 3300009553 Bacteria 1053
195 Ga0105239_10043725 3300010375 Unclassified 4912
196 Ga0105246_10035783 3300011119 Bacteria 3321
197 Ga0105246_10090137 3300011119 Bacteria 2208
198 Ga0157373_10029797 3300013100 Bacteria 3928
199 Ga0157370_10004271 3300013104 Bacteria 16459
200 Ga0157370_10530748 3300013104 Bacteria 1080
201 Ga0157369_10044728 3300013105 Bacteria 4818
202 Ga0157369_10480520 3300013105 Bacteria 1286
203 Ga0157374_10202204 3300013296 Bacteria 1945
204 Ga0157374_11026711 3300013296 Bacteria 844
205 Ga0157374_11859219 3300013296 Bacteria 628
206 Ga0157378_10088257 3300013297 Bacteria 2814
207 Ga0157378_10177341 3300013297 Unclassified 2002
208 Ga0157378_11612292 3300013297 Bacteria 695
209 Ga0163162_10006914 3300013306 Bacteria 10999
210 Ga0163162_11098760 3300013306 Bacteria 901
211 Ga0163162_11857758 3300013306 Bacteria 689
212 Ga0157372_10430781 3300013307 Bacteria 1537
213 Ga0157372_10606192 3300013307 Bacteria 1276
214 Ga0157372_10976062 3300013307 Unclassified 982
215 Ga0157375_10041618 3300013308 Bacteria 4438
216 Ga0157375_10305678 3300013308 Unclassified 1754
217 Ga0157375_13098041 3300013308 Bacteria 555
218 Ga0163163_10002467 3300014325 Bacteria 15632
219 Ga0163163_10003812 3300014325 Bacteria 12844
220 Ga0163163_10392547 3300014325 Bacteria 1446
221 Ga0157380_10196760 3300014326 Bacteria 1785
222 Ga0157380_10726906 3300014326 Bacteria 1001
223 Ga0157380_12304693 3300014326 Bacteria 603
224 Ga0182008_10095511 3300014497 Bacteria 1467
225 Ga0157379_10002968 3300014968 Bacteria 14312
226 Ga0157379_10064937 3300014968 Bacteria 3262
227 Ga0157376_10104168 3300014969 Bacteria 2486
228 Ga0157376_10122956 3300014969 Bacteria 2303
229 Ga0157376_10207144 3300014969 Bacteria 1808
230 Ga0157376_11019460 3300014969 Bacteria 851
231 Ga0163161_10223843 3300017792 Bacteria 1458
232 Ga0207666_1029471 3300025271 Bacteria 837
233 Ga0207697_10050410 3300025315 Bacteria 1719
234 Ga0207697_10365518 3300025315 Bacteria 641
235 Ga0207688_10003387 3300025901 Bacteria 8695
236 Ga0207688_10718298 3300025901 Bacteria 632
237 Ga0207680_10029447 3300025903 Bacteria 3085
238 Ga0207680_10174871 3300025903 Bacteria 1448
239 Ga0207647_10047660 3300025904 Bacteria 2665
240 Ga0207685_10081668 3300025905 Bacteria 1339
241 Ga0207645_10026890 3300025907 Bacteria 3718
242 Ga0207643_10318638 3300025908 Bacteria 971
243 Ga0207684_10002617 3300025910 Bacteria 18008
244 Ga0207684_10832201 3300025910 Bacteria 779
245 Ga0207654_10048310 3300025911 Bacteria 2435
246 Ga0207654_10186458 3300025911 Bacteria 1357
247 Ga0207707_10065861 3300025912 Bacteria 3155
248 Ga0207695_10008378 3300025913 Bacteria 12950
249 Ga0207671_10185670 3300025914 Bacteria 1620
250 Ga0207671_10733223 3300025914 Bacteria 785
251 Ga0207663_10568036 3300025916 Unclassified 888
252 Ga0207657_10108356 3300025919 Bacteria 2296
253 Ga0207649_10003796 3300025920 Bacteria 8240
254 Ga0207649_10246917 3300025920 Bacteria 1284
255 Ga0207652_10318203 3300025921 Bacteria 1405
256 Ga0207652_10379115 3300025921 Bacteria 1276
257 Ga0207652_10782472 3300025921 Bacteria 848
258 Ga0207681_10113202 3300025923 Bacteria 1978
259 Ga0207694_10530308 3300025924 Bacteria 987
260 Ga0207650_10027759 3300025925 Bacteria 4054
261 Ga0207650_10078249 3300025925 Bacteria 2502
262 Ga0207650_10169141 3300025925 Bacteria 1736
263 Ga0207650_10276468 3300025925 Bacteria 1366
264 Ga0207650_10325566 3300025925 Bacteria 1259
265 Ga0207650_10476939 3300025925 Bacteria 1041
266 Ga0207650_11786576 3300025925 Bacteria 520
267 Ga0207659_10003971 3300025926 Bacteria 8925
268 Ga0207659_10165479 3300025926 Bacteria 1740
269 Ga0207659_11922356 3300025926 Bacteria 501
270 Ga0207664_10017380 3300025929 Bacteria 5271
271 Ga0207644_10020605 3300025931 Bacteria 4486
272 Ga0207644_10072290 3300025931 Bacteria 2526
273 Ga0207644_10080809 3300025931 Bacteria 2401
274 Ga0207690_10146881 3300025932 Bacteria 1744
275 Ga0207690_10284466 3300025932 Bacteria 1289
276 Ga0207706_10039260 3300025933 Bacteria 4196
277 Ga0207706_10054405 3300025933 Bacteria 3532
278 Ga0207686_10577383 3300025934 Bacteria 882
279 Ga0207669_10228475 3300025937 Bacteria 1371
280 Ga0207704_10995007 3300025938 Bacteria 709
281 Ga0207691_10029281 3300025940 Bacteria 5151
282 Ga0207691_10038932 3300025940 Bacteria 4399
283 Ga0207691_10380379 3300025940 Bacteria 1205
284 Ga0207711_10021684 3300025941 Bacteria 5366
285 Ga0207711_10270227 3300025941 Bacteria 1564
286 Ga0207711_10382523 3300025941 Bacteria 1306
287 Ga0207711_10395394 3300025941 Bacteria 1284
288 Ga0207689_10629094 3300025942 Bacteria 904
289 Ga0207661_10002977 3300025944 Bacteria 11713
290 Ga0207661_10621735 3300025944 Bacteria 992
291 Ga0207661_10682181 3300025944 Bacteria 945
292 Ga0207679_10000351 3300025945 Bacteria 33566
293 Ga0207679_10004809 3300025945 Archaea 8415
294 Ga0207679_10179929 3300025945 Bacteria 1748
295 Ga0207679_10256205 3300025945 Bacteria 1490
296 Ga0207679_10953803 3300025945 Bacteria 786
297 Ga0207679_11515693 3300025945 Bacteria 615
298 Ga0207667_10198240 3300025949 Bacteria 2060
299 Ga0207667_10664601 3300025949 Bacteria 1046
300 Ga0207667_11667636 3300025949 Bacteria 605
301 Ga0207651_10150517 3300025960 Bacteria 1811
302 Ga0207712_10016033 3300025961 Bacteria 4844
303 Ga0207712_11825969 3300025961 Bacteria 545
304 Ga0207640_10128404 3300025981 Bacteria 1828
305 Ga0207658_10018851 3300025986 Bacteria 4772
306 Ga0207658_10147967 3300025986 Bacteria 1910
307 Ga0207658_10213730 3300025986 Bacteria 1618
308 Ga0207658_11067646 3300025986 Bacteria 737
309 Ga0207677_10002714 3300026023 Bacteria 9336
310 Ga0207677_10112850 3300026023 Bacteria 2028
311 Ga0207703_10000731 3300026035 Bacteria 32297
312 Ga0207703_10673740 3300026035 Bacteria 982
313 Ga0207678_10069233 3300026067 Bacteria 3026
314 Ga0207678_10176713 3300026067 Bacteria 1823
315 Ga0207708_10233893 3300026075 Bacteria 1476
316 Ga0207708_11035890 3300026075 Bacteria 714
317 Ga0207702_10031244 3300026078 Bacteria 4438
318 Ga0207641_10001792 3300026088 Bacteria 20694
319 Ga0207641_10029632 3300026088 Bacteria 4527
320 Ga0207641_10597085 3300026088 Bacteria 1080
321 Ga0207648_10060794 3300026089 Bacteria 3295
322 Ga0207676_10093176 3300026095 Bacteria 2479
323 Ga0207676_10508401 3300026095 Bacteria 1145
324 Ga0207676_10706327 3300026095 Bacteria 977
325 Ga0207675_100009918 3300026118 Bacteria 8914
326 Ga0207675_101310661 3300026118 Bacteria 745
327 Ga0207683_10006275 3300026121 Bacteria 10189
328 Ga0207683_10125228 3300026121 Bacteria 2309
329 Ga0207683_11602496 3300026121 Bacteria 600
330 Ga0207698_10013427 3300026142 Bacteria 5403
331 Ga0207698_10455416 3300026142 Bacteria 1236
332 Ga0209970_1001043 3300027614 Bacteria 4908
333 Ga0209971_1114541 3300027682 Bacteria 662
334 Ga0268266_10584460 3300028379 Unclassified 1072
335 Ga0268266_10659445 3300028379 Bacteria 1007
336 Ga0268264_10000034 3300028381 Bacteria 401894
337 Ga0268264_10043260 3300028381 Bacteria 3731
338 Ga0307515_10000737 3300028794 Bacteria 75687
339 Ga0307515_10094839 3300028794 Bacteria 3680
340 Ga0307515_10472820 3300028794 Bacteria 866
341 Ga0307515_10600180 3300028794 Bacteria 711
342 Ga0307515_10840421 3300028794 Bacteria 544
343 Ga0265760_10008169 3300031090 Bacteria 2991
344 Ga0265332_10299582 3300031238 Bacteria 664
345 Ga0307513_10088469 3300031456 Bacteria 3165
346 Ga0307408_100295473 3300031548 Bacteria 1355
347 Ga0307408_100616423 3300031548 Bacteria 966
348 Ga0307408_100923046 3300031548 Bacteria 800
349 Ga0307514_10000960 3300031649 Bacteria 43228
350 Ga0265314_10148753 3300031711 Bacteria 1439
351 Ga0307405_10725616 3300031731 Bacteria 825
352 Ga0307413_11082420 3300031824 Bacteria 691
353 Ga0307409_100216345 3300031995 Bacteria 1726
354 Ga0307416_100174355 3300032002 Bacteria 2007
355 Ga0307414_10432169 3300032004 Bacteria 1150
356 Ga0307411_10320707 3300032005 Bacteria 1251
357 Ga0307411_11349314 3300032005 Unclassified 651
358 Ga0373923_0075067 3300035111 Bacteria 1458
359 Ga0373936_0118762 3300035113 Bacteria 1128
360 Ga0373953_0022796 3300035117 Bacteria 2365
361 Ga0373953_0103833 3300035117 Bacteria 1198
362 Ga0373954_0126572 3300035118 Bacteria 1242
363 Ga0373943_0003459 3300035170 Bacteria 7181
364 Ga0373943_0430369 3300035170 Bacteria 765
365 Ga0373946_0007111 3300035171 Bacteria 4086
366 Ga0373955_0062800 3300035172 Bacteria 2055
367 Ga0373955_0356050 3300035172 Bacteria 887
368 Ga0373955_0939551 3300035172 Bacteria 532
369 Ga0373935_0007902 3300035692 Bacteria 6383
370 Ga0373933_0556159 3300035724 Bacteria 753
371 Ga0373937_0193842 3300036401 Bacteria 1910
372 Ga0373937_0215199 3300036401 Bacteria 1808
373 Ga0373925_0012751 3300037068 Bacteria 6090
374 Ga0373925_0282162 3300037068 Bacteria 1338
375 Ga0395900_0186106 3300037418 Bacteria 2108
376 Ga0395900_0737608 3300037418 Bacteria 916
377 Ga0395905_0354539 3300037471 Bacteria 1359
378 Ga0395901_0443678 3300038443 Bacteria 1328
379 Ga0439461_0030694 3300041410 Bacteria 1119
380 Ga0451787_754771 3300041441 Bacteria 531
381 Ga0451839_1412291 3300041496 Bacteria 668
382 Ga0451845_0057139 3300041501 Bacteria 578
383 Ga0439454_009483 3300042011 Bacteria 1265
384 Ga0439446_0179487 3300042156 Bacteria 707
385 Ga0451577_0081068 3300042876 Bacteria 2894
386 Ga0451577_0390207 3300042876 Bacteria 1264
387 Ga0453683_0644552 3300044673 Bacteria 692
388 Ga0466961_0102542 3300044693 Bacteria 1802
389 Ga0466963_0025657 3300044694 Bacteria 3761
390 Ga0453684_0998658 3300044712 Bacteria 890
391 Ga0451576_0007145 3300045051 Bacteria 13469
392 Ga0466958_1164983 3300045836 Bacteria 503
393 Ga0495592_0050701 3300046454 Bacteria 3084
394 Ga0495651_0747479 3300046462 Bacteria 607
395 Ga0495580_0168946 3300046472 Bacteria 1512
396 Ga0495580_0417456 3300046472 Bacteria 903
397 Ga0495582_0360400 3300046473 Bacteria 837
398 Ga0495664_0051295 3300046477 Bacteria 2450
399 Ga0495594_0037771 3300046499 Unclassified 2636
400 Ga0495607_0069821 3300046501 Bacteria 1965
401 Ga0495583_0144123 3300046506 Bacteria 990
402 Ga0495608_0002043 3300046511 Bacteria 14503
403 Ga0495630_0112466 3300046517 Bacteria 2062
404 Ga0495630_0212620 3300046517 Bacteria 1476
405 Ga0495630_1213451 3300046517 Bacteria 570
406 Ga0495632_0151183 3300046519 Bacteria 1073
407 Ga0495643_0021214 3300046522 Bacteria 3731
408 Ga0495665_0021928 3300046531 Bacteria 3434
409 Ga0495640_0751413 3300046533 Bacteria 583
410 Ga0495587_0046361 3300046536 Bacteria 2581
411 Ga0495645_0101165 3300046543 Bacteria 2049
412 Ga0495667_0023945 3300046559 Bacteria 4112
413 Ga0495635_0336272 3300046663 Bacteria 1009
414 Ga0495635_1017842 3300046663 Bacteria 527
415 Ga0495623_0240005 3300046679 Bacteria 1024
416 Ga0495669_0365716 3300046684 Bacteria 698
417 Ga0495613_0001654 3300046689 Bacteria 16971
418 Ga0495613_0093006 3300046689 Bacteria 2183
419 Ga0495671_0429006 3300046692 Bacteria 632
420 Ga0495600_0180313 3300046809 Bacteria 1361
421 Ga0495581_0369612 3300047315 Bacteria 837
422 Ga0495604_0138013 3300047317 Bacteria 1745
423 Ga0495674_0106708 3300047319 Bacteria 2378
424 Ga0495687_050164 3300047443 Unclassified 1780
425 Ga0495675_0605884 3300047444 Bacteria 621
426 Ga0495684_0000356 3300047471 Bacteria 36996
427 Ga0495602_0929794 3300048088 Bacteria 577
428 Ga0496100_0161852 3300048903 Unclassified 1605
429 Ga0496101_1318712 3300048904 Bacteria 564
430 Ga0496102_0670101 3300048905 Unclassified 960
431 Ga0496103_0789413 3300048906 Bacteria 599
432 Ga0496104_0003139 3300048907 Bacteria 14251
433 Ga0496104_0494623 3300048907 Unclassified 1134
434 Ga0496104_1580041 3300048907 Bacteria 559
435 Ga0496105_0038650 3300048908 Bacteria 3932
436 Ga0496106_0039470 3300048909 Bacteria 3536
437 Ga0496106_0463345 3300048909 Bacteria 1018
438 Ga0496106_0913748 3300048909 Unclassified 693
439 Ga0496107_0759798 3300048910 Unclassified 711
440 Ga0496108_0002568 3300048911 Bacteria 14544
441 Ga0496108_0048603 3300048911 Bacteria 3547
442 Ga0496108_0227577 3300048911 Bacteria 1621
443 Ga0496109_0001167 3300048912 Bacteria 21850
444 Ga0496109_0068759 3300048912 Bacteria 3246
445 Ga0496109_0342450 3300048912 Unclassified 1412
446 Ga0496110_0002830 3300048913 Bacteria 13102
447 Ga0496110_0140305 3300048913 Bacteria 2185
448 Ga0496110_0484333 3300048913 Bacteria 1127
449 Ga0496111_0077582 3300048914 Bacteria 2422
450 Ga0496112_0001664 3300048915 Bacteria 17280
451 Ga0496112_0175137 3300048915 Bacteria 2110
452 Ga0496113_0119014 3300048916 Bacteria 2063
453 Ga0496113_0211493 3300048916 Bacteria 1544
454 Ga0496114_0006595 3300048917 Bacteria 9149
455 Ga0496114_0246121 3300048917 Unclassified 1573
456 Ga0496115_1260141 3300048918 Bacteria 553
457 Ga0496118_0269079 3300048921 Bacteria 956
458 Ga0496126_0029175 3300048929 Bacteria 5243
459 Ga0501032_0015211 3300049569 Bacteria 5432
460 Ga0501032_0027016 3300049569 Unclassified 3945
461 Ga0501033_0002169 3300049570 Bacteria 16958
462 Ga0501033_0038678 3300049570 Bacteria 3564
463 Ga0501034_0025973 3300049571 Bacteria 5965
464 Ga0501036_0035450 3300049572 Bacteria 4222
465 Ga0501036_0059199 3300049572 Bacteria 3245
466 Ga0501037_0013674 3300049573 Bacteria 5979
467 Ga0501037_0428658 3300049573 Bacteria 904
468 Ga0501038_0160293 3300049574 Bacteria 1828
469 Ga0501039_0009109 3300049575 Bacteria 7564
470 Ga0501039_0020417 3300049575 Bacteria 5077
471 Ga0501039_0316042 3300049575 Bacteria 1228
472 Ga0501039_0563448 3300049575 Bacteria 894
473 Ga0501039_1095069 3300049575 Unclassified 617
474 Ga0501042_0053775 3300049578 Unclassified 2872
475 Ga0501043_0002998 3300049579 Bacteria 14066
476 Ga0501043_0053688 3300049579 Bacteria 3164
477 Ga0501046_0048789 3300049580 Bacteria 3351
478 Ga0501046_0061684 3300049580 Bacteria 2930
479 Ga0501047_0002955 3300049581 Bacteria 16112
480 Ga0501047_0109718 3300049581 Bacteria 2642
481 Ga0501048_0085056 3300049582 Bacteria 2230
482 Ga0501068_0052595 3300049584 Bacteria 2464
483 Ga0501035_0000299 3300049822 Bacteria 58451
484 Ga0501035_0365722 3300049822 Bacteria 1205
485 Ga0501044_0006586 3300049823 Bacteria 12820
486 Ga0501044_0047650 3300049823 Bacteria 4432
487 Ga0501044_0933879 3300049823 Bacteria 741
488 Ga0501045_0034811 3300049824 Bacteria 3656
489 Ga0501045_0772953 3300049824 Bacteria 707
490 nmdc:mga0k408_137562_c1 3300050493 Bacteria 1452
491 nmdc:mga06z11_44958_c1 3300050494 Bacteria 2230
492 nmdc:mga07m45_62799_c1 3300050496 Bacteria 2106
493 nmdc:mga05p37_7079_c1 3300050507 Bacteria 13225
494 nmdc:mga0qj67_642729_c1 3300050509 Bacteria 847
495 nmdc:mga06r32_57614_c1 3300050510 Bacteria 3732
496 nmdc:mga06r32_88740_c1 3300050510 Bacteria 3019
497 nmdc:mga08y16_272878_c1 3300050511 Bacteria 1745
498 nmdc:mga0n895_352250_c1 3300050512 Bacteria 1491
499 nmdc:mga0rr50_49823_c1 3300050513 Unclassified 3101
500 nmdc:mga08x19_1184970_c1 3300050514 Bacteria 542
501 nmdc:mga08x19_214536_c1 3300050514 Bacteria 1321
502 Ga0495601_0016607 3300053077 Bacteria 4462
503 Ga0495601_0082151 3300053077 Bacteria 2068
504 Ga0495619_0008484 3300053085 Bacteria 6499
505 Ga0495619_0113476 3300053085 Bacteria 1853
506 Ga0495619_0342849 3300053085 Bacteria 1034
507 Ga0500644_0007844 3300053088 Bacteria 2794
508 Ga0500641_0001061 3300053096 Bacteria 9793
509 Ga0500562_019098 3300053108 Bacteria 1771
510 Ga0500593_052007 3300053117 Bacteria 1816
511 Ga0500577_0037449 3300053142 Bacteria 1745
512 2739251505 2738543013 Bacteria 5618633
513 2894236975 2894232714 Bacteria 8834183
514 Ga0496108_0538730
515 MBSR1b_contig_5835153
516 rootH1_10023584
517 rootH1_10365404
518 Ga0065712_10002767
519 Ga0065712_10080893
520 Ga0065712_10381586
521 Ga0065712_10756371
522 Ga0065715_10227584
523 Ga0065715_10228792
524 Ga0065715_10275393
525 Ga0065707_10247149
526 Ga0070676_10021234
527 Ga0070676_10223475
528 Ga0070683_100080731
529 Ga0070683_100142417
530 Ga0070683_100967893
531 Ga0070690_100177557
532 Ga0070690_100288771
533 Ga0070690_100696963
534 Ga0070670_100069059
535 Ga0070670_100093322
536 Ga0070670_100145202
537 Ga0070670_100213863
538 Ga0070670_101105788
539 Ga0070677_10055485
540 Ga0070666_10005935
541 Ga0070666_10238113
542 Ga0070682_100184511
543 Ga0070682_100741819
544 Ga0068868_100001055
545 Ga0068868_100039328
546 Ga0068868_100292350
547 Ga0070661_100001073
548 Ga0070661_100107183
549 Ga0070661_100165719
550 Ga0070661_100917427
551 Ga0070668_100777815
552 Ga0070669_100150886
553 Ga0070675_100009250
554 Ga0070675_100081830
555 Ga0070675_100209411
556 Ga0070675_100472151
557 Ga0070671_100017325
558 Ga0070671_100021748
559 Ga0070671_100033410
560 Ga0070671_100408836
561 Ga0070671_100704678
562 Ga0070674_100056961
563 Ga0070674_100142042
564 Ga0070674_100196141
565 Ga0070673_100001034
566 Ga0070673_100642684
567 Ga0070688_100088307
568 Ga0070659_100080169
569 Ga0070659_100104936
570 Ga0070659_100632241
571 Ga0070667_100017600
572 Ga0070667_100049065
573 Ga0070667_100109218
574 Ga0070667_100282365
575 Ga0070667_100779233
576 Ga0070711_100174247
577 Ga0070711_100230366
578 Ga0070711_100626357
579 Ga0070700_100484284
580 Ga0070700_100934396
581 Ga0070663_100166309
582 Ga0070663_100285180
583 Ga0070663_100496398
584 Ga0070663_100648456
585 Ga0070678_100021109
586 Ga0070678_100571199
587 Ga0070678_101207183
588 Ga0070662_100045881
589 Ga0070662_100069554
590 Ga0070662_100865848
591 Ga0070681_10044922
592 Ga0070681_10975983
593 Ga0068867_101683880
594 Ga0070685_10012353
595 Ga0070698_100351456
596 Ga0070698_100981364
597 Ga0070699_100285497
598 Ga0070679_100126247
599 Ga0070679_100257298
600 Ga0070684_100000938
601 Ga0070684_100805016
602 Ga0070684_101201722
603 Ga0068853_100507461
604 Ga0068853_101845185
605 Ga0070672_100021253
606 Ga0070672_100100115
607 Ga0070672_100112301
608 Ga0070686_100356172
609 Ga0070695_100158565
610 Ga0070696_101928265
611 Ga0070693_100014848
612 Ga0070693_100120540
613 Ga0070693_100407194
614 Ga0070693_100505119
615 Ga0070693_101204645
616 Ga0070665_100090204
617 Ga0070665_100747409
618 Ga0070665_100833226
619 Ga0070665_102073830
620 Ga0068855_100176269
621 Ga0068855_100702423
622 Ga0070664_100000219
623 Ga0070664_100041844
624 Ga0070664_100080962
625 Ga0070664_100086585
626 Ga0070664_100458951
627 Ga0070664_100597174
628 Ga0070664_100739142
629 Ga0070664_101147432
630 Ga0070664_101294845
631 Ga0068857_102469585
632 Ga0068854_100062400
633 Ga0068854_100354734
634 Ga0068854_100600457
635 Ga0068856_100177070
636 Ga0070702_101533701
637 Ga0068852_100092105
638 Ga0068852_100246558
639 Ga0068852_100350192
640 Ga0068859_100050331
641 Ga0068859_100066026
642 Ga0068859_100103030
643 Ga0068859_102056071
644 Ga0068864_100000464
645 Ga0068864_100061020
646 Ga0068864_100412654
647 Ga0068864_100497925
648 Ga0068864_101069948
649 Ga0068861_100017532
650 Ga0068861_100130515
651 Ga0068861_100610870
652 Ga0068851_10042861
653 Ga0068851_10094589
654 Ga0068851_10246254
655 Ga0068851_10986897
656 Ga0068863_100190423
657 Ga0068858_100001151
658 Ga0068858_100644609
659 Ga0068860_100001031
660 Ga0068860_100058322
661 Ga0068860_100082131
662 Ga0068860_100634817
663 Ga0068860_102776350
664 Ga0081455_10047271
665 Ga0070717_10420094
666 Ga0075368_10314734
667 Ga0070715_10153677
668 Ga0075366_10564955
669 Ga0097621_100020006
670 Ga0097621_100912708
671 Ga0097621_100932803
672 Ga0097621_101691003
673 Ga0075370_10147394
674 Ga0068871_100032979
675 Ga0068871_100276796
676 Ga0075428_100003042
677 Ga0075430_100199857
678 Ga0075430_100387019
679 Ga0075431_100023870
680 Ga0075429_100174531
681 Ga0075429_100880173
682 Ga0068865_101419170
683 Ga0075436_100428097
684 Ga0075436_100699626
685 Ga0097620_100050332
686 Ga0097620_100066026
687 Ga0097620_100103034
688 Ga0097620_102055881
689 Ga0099795_10174226
690 Ga0105240_10011394
691 Ga0105240_10069001
692 Ga0111539_10050130
693 Ga0105245_11655033
694 Ga0105247_10036100
695 Ga0114129_10042761
696 Ga0105243_12240445
697 Ga0105241_10399594
698 Ga0105242_10178199
699 Ga0105242_11753354
700 Ga0105248_10003492
701 Ga0105248_10494355
702 Ga0105248_10559239
703 Ga0105248_11171482
704 Ga0105237_11131363
705 Ga0105238_10584570
706 Ga0105249_10032435
707 Ga0105249_10728976
708 Ga0105239_10043725
709 Ga0105246_10035783
710 Ga0105246_10090137
711 Ga0157373_10029797
712 Ga0157370_10004271
713 Ga0157370_10530748
714 Ga0157369_10044728
715 Ga0157369_10480520
716 Ga0157374_10202204
717 Ga0157374_11026711
718 Ga0157374_11859219
719 Ga0157378_10088257
720 Ga0157378_10177341
721 Ga0157378_11612292
722 Ga0163162_10006914
723 Ga0163162_11098760
724 Ga0163162_11857758
725 Ga0157372_10430781
726 Ga0157372_10606192
727 Ga0157372_10976062
728 Ga0157375_10041618
729 Ga0157375_10305678
730 Ga0157375_13098041
731 Ga0163163_10002467
732 Ga0163163_10003812
733 Ga0163163_10392547
734 Ga0157380_10196760
735 Ga0157380_10726906
736 Ga0157380_12304693
737 Ga0182008_10095511
738 Ga0157379_10002968
739 Ga0157379_10064937
740 Ga0157376_10104168
741 Ga0157376_10122956
742 Ga0157376_10207144
743 Ga0157376_11019460
744 Ga0163161_10223843
745 Ga0207666_1029471
746 Ga0207697_10050410
747 Ga0207697_10365518
748 Ga0207688_10003387
749 Ga0207688_10718298
750 Ga0207680_10029447
751 Ga0207680_10174871
752 Ga0207647_10047660
753 Ga0207685_10081668
754 Ga0207645_10026890
755 Ga0207643_10318638
756 Ga0207684_10002617
757 Ga0207684_10832201
758 Ga0207654_10048310
759 Ga0207654_10186458
760 Ga0207707_10065861
761 Ga0207695_10008378
762 Ga0207671_10185670
763 Ga0207671_10733223
764 Ga0207663_10568036
765 Ga0207657_10108356
766 Ga0207649_10003796
767 Ga0207649_10246917
768 Ga0207652_10318203
769 Ga0207652_10379115
770 Ga0207652_10782472
771 Ga0207681_10113202
772 Ga0207694_10530308
773 Ga0207650_10027759
774 Ga0207650_10078249
775 Ga0207650_10169141
776 Ga0207650_10276468
777 Ga0207650_10325566
778 Ga0207650_10476939
779 Ga0207650_11786576
780 Ga0207659_10003971
781 Ga0207659_10165479
782 Ga0207659_11922356
783 Ga0207664_10017380
784 Ga0207644_10020605
785 Ga0207644_10072290
786 Ga0207644_10080809
787 Ga0207690_10146881
788 Ga0207690_10284466
789 Ga0207706_10039260
790 Ga0207706_10054405
791 Ga0207686_10577383
792 Ga0207669_10228475
793 Ga0207704_10995007
794 Ga0207691_10029281
795 Ga0207691_10038932
796 Ga0207691_10380379
797 Ga0207711_10021684
798 Ga0207711_10270227
799 Ga0207711_10382523
800 Ga0207711_10395394
801 Ga0207689_10629094
802 Ga0207661_10002977
803 Ga0207661_10621735
804 Ga0207661_10682181
805 Ga0207679_10000351
806 Ga0207679_10004809
807 Ga0207679_10179929
808 Ga0207679_10256205
809 Ga0207679_10953803
810 Ga0207679_11515693
811 Ga0207667_10198240
812 Ga0207667_10664601
813 Ga0207667_11667636
814 Ga0207651_10150517
815 Ga0207712_10016033
816 Ga0207712_11825969
817 Ga0207640_10128404
818 Ga0207658_10018851
819 Ga0207658_10147967
820 Ga0207658_10213730
821 Ga0207658_11067646
822 Ga0207677_10002714
823 Ga0207677_10112850
824 Ga0207703_10000731
825 Ga0207703_10673740
826 Ga0207678_10069233
827 Ga0207678_10176713
828 Ga0207708_10233893
829 Ga0207708_11035890
830 Ga0207702_10031244
831 Ga0207641_10001792
832 Ga0207641_10029632
833 Ga0207641_10597085
834 Ga0207648_10060794
835 Ga0207676_10093176
836 Ga0207676_10508401
837 Ga0207676_10706327
838 Ga0207675_100009918
839 Ga0207675_101310661
840 Ga0207683_10006275
841 Ga0207683_10125228
842 Ga0207683_11602496
843 Ga0207698_10013427
844 Ga0207698_10455416
845 Ga0209970_1001043
846 Ga0209971_1114541
847 Ga0268266_10584460
848 Ga0268266_10659445
849 Ga0268264_10000034
850 Ga0268264_10043260
851 Ga0307515_10000737
852 Ga0307515_10094839
853 Ga0307515_10472820
854 Ga0307515_10600180
855 Ga0307515_10840421
856 Ga0265760_10008169
857 Ga0265332_10299582
858 Ga0307513_10088469
859 Ga0307408_100295473
860 Ga0307408_100616423
861 Ga0307408_100923046
862 Ga0307514_10000960
863 Ga0265314_10148753
864 Ga0307405_10725616
865 Ga0307413_11082420
866 Ga0307409_100216345
867 Ga0307416_100174355
868 Ga0307414_10432169
869 Ga0307411_10320707
870 Ga0307411_11349314
871 Ga0373923_0075067
872 Ga0373936_0118762
873 Ga0373953_0022796
874 Ga0373953_0103833
875 Ga0373954_0126572
876 Ga0373943_0003459
877 Ga0373943_0430369
878 Ga0373946_0007111
879 Ga0373955_0062800
880 Ga0373955_0356050
881 Ga0373955_0939551
882 Ga0373935_0007902
883 Ga0373933_0556159
884 Ga0373937_0193842
885 Ga0373937_0215199
886 Ga0373925_0012751
887 Ga0373925_0282162
888 Ga0395900_0186106
889 Ga0395900_0737608
890 Ga0395905_0354539
891 Ga0395901_0443678
892 Ga0439461_0030694
893 Ga0451787_754771
894 Ga0451839_1412291
895 Ga0451845_0057139
896 Ga0439454_009483
897 Ga0439446_0179487
898 Ga0451577_0081068
899 Ga0451577_0390207
900 Ga0453683_0644552
901 Ga0466961_0102542
902 Ga0466963_0025657
903 Ga0453684_0998658
904 Ga0451576_0007145
905 Ga0466958_1164983
906 Ga0495592_0050701
907 Ga0495651_0747479
908 Ga0495580_0168946
909 Ga0495580_0417456
910 Ga0495582_0360400
911 Ga0495664_0051295
912 Ga0495594_0037771
913 Ga0495607_0069821
914 Ga0495583_0144123
915 Ga0495608_0002043
916 Ga0495630_0112466
917 Ga0495630_0212620
918 Ga0495630_1213451
919 Ga0495632_0151183
920 Ga0495643_0021214
921 Ga0495665_0021928
922 Ga0495640_0751413
923 Ga0495587_0046361
924 Ga0495645_0101165
925 Ga0495667_0023945
926 Ga0495635_0336272
927 Ga0495635_1017842
928 Ga0495623_0240005
929 Ga0495669_0365716
930 Ga0495613_0001654
931 Ga0495613_0093006
932 Ga0495671_0429006
933 Ga0495600_0180313
934 Ga0495581_0369612
935 Ga0495604_0138013
936 Ga0495674_0106708
937 Ga0495687_050164
938 Ga0495675_0605884
939 Ga0495684_0000356
940 Ga0495602_0929794
941 Ga0496100_0161852
942 Ga0496101_1318712
943 Ga0496102_0670101
944 Ga0496103_0789413
945 Ga0496104_0003139
946 Ga0496104_0494623
947 Ga0496104_1580041
948 Ga0496105_0038650
949 Ga0496106_0039470
950 Ga0496106_0463345
951 Ga0496106_0913748
952 Ga0496107_0759798
953 Ga0496108_0002568
954 Ga0496108_0048603
955 Ga0496108_0227577
956 Ga0496109_0001167
957 Ga0496109_0068759
958 Ga0496109_0342450
959 Ga0496110_0002830
960 Ga0496110_0140305
961 Ga0496110_0484333
962 Ga0496111_0077582
963 Ga0496112_0001664
964 Ga0496112_0175137
965 Ga0496113_0119014
966 Ga0496113_0211493
967 Ga0496114_0006595
968 Ga0496114_0246121
969 Ga0496115_1260141
970 Ga0496118_0269079
971 Ga0496126_0029175
972 Ga0501032_0015211
973 Ga0501032_0027016
974 Ga0501033_0002169
975 Ga0501033_0038678
976 Ga0501034_0025973
977 Ga0501036_0035450
978 Ga0501036_0059199
979 Ga0501037_0013674
980 Ga0501037_0428658
981 Ga0501038_0160293
982 Ga0501039_0009109
983 Ga0501039_0020417
984 Ga0501039_0316042
985 Ga0501039_0563448
986 Ga0501039_1095069
987 Ga0501042_0053775
988 Ga0501043_0002998
989 Ga0501043_0053688
990 Ga0501046_0048789
991 Ga0501046_0061684
992 Ga0501047_0002955
993 Ga0501047_0109718
994 Ga0501048_0085056
995 Ga0501068_0052595
996 Ga0501035_0000299
997 Ga0501035_0365722
998 Ga0501044_0006586
999 Ga0501044_0047650
1000 Ga0501044_0933879
1001 Ga0501045_0034811
1002 Ga0501045_0772953
1003 nmdc:mga0k408_137562_c1
1004 nmdc:mga06z11_44958_c1
1005 nmdc:mga07m45_62799_c1
1006 nmdc:mga05p37_7079_c1
1007 nmdc:mga0qj67_642729_c1
1008 nmdc:mga06r32_57614_c1
1009 nmdc:mga06r32_88740_c1
1010 nmdc:mga08y16_272878_c1
1011 nmdc:mga0n895_352250_c1
1012 nmdc:mga0rr50_49823_c1
1013 nmdc:mga08x19_1184970_c1
1014 nmdc:mga08x19_214536_c1
1015 Ga0495601_0016607
1016 Ga0495601_0082151
1017 Ga0495619_0008484
1018 Ga0495619_0113476
1019 Ga0495619_0342849
1020 Ga0500644_0007844
1021 Ga0500641_0001061
1022 Ga0500562_019098
1023 Ga0500593_052007
1024 Ga0500577_0037449
1025 2739251505
1026 2894236975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

10

117

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.963 2 125
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9551 2 125
2dyy-assembly3.cif.gz_G crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9547 18 126
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.9477 19 125
5yu2-assembly1.cif.gz_B structure of ribonuclease yabj 0.9436 18 124
ID Description Score Start End Superfamily
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.963 2 125 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9551 2 125 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9547 18 126 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9441 19 125 3.30.1330.40
3k0tB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9299 17 125 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A068NM87-F1-model_v4 Endoribonuclease L-PSP 0.9981 23 126
AF-Q2H308-F1-model_v4 Uncharacterized protein 0.9958 3 126
AF-A0A7Y4RQ37-F1-model_v4 RidA family protein 0.9952 1 126
AF-A0A6I0EGL2-F1-model_v4 RidA family protein 0.9941 2 126
AF-A0A7X5V9Q4-F1-model_v4 Enamine deaminase RidA (YjgF/YER057c/UK114 family) 0.9938 1 126

Map