F457591

General Info

Members Datasets Scaffolds Average Seq Length
513 321 483 292

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10021154|Ga0307515_100211544
Length 315
Sequence MNAISPTPALPPAEATQITPLTVPGAASPAVLPVEATPPKLQRRRRGFGWGGLLGLAVIAFWALAALFGPSLMSHSISAMGGADVFAPMSSAHWLGTDYLGRDMLARVVDGARYTVGIAFVATLLASSIGTTLALLAAASGRWVDAALSRSLDTLTAIPSKMFALLMVAGFGSSVPMLVVAAAIIYVPGAYRIARSLAVNINAMDYVTVARVRGEGTPYVMLREILPNIVGPMLADLGLRFVYVVLLLAGLSFLGLGVQPPVADWGSLVRENIGALPDGGASVIAPALAIASLTIAVNLVIDNLPGRAARERGAR

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
8 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2643221717 Acidovorax sp. Root267 Isolate Unclassified
12 2818991446 Variovorax sp. 1180 Isolate Unclassified
13 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
14 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
15 2842677519 Variovorax sp. R-72495 Isolate Unclassified
16 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
17 2885198086 Variovorax sp. 679 Isolate Unclassified
18 2885211737 Variovorax sp. 553 Isolate Unclassified
19 2899924645 Variovorax sp. 369 Isolate Unclassified
20 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
21 2904456579 Variovorax sp. 2002 Isolate Unclassified
22 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
23 2928037797 Variovorax sp. 1126 Isolate Unclassified
24 2928044640 Variovorax sp. 1128 Isolate Unclassified
25 2928051484 Variovorax sp. 1133 Isolate Unclassified
26 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
27 2928070936 Variovorax gossypii 1167 Isolate Unclassified
28 2929520902 Variovorax beijingensis 502 Isolate Unclassified
29 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
30 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
31 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
34 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
38 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
39 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
42 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
43 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
120 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
126 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
175 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
181 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
182 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
183 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
197 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
205 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
206 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
211 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
212 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
213 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
214 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
215 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
216 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
217 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
218 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
219 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
220 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
221 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
222 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
223 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
224 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
225 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
226 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
227 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
228 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
229 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
230 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
231 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
232 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
233 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
234 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
235 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
236 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
239 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
240 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
253 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
254 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
259 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
260 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
289 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
290 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
303 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
304 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
305 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
306 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
307 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
308 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
309 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
310 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
311 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
312 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
313 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
314 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
315 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
316 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
317 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
318 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
319 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
320 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.57
Metatranscriptomes 0.39
Isolates 6.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.39
Nodule 0.78
Rhizoplane 2.73
Rhizosphere 58.67
Stem 0
Stem Tuber 0
Unclassified 14.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10041869 3300001989 Bacteria 1521
2 JGI25151J46595_10001430 3300003187 Bacteria 16253
3 rootH1_10003890 3300003316 Bacteria 2811
4 rootH1_10003890 3300003323 Bacteria 31835
5 rootH1_10004212 3300003316 Bacteria 4988
6 rootH1_10014318 3300003316 Bacteria 4742
7 rootL2_10000415 3300003322 Bacteria 223695
8 rootL2_10019742 3300003322 Bacteria 11664
9 rootH1_10023430 3300003323 Bacteria 10806
10 rootH1_10031315 3300003323 Bacteria 2808
11 rootH1_10031316 3300003323 Bacteria 2197
12 Ga0006562J51391_1024902 3300003578 Bacteria 2770
13 Ga0006562J51391_1024904 3300003578 Bacteria 1940
14 Ga0055535_1000136 3300003761 Bacteria 77549
15 Ga0055542_1000095 3300003762 Bacteria 119022
16 Ga0055537_1006203 3300003773 Bacteria 3074
17 Ga0055536_1005765 3300003781 Bacteria 5965
18 Ga0055536_1006382 3300003781 Bacteria 5522
19 Ga0055534_1005510 3300003784 Bacteria 3372
20 Ga0055528_1019892 3300003790 Bacteria 2200
21 Ga0055530_10000807 3300003791 Bacteria 26041
22 Ga0055530_10001091 3300003791 Bacteria 21331
23 Ga0055530_10007070 3300003791 Bacteria 4820
24 Ga0055540_1001328 3300003792 Bacteria 14923
25 Ga0055540_1031353 3300003792 Bacteria 1222
26 Ga0055531_10001703 3300003794 Bacteria 15767
27 Ga0065714_10083208 3300005288 Bacteria 2247
28 Ga0070676_10006380 3300005328 Bacteria 6302
29 Ga0070676_10015329 3300005328 Bacteria 4228
30 Ga0070670_100042075 3300005331 Bacteria 3926
31 Ga0070677_10046061 3300005333 Bacteria 1742
32 Ga0068869_100010836 3300005334 Bacteria 5961
33 Ga0068869_100049835 3300005334 Bacteria 3033
34 Ga0070666_10046895 3300005335 Bacteria 2900
35 Ga0070666_10146902 3300005335 Bacteria 1644
36 Ga0068868_100010681 3300005338 Bacteria 6654
37 Ga0070669_100013521 3300005353 Bacteria 5801
38 Ga0070675_100070374 3300005354 Bacteria 2899
39 Ga0070675_100076965 3300005354 Bacteria 2776
40 Ga0070671_100005117 3300005355 Bacteria 10443
41 Ga0070671_100112423 3300005355 Bacteria 2288
42 Ga0070674_100003286 3300005356 Bacteria 9046
43 Ga0070674_100198113 3300005356 Bacteria 1549
44 Ga0070659_100116749 3300005366 Bacteria 2158
45 Ga0070667_100004999 3300005367 Bacteria 11105
46 Ga0070667_100026171 3300005367 Bacteria 4852
47 Ga0070667_100133429 3300005367 Bacteria 2169
48 Ga0070667_100237067 3300005367 Bacteria 1628
49 Ga0070667_100505856 3300005367 Bacteria 1108
50 Ga0070678_100003546 3300005456 Bacteria 8707
51 Ga0070678_100084237 3300005456 Bacteria 2419
52 Ga0070678_100262652 3300005456 Bacteria 1453
53 Ga0070662_100008001 3300005457 Bacteria 6878
54 Ga0070662_100017744 3300005457 Bacteria 4802
55 Ga0070662_100030131 3300005457 Bacteria 3792
56 Ga0070662_100161651 3300005457 Bacteria 1752
57 Ga0070662_100165606 3300005457 Bacteria 1732
58 Ga0068867_100001097 3300005459 Bacteria 18480
59 Ga0068867_100047636 3300005459 Bacteria 3151
60 Ga0070706_100002750 3300005467 Bacteria 17598
61 Ga0070707_100016227 3300005468 Bacteria 6990
62 Ga0068853_100014990 3300005539 Bacteria 6368
63 Ga0068853_100504089 3300005539 Bacteria 1143
64 Ga0070672_100000385 3300005543 Bacteria 25616
65 Ga0070672_100011464 3300005543 Bacteria 6183
66 Ga0070665_100028675 3300005548 Bacteria 5605
67 Ga0070665_100109145 3300005548 Bacteria 2769
68 Ga0068855_100414717 3300005563 Bacteria 1474
69 Ga0070664_100189310 3300005564 Bacteria 1833
70 Ga0068857_100338087 3300005577 Bacteria 1393
71 Ga0068854_100148744 3300005578 Bacteria 1804
72 Ga0068854_100351470 3300005578 Bacteria 1207
73 Ga0068852_100106374 3300005616 Bacteria 2543
74 Ga0068852_100375988 3300005616 Bacteria 1393
75 Ga0068859_100633243 3300005617 Bacteria 1162
76 Ga0068866_10155701 3300005718 Bacteria 1328
77 Ga0068861_100074757 3300005719 Bacteria 2636
78 Ga0068870_10227423 3300005840 Bacteria 1145
79 Ga0068862_100099319 3300005844 Bacteria 2544
80 Ga0075365_10086978 3300006038 Bacteria 2124
81 Ga0075368_10031736 3300006042 Bacteria 2050
82 Ga0075368_10045075 3300006042 Bacteria 1742
83 Ga0075363_100051015 3300006048 Bacteria 2205
84 Ga0075363_100078129 3300006048 Bacteria 1807
85 Ga0075364_10031671 3300006051 Bacteria 3397
86 Ga0075432_10028524 3300006058 Bacteria 1925
87 Ga0075432_10032932 3300006058 Bacteria 1796
88 Ga0075362_10018612 3300006177 Bacteria 2877
89 Ga0075362_10031289 3300006177 Bacteria 2302
90 Ga0075362_10090153 3300006177 Bacteria 1422
91 Ga0075362_10096719 3300006177 Bacteria 1376
92 Ga0075367_10027357 3300006178 Bacteria 3244
93 Ga0075369_10002113 3300006186 Bacteria 7022
94 Ga0075369_10021716 3300006186 Bacteria 2641
95 Ga0075366_10000282 3300006195 Bacteria 22748
96 Ga0075366_10021865 3300006195 Bacteria 3719
97 Ga0075366_10023034 3300006195 Bacteria 3627
98 Ga0075366_10029170 3300006195 Bacteria 3241
99 Ga0097621_100290687 3300006237 Bacteria 1441
100 Ga0075370_10002778 3300006353 Bacteria 8202
101 Ga0075370_10020711 3300006353 Bacteria 3597
102 Ga0075370_10075847 3300006353 Bacteria 1928
103 Ga0075370_10084653 3300006353 Bacteria 1825
104 Ga0075370_10166314 3300006353 Bacteria 1295
105 Ga0075370_10170927 3300006353 Bacteria 1277
106 Ga0068871_100001360 3300006358 Bacteria 16388
107 Ga0075430_100035730 3300006846 Bacteria 4215
108 Ga0075429_100000391 3300006880 Bacteria 32193
109 Ga0068865_100190776 3300006881 Bacteria 1584
110 Ga0097620_100633292 3300006931 Bacteria 1162
111 Ga0099826_10000118 3300006948 Bacteria 36216
112 Ga0099826_10119078 3300006948 Bacteria 1559
113 Ga0105244_10002508 3300009036 Bacteria 13809
114 Ga0105244_10043492 3300009036 Bacteria 2317
115 Ga0105240_10009916 3300009093 Bacteria 13431
116 Ga0105240_10129440 3300009093 Bacteria 3029
117 Ga0111539_10136942 3300009094 Bacteria 2867
118 Ga0105245_10055780 3300009098 Bacteria 3550
119 Ga0105245_10123097 3300009098 Bacteria 2425
120 Ga0105245_10303453 3300009098 Bacteria 1567
121 Ga0105243_10002595 3300009148 Bacteria 15062
122 Ga0105243_10028283 3300009148 Bacteria 4303
123 Ga0105243_10083671 3300009148 Bacteria 2611
124 Ga0105243_10403569 3300009148 Bacteria 1270
125 Ga0105242_10017870 3300009176 Bacteria 5535
126 Ga0105237_10001808 3300009545 Bacteria 27606
127 Ga0105238_10025139 3300009551 Bacteria 6069
128 Ga0105238_10548520 3300009551 Bacteria 1160
129 Ga0105239_10007228 3300010375 Bacteria 12757
130 Ga0105239_10008675 3300010375 Bacteria 11512
131 Ga0105239_10192067 3300010375 Bacteria 2285
132 Ga0105246_10284539 3300011119 Bacteria 1328
133 Ga0157373_10052934 3300013100 Bacteria 2887
134 Ga0157371_10086328 3300013102 Bacteria 2222
135 Ga0157370_10008667 3300013104 Bacteria 10945
136 Ga0157370_10021814 3300013104 Bacteria 6379
137 Ga0157369_10001241 3300013105 Bacteria 31779
138 Ga0157374_10297421 3300013296 Bacteria 1596
139 Ga0157378_10042890 3300013297 Bacteria 4016
140 Ga0157378_10084844 3300013297 Bacteria 2868
141 Ga0163162_10018032 3300013306 Bacteria 6907
142 Ga0157372_10152783 3300013307 Bacteria 2665
143 Ga0157372_10353694 3300013307 Bacteria 1712
144 Ga0157375_10008195 3300013308 Bacteria 9150
145 Ga0157375_10036361 3300013308 Bacteria 4710
146 Ga0182008_10002215 3300014497 Bacteria 12318
147 Ga0182008_10002418 3300014497 Bacteria 11711
148 Ga0182008_10024907 3300014497 Bacteria 3043
149 Ga0157376_10458006 3300014969 Bacteria 1246
150 Ga0182006_1005201 3300015261 Bacteria 6236
151 Ga0182007_10000193 3300015262 Bacteria 41031
152 Ga0182007_10003952 3300015262 Bacteria 6848
153 Ga0163161_10000165 3300017792 Bacteria 60584
154 Ga0163161_10044860 3300017792 Bacteria 3186
155 Ga0209436_108738 3300025208 Bacteria 1988
156 Ga0209672_100385 3300025228 Bacteria 26891
157 Ga0209147_101099 3300025229 Bacteria 11279
158 Ga0209258_100069 3300025242 Bacteria 280496
159 Ga0207425_1000236 3300025245 Bacteria 42815
160 Ga0209148_1000076 3300025254 Bacteria 301449
161 Ga0209129_1000055 3300025258 Bacteria 261708
162 Ga0209129_1002422 3300025258 Bacteria 9168
163 Ga0209565_1000182 3300025263 Bacteria 77316
164 Ga0209565_1000275 3300025263 Bacteria 52195
165 Ga0209565_1006859 3300025263 Bacteria 3143
166 Ga0209673_1000106 3300025273 Bacteria 185426
167 Ga0209673_1000415 3300025273 Bacteria 74762
168 Ga0209673_1001604 3300025273 Bacteria 19856
169 Ga0209673_1013932 3300025273 Bacteria 3143
170 Ga0209675_1000058 3300025291 Bacteria 185426
171 Ga0209676_1000028 3300025292 Bacteria 559745
172 Ga0209676_1000216 3300025292 Bacteria 125759
173 Ga0209676_1000912 3300025292 Bacteria 36938
174 Ga0209025_1000174 3300025294 Bacteria 158915
175 Ga0209025_1003933 3300025294 Bacteria 13352
176 Ga0209564_1000220 3300025295 Bacteria 129579
177 Ga0209564_1000442 3300025295 Bacteria 71380
178 Ga0209758_1000042 3300025297 Bacteria 407145
179 Ga0209050_1000072 3300025298 Bacteria 293619
180 Ga0209050_1000133 3300025298 Bacteria 184688
181 Ga0209050_1000699 3300025298 Bacteria 49865
182 Ga0209256_1000117 3300025299 Bacteria 169435
183 Ga0209256_1000148 3300025299 Bacteria 147639
184 Ga0207426_1000055 3300025302 Bacteria 374450
185 Ga0207426_1000166 3300025302 Bacteria 169435
186 Ga0209051_1000015 3300025303 Bacteria 546798
187 Ga0209051_1000056 3300025303 Bacteria 271616
188 Ga0209051_1000126 3300025303 Bacteria 142582
189 Ga0209051_1000355 3300025303 Bacteria 67873
190 Ga0209257_1000037 3300025304 Bacteria 612915
191 Ga0209257_1000214 3300025304 Bacteria 136547
192 Ga0207656_10005634 3300025321 Bacteria 4443
193 Ga0207655_1034294 3300025728 Bacteria 2284
194 Ga0207682_10048026 3300025893 Bacteria 1759
195 Ga0207642_10045253 3300025899 Bacteria 1953
196 Ga0207680_10002712 3300025903 Bacteria 8271
197 Ga0207645_10002729 3300025907 Bacteria 13746
198 Ga0207645_10190223 3300025907 Bacteria 1349
199 Ga0207645_10250490 3300025907 Bacteria 1172
200 Ga0207643_10271995 3300025908 Bacteria 1049
201 Ga0207684_10002611 3300025910 Bacteria 18016
202 Ga0207695_10014701 3300025913 Bacteria 9255
203 Ga0207695_10143937 3300025913 Bacteria 2330
204 Ga0207695_10241623 3300025913 Bacteria 1707
205 Ga0207671_10005941 3300025914 Bacteria 11060
206 Ga0207671_10011317 3300025914 Bacteria 7271
207 Ga0207671_10069790 3300025914 Bacteria 2619
208 Ga0207649_10168442 3300025920 Bacteria 1524
209 Ga0207646_10394959 3300025922 Bacteria 1249
210 Ga0207681_10023385 3300025923 Bacteria 3952
211 Ga0207694_10018637 3300025924 Bacteria 5247
212 Ga0207694_10037157 3300025924 Bacteria 3738
213 Ga0207650_10123326 3300025925 Bacteria 2019
214 Ga0207644_10001695 3300025931 Bacteria 14215
215 Ga0207644_10087428 3300025931 Bacteria 2317
216 Ga0207690_10198788 3300025932 Bacteria 1521
217 Ga0207706_10005300 3300025933 Bacteria 12021
218 Ga0207706_10049062 3300025933 Bacteria 3732
219 Ga0207706_10058965 3300025933 Bacteria 3381
220 Ga0207706_10101250 3300025933 Bacteria 2534
221 Ga0207709_10000762 3300025935 Bacteria 25398
222 Ga0207709_10034199 3300025935 Bacteria 2993
223 Ga0207669_10004075 3300025937 Bacteria 6401
224 Ga0207669_10033374 3300025937 Bacteria 2904
225 Ga0207669_10072471 3300025937 Bacteria 2169
226 Ga0207704_10025320 3300025938 Bacteria 3235
227 Ga0207691_10002117 3300025940 Bacteria 19415
228 Ga0207691_10056892 3300025940 Bacteria 3561
229 Ga0207691_10105695 3300025940 Bacteria 2508
230 Ga0207689_10036374 3300025942 Bacteria 4088
231 Ga0207689_10064467 3300025942 Bacteria 3015
232 Ga0207689_10351088 3300025942 Bacteria 1226
233 Ga0207679_10031030 3300025945 Bacteria 3738
234 Ga0207651_10005747 3300025960 Bacteria 6405
235 Ga0207640_10087560 3300025981 Bacteria 2147
236 Ga0207640_10225876 3300025981 Bacteria 1437
237 Ga0207658_10023403 3300025986 Bacteria 4311
238 Ga0207658_10586484 3300025986 Bacteria 1000
239 Ga0207639_10010235 3300026041 Bacteria 6489
240 Ga0207639_10018865 3300026041 Bacteria 4909
241 Ga0207639_10096554 3300026041 Bacteria 2378
242 Ga0207678_10024716 3300026067 Bacteria 5245
243 Ga0207708_10029490 3300026075 Bacteria 4159
244 Ga0207648_10001677 3300026089 Bacteria 24259
245 Ga0207648_10010070 3300026089 Bacteria 8993
246 Ga0207648_10011635 3300026089 Bacteria 8282
247 Ga0207648_10171025 3300026089 Bacteria 1920
248 Ga0207648_10406261 3300026089 Bacteria 1235
249 Ga0207676_10344982 3300026095 Bacteria 1375
250 Ga0207674_10023050 3300026116 Bacteria 6676
251 Ga0207674_10064216 3300026116 Bacteria 3704
252 Ga0207683_10001175 3300026121 Bacteria 23700
253 Ga0207698_10046901 3300026142 Bacteria 3268
254 Ga0207698_10062576 3300026142 Bacteria 2907
255 Ga0207698_10107134 3300026142 Bacteria 2333
256 Ga0207698_10157878 3300026142 Bacteria 1979
257 Ga0207698_10275886 3300026142 Bacteria 1552
258 Ga0209973_1003911 3300027252 Bacteria 1498
259 Ga0209282_1000893 3300027666 Bacteria 15507
260 Ga0209813_10024316 3300027866 Bacteria 1731
261 Ga0207428_10297628 3300027907 Bacteria 1194
262 Ga0268266_10142866 3300028379 Bacteria 2149
263 Ga0307517_10017727 3300028786 Bacteria 9257
264 Ga0307515_10000424 3300028794 Bacteria 101910
265 Ga0307515_10001625 3300028794 Bacteria 50019
266 Ga0307515_10021154 3300028794 Bacteria 11550
267 Ga0307515_10027502 3300028794 Bacteria 9721
268 Ga0307515_10029411 3300028794 Bacteria 9285
269 Ga0307515_10053185 3300028794 Bacteria 5982
270 Ga0307515_10063943 3300028794 Bacteria 5154
271 Ga0307515_10084863 3300028794 Bacteria 4060
272 Ga0307512_10062767 3300030522 Bacteria 2846
273 Ga0307512_10063559 3300030522 Bacteria 2820
274 Ga0307512_10188126 3300030522 Bacteria 1145
275 Ga0314311_1036622 3300030733 Bacteria 1363
276 Ga0316183_1111195 3300030742 Bacteria 2387
277 Ga0316182_1143789 3300030745 Bacteria 1622
278 Ga0307513_10001531 3300031456 Bacteria 33094
279 Ga0307513_10013499 3300031456 Bacteria 10023
280 Ga0307513_10028426 3300031456 Bacteria 6394
281 Ga0307513_10058728 3300031456 Bacteria 4086
282 Ga0307513_10061071 3300031456 Bacteria 3992
283 Ga0307509_10001361 3300031507 Bacteria 41386
284 Ga0307509_10003877 3300031507 Bacteria 22152
285 Ga0307509_10011254 3300031507 Bacteria 10856
286 Ga0307509_10171710 3300031507 Bacteria 2046
287 Ga0307408_100000939 3300031548 Bacteria 22685
288 Ga0307508_10011189 3300031616 Bacteria 8208
289 Ga0307508_10032811 3300031616 Bacteria 4688
290 Ga0307508_10204999 3300031616 Bacteria 1572
291 Ga0307514_10025905 3300031649 Bacteria 4743
292 Ga0307514_10043556 3300031649 Bacteria 3523
293 Ga0307516_10003867 3300031730 Bacteria 18921
294 Ga0307516_10025853 3300031730 Bacteria 5971
295 Ga0307516_10098504 3300031730 Bacteria 2742
296 Ga0307405_10032061 3300031731 Bacteria 3101
297 Ga0307518_10081695 3300031838 Bacteria 2333
298 Ga0307406_10000738 3300031901 Bacteria 18317
299 Ga0307406_10006122 3300031901 Bacteria 6611
300 Ga0307406_10119347 3300031901 Bacteria 1830
301 Ga0307412_10042638 3300031911 Bacteria 2950
302 Ga0307412_10454017 3300031911 Bacteria 1056
303 Ga0307416_100052505 3300032002 Bacteria 3264
304 Ga0307416_100691522 3300032002 Bacteria 1108
305 Ga0307411_10000452 3300032005 Bacteria 14127
306 Ga0307411_10012742 3300032005 Bacteria 4606
307 Ga0307411_10097028 3300032005 Bacteria 2073
308 Ga0307507_10040295 3300033179 Bacteria 4694
309 Ga0307507_10104515 3300033179 Bacteria 2350
310 Ga0307510_10098640 3300033180 Bacteria 2724
311 Ga0307510_10206075 3300033180 Bacteria 1494
312 Ga0373925_0009219 3300037068 Bacteria 7183
313 Ga0395899_0002873 3300037312 Bacteria 13843
314 Ga0395899_0100342 3300037312 Bacteria 2090
315 Ga0395900_0000569 3300037418 Bacteria 51069
316 Ga0395905_0006783 3300037471 Bacteria 11475
317 Ga0395905_0016418 3300037471 Bacteria 7037
318 Ga0395905_0039287 3300037471 Bacteria 4439
319 Ga0395905_0133536 3300037471 Bacteria 2334
320 Ga0395901_0000378 3300038443 Bacteria 53368
321 Ga0395901_0052071 3300038443 Bacteria 4255
322 Ga0439436_0017664 3300041404 Bacteria 2134
323 Ga0439447_010115 3300041407 Bacteria 2815
324 Ga0439461_0006998 3300041410 Bacteria 1983
325 Ga0439466_0004713 3300041411 Bacteria 5242
326 Ga0439466_0048340 3300041411 Bacteria 1399
327 Ga0439465_0000713 3300041413 Bacteria 10223
328 Ga0439465_0012978 3300041413 Bacteria 2604
329 Ga0451800_0175717 3300041459 Bacteria 1126
330 Ga0451853_3557593 3300041512 Bacteria 1877
331 Ga0439431_0001073 3300041997 Bacteria 5921
332 Ga0439431_0008323 3300041997 Bacteria 2330
333 Ga0439433_0001657 3300041999 Bacteria 4637
334 Ga0439442_003895 3300042002 Bacteria 2959
335 Ga0439442_004850 3300042002 Bacteria 2678
336 Ga0439442_016052 3300042002 Bacteria 1543
337 Ga0439445_0001873 3300042004 Bacteria 4632
338 Ga0439445_0005692 3300042004 Bacteria 2847
339 Ga0439448_0110389 3300042005 Bacteria 939
340 Ga0439432_018189 3300042006 Bacteria 2351
341 Ga0439449_0009465 3300042007 Bacteria 3694
342 Ga0439449_0030927 3300042007 Bacteria 1995
343 Ga0439450_037704 3300042008 Bacteria 1112
344 Ga0439452_003220 3300042010 Bacteria 5774
345 Ga0439452_006084 3300042010 Bacteria 3811
346 Ga0439454_007759 3300042011 Bacteria 1353
347 Ga0439455_0018192 3300042012 Bacteria 1646
348 Ga0439457_003147 3300042014 Bacteria 4555
349 Ga0439457_003203 3300042014 Bacteria 4502
350 Ga0439462_0003329 3300042015 Bacteria 3845
351 Ga0439462_0010897 3300042015 Bacteria 2308
352 Ga0450919_000104 3300042121 Bacteria 8491
353 Ga0450920_007056 3300042122 Bacteria 2030
354 Ga0450922_003686 3300042124 Bacteria 1408
355 Ga0450923_000920 3300042125 Bacteria 3629
356 Ga0450923_009801 3300042125 Bacteria 1684
357 Ga0450897_000032 3300042128 Bacteria 6299
358 Ga0450895_002968 3300042132 Bacteria 1290
359 Ga0450898_000702 3300042134 Bacteria 4051
360 Ga0450899_000336 3300042135 Bacteria 5172
361 Ga0450906_001370 3300042145 Bacteria 5316
362 Ga0450907_007476 3300042146 Bacteria 1823
363 Ga0450910_000479 3300042147 Bacteria 4748
364 Ga0450910_001490 3300042147 Bacteria 2960
365 Ga0439446_0001731 3300042156 Bacteria 5068
366 Ga0439458_0041490 3300042157 Bacteria 1118
367 Ga0450908_000605 3300042184 Bacteria 6875
368 Ga0439434_0007134 3300042435 Bacteria 3269
369 Ga0439434_0008678 3300042435 Bacteria 2985
370 Ga0439459_0011334 3300042438 Bacteria 1570
371 Ga0450918_000256 3300042531 Bacteria 12019
372 Ga0450918_000535 3300042531 Bacteria 8146
373 Ga0450893_0015020 3300042532 Bacteria 1303
374 Ga0451577_0000270 3300042876 Bacteria 101581
375 Ga0451577_0004473 3300042876 Bacteria 14756
376 Ga0466972_0028113 3300044658 Bacteria 2777
377 Ga0453684_0000868 3300044712 Bacteria 101512
378 Ga0453684_0010698 3300044712 Bacteria 15601
379 Ga0466971_0053094 3300044719 Bacteria 1826
380 Ga0451576_0214035 3300045051 Bacteria 2012
381 Ga0495627_011304 3300046453 Bacteria 3208
382 Ga0495592_0000418 3300046454 Bacteria 32266
383 Ga0495638_0069462 3300046460 Bacteria 2159
384 Ga0495582_0199725 3300046473 Bacteria 1142
385 Ga0495583_0097412 3300046506 Bacteria 1259
386 Ga0495610_0021976 3300046512 Bacteria 3499
387 Ga0495610_0052598 3300046512 Bacteria 1976
388 Ga0495616_0000220 3300046513 Bacteria 47083
389 Ga0495618_0164603 3300046514 Bacteria 1413
390 Ga0495620_0003900 3300046515 Bacteria 8508
391 Ga0495620_0021944 3300046515 Bacteria 3088
392 Ga0495620_0059930 3300046515 Bacteria 1589
393 Ga0495630_0064464 3300046517 Bacteria 2753
394 Ga0495631_0000512 3300046518 Bacteria 25952
395 Ga0495632_0023011 3300046519 Bacteria 3333
396 Ga0495637_0015742 3300046520 Bacteria 3544
397 Ga0495654_0029878 3300046530 Bacteria 2777
398 Ga0495609_0034785 3300046538 Bacteria 2282
399 Ga0495668_0167650 3300046616 Bacteria 1203
400 Ga0495625_0000052 3300046660 Bacteria 190656
401 Ga0495588_0019458 3300046674 Bacteria 3324
402 Ga0495624_0095023 3300046690 Bacteria 1837
403 Ga0495687_021154 3300047443 Bacteria 3155
404 Ga0495687_044313 3300047443 Bacteria 1934
405 Ga0495593_0042628 3300047673 Bacteria 2435
406 Ga0495614_0094787 3300048089 Bacteria 1301
407 Ga0495626_0095752 3300048091 Bacteria 1300
408 Ga0496100_0134940 3300048903 Bacteria 1743
409 Ga0496101_0116536 3300048904 Bacteria 2015
410 Ga0496102_0032427 3300048905 Bacteria 4691
411 Ga0496102_0691654 3300048905 Bacteria 943
412 Ga0496103_0137117 3300048906 Bacteria 1564
413 Ga0496105_0089725 3300048908 Bacteria 2539
414 Ga0496106_0006204 3300048909 Bacteria 8841
415 Ga0496108_0011171 3300048911 Bacteria 7295
416 Ga0496109_0287684 3300048912 Bacteria 1549
417 Ga0496113_0152184 3300048916 Bacteria 1826
418 Ga0496116_0018757 3300048919 Bacteria 5317
419 Ga0496117_0061917 3300048920 Bacteria 2568
420 Ga0496118_0010901 3300048921 Bacteria 8940
421 Ga0496118_0189605 3300048921 Bacteria 1231
422 Ga0496122_0152335 3300048925 Bacteria 1425
423 Ga0496123_0032119 3300048926 Bacteria 3808
424 Ga0496124_0006696 3300048927 Bacteria 12473
425 Ga0496124_0247535 3300048927 Bacteria 1321
426 Ga0496124_0257261 3300048927 Bacteria 1287
427 Ga0496125_0020311 3300048928 Bacteria 6235
428 Ga0496126_0103587 3300048929 Bacteria 2487
429 Ga0501298_000677 3300049521 Bacteria 4724
430 Ga0501047_0077598 3300049581 Bacteria 3195
431 Ga0501249_002002 3300049679 Bacteria 4144
432 Ga0501225_0004839 3300049705 Bacteria 3982
433 Ga0501262_000340 3300049759 Bacteria 5669
434 Ga0501262_001467 3300049759 Bacteria 2649
435 Ga0501035_0001776 3300049822 Bacteria 21781
436 Ga0501044_0023820 3300049823 Bacteria 6507
437 nmdc:mga03683_25055_c1 3300050489 Bacteria 2339
438 nmdc:mga03683_264_c1 3300050489 Bacteria 12697
439 nmdc:mga03683_53572_c1 3300050489 Bacteria 1689
440 nmdc:mga03683_69067_c1 3300050489 Bacteria 1507
441 nmdc:mga03n38_40105_c1 3300050490 Bacteria 2034
442 nmdc:mga00v17_111375_c1 3300050491 Bacteria 1737
443 nmdc:mga0yw44_129643_c1 3300050492 Bacteria 1631
444 nmdc:mga0k408_121639_c1 3300050493 Bacteria 1546
445 nmdc:mga0k408_5052_c1 3300050493 Bacteria 6987
446 nmdc:mga0k408_52679_c1 3300050493 Bacteria 2359
447 nmdc:mga0k408_6824_c1 3300050493 Bacteria 6088
448 nmdc:mga0k408_80394_c1 3300050493 Bacteria 1908
449 nmdc:mga0k408_91025_c1 3300050493 Bacteria 1792
450 nmdc:mga06z11_52835_c1 3300050494 Bacteria 2087
451 nmdc:mga07m45_10356_c1 3300050496 Bacteria 4868
452 nmdc:mga07m45_16151_c1 3300050496 Bacteria 3995
453 nmdc:mga07m45_17477_c1 3300050496 Bacteria 3853
454 nmdc:mga07m45_24957_c1 3300050496 Bacteria 3277
455 nmdc:mga07m45_35054_c1 3300050496 Bacteria 2791
456 nmdc:mga07m45_39174_c1 3300050496 Bacteria 2648
457 nmdc:mga07m45_8155_c1 3300050496 Bacteria 5372
458 nmdc:mga09592_728_c1 3300050508 Bacteria 25328
459 nmdc:mga08y16_237336_c1 3300050511 Bacteria 1885
460 Ga0500643_006387 3300053087 Bacteria 4931
461 Ga0500583_0114109 3300053092 Bacteria 1333
462 Ga0500651_0000123 3300053093 Bacteria 47588
463 Ga0500651_0178501 3300053093 Bacteria 1262
464 Ga0500571_000013 3300053110 Bacteria 71532
465 Ga0500593_001517 3300053117 Bacteria 8344
466 Ga0500597_069739 3300053120 Bacteria 1519
467 Ga0500607_000211 3300053121 Bacteria 53358
468 Ga0500626_032153 3300053128 Bacteria 2372
469 Ga0500655_005312 3300053133 Bacteria 2327
470 Ga0500658_0000332 3300053134 Bacteria 21039
471 Ga0500658_0006167 3300053134 Bacteria 4459
472 Ga0500658_0016790 3300053134 Bacteria 2729
473 Ga0500559_0000021 3300053136 Bacteria 129980
474 Ga0500564_101518 3300053138 Bacteria 1270
475 Ga0500568_0000409 3300053139 Bacteria 32815
476 Ga0500568_0025138 3300053139 Bacteria 2516
477 Ga0500574_054337 3300053141 Bacteria 1151
478 Ga0500616_0011574 3300053153 Bacteria 5200
479 Ga0500619_053276 3300053154 Bacteria 1315
480 Ga0500627_0001945 3300053158 Bacteria 5944
481 Ga0500634_0109903 3300053161 Bacteria 1363
482 Ga0500638_103784 3300053162 Bacteria 1322
483 Ga0466962_0042096 3300061719 Bacteria 2186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006058 Ga0075432_10032932 Ga0075432_100329322 251
2 3300030522 Ga0307512_10062767 Ga0307512_100627672 252
3 3300031507 Ga0307509_10001361 Ga0307509_1000136116 252
4 3300046454 Ga0495592_0000418 Ga0495592_0000418_29310_30164 252
5 3300053154 Ga0500619_053276 Ga0500619_053276_342_1196 252
6 3300031456 Ga0307513_10061071 Ga0307513_100610713 253
7 3300031838 Ga0307518_10081695 Ga0307518_100816952 253
8 3300027252 Ga0209973_1003911 Ga0209973_10039112 256
9 3300042008 Ga0439450_037704 Ga0439450_037704_104_955 257
10 3300049581 Ga0501047_0077598 Ga0501047_0077598_984_1853 257
11 3300037471 Ga0395905_0039287 Ga0395905_0039287_3054_3908 258
12 3300038443 Ga0395901_0052071 Ga0395901_0052071_2566_3420 258
13 3300048925 Ga0496122_0152335 Ga0496122_0152335_91_945 258
14 3300048927 Ga0496124_0257261 Ga0496124_0257261_13_867 258
15 3300050496 nmdc:mga07m45_17477_c1 nmdc:mga07m45_17477_c1_2965_3741 258
16 3300028794 Ga0307515_10000424 Ga0307515_1000042411 261
17 3300048927 Ga0496124_0247535 Ga0496124_0247535_348_1250 263
18 3300030745 Ga0316182_1143789 Ga0316182_11437892 265
19 3300037068 Ga0373925_0009219 Ga0373925_0009219_1921_2775 265
20 3300028794 Ga0307515_10027502 Ga0307515_100275022 266
21 3300009098 Ga0105245_10055780 Ga0105245_100557802 267
22 3300005467 Ga0070706_100002750 Ga0070706_1000027507 269
23 3300005468 Ga0070707_100016227 Ga0070707_1000162272 269
24 3300006195 Ga0075366_10029170 Ga0075366_100291703 269
25 3300025910 Ga0207684_10002611 Ga0207684_100026113 269
26 3300025922 Ga0207646_10394959 Ga0207646_103949592 269
27 3300028794 Ga0307515_10001625 Ga0307515_1000162543 272
28 3300031456 Ga0307513_10013499 Ga0307513_100134993 273
29 3300042121 Ga0450919_000104 Ga0450919_000104_4140_4964 274
30 3300042125 Ga0450923_009801 Ga0450923_009801_335_1159 274
31 3300042531 Ga0450918_000256 Ga0450918_000256_7028_7852 274
32 3300006195 Ga0075366_10000282 Ga0075366_100002826 275
33 3300031649 Ga0307514_10025905 Ga0307514_100259053 275
34 3300042876 Ga0451577_0000270 Ga0451577_0000270_71661_72488 275
35 3300044712 Ga0453684_0000868 Ga0453684_0000868_29020_29847 275
36 3300050493 nmdc:mga0k408_5052_c1 nmdc:mga0k408_5052_c1_3711_4586 275
37 3300006195 Ga0075366_10023034 Ga0075366_100230343 277
38 3300013307 Ga0157372_10152783 Ga0157372_101527832 277
39 3300037312 Ga0395899_0002873 Ga0395899_0002873_1958_2809 277
40 3300037418 Ga0395900_0000569 Ga0395900_0000569_29481_30332 277
41 3300042005 Ga0439448_0110389 Ga0439448_0110389_73_924 277
42 3300048903 Ga0496100_0134940 Ga0496100_0134940_369_1220 277
43 3300048905 Ga0496102_0691654 Ga0496102_0691654_71_922 277
44 3300048906 Ga0496103_0137117 Ga0496103_0137117_457_1308 277
45 3300048909 Ga0496106_0006204 Ga0496106_0006204_6875_7726 277
46 3300049822 Ga0501035_0001776 Ga0501035_0001776_4587_5438 277
47 3300050493 nmdc:mga0k408_91025_c1 nmdc:mga0k408_91025_c1_555_1442 277
48 3300003322 rootL2_10019742 rootL2_100197423 278
49 3300009148 Ga0105243_10083671 Ga0105243_100836712 278
50 3300009176 Ga0105242_10017870 Ga0105242_100178702 278
51 3300037312 Ga0395899_0100342 Ga0395899_0100342_946_1812 278
52 3300037471 Ga0395905_0006783 Ga0395905_0006783_295_1161 278
53 3300038443 Ga0395901_0000378 Ga0395901_0000378_29008_29862 278
54 3300049823 Ga0501044_0023820 Ga0501044_0023820_4773_5627 278
55 3300037471 Ga0395905_0016418 Ga0395905_0016418_2478_3356 279
56 iso_pu_bacteria 2919704043 2919707888 279
57 3300005367 Ga0070667_100505856 Ga0070667_1005058562 280
58 3300028786 Ga0307517_10017727 Ga0307517_100177275 280
59 3300028794 Ga0307515_10053185 Ga0307515_100531855 280
60 3300031456 Ga0307513_10028426 Ga0307513_100284265 280
61 3300031507 Ga0307509_10003877 Ga0307509_1000387722 280
62 3300031507 Ga0307509_10011254 Ga0307509_100112543 280
63 3300031507 Ga0307509_10171710 Ga0307509_101717102 280
64 3300031616 Ga0307508_10011189 Ga0307508_100111894 280
65 3300031616 Ga0307508_10032811 Ga0307508_100328112 280
66 3300031616 Ga0307508_10204999 Ga0307508_102049992 280
67 3300031649 Ga0307514_10043556 Ga0307514_100435561 280
68 3300031730 Ga0307516_10003867 Ga0307516_100038679 280
69 3300031730 Ga0307516_10098504 Ga0307516_100985042 280
70 3300033179 Ga0307507_10040295 Ga0307507_100402953 280
71 3300033180 Ga0307510_10098640 Ga0307510_100986402 280
72 3300033180 Ga0307510_10206075 Ga0307510_102060752 280
73 3300044719 Ga0466971_0053094 Ga0466971_0053094_514_1377 280
74 3300046512 Ga0495610_0021976 Ga0495610_0021976_166_1020 280
75 3300046514 Ga0495618_0164603 Ga0495618_0164603_396_1250 280
76 3300046515 Ga0495620_0059930 Ga0495620_0059930_172_1038 280
77 3300046517 Ga0495630_0064464 Ga0495630_0064464_223_1077 280
78 3300046660 Ga0495625_0000052 Ga0495625_0000052_106513_107364 280
79 3300046690 Ga0495624_0095023 Ga0495624_0095023_666_1520 280
80 3300048089 Ga0495614_0094787 Ga0495614_0094787_315_1169 280
81 3300048091 Ga0495626_0095752 Ga0495626_0095752_257_1123 280
82 3300050491 nmdc:mga00v17_111375_c1 nmdc:mga00v17_111375_c1_316_1167 280
83 3300053092 Ga0500583_0114109 Ga0500583_0114109_405_1259 280
84 3300053093 Ga0500651_0178501 Ga0500651_0178501_150_1004 280
85 3300053136 Ga0500559_0000021 Ga0500559_0000021_8182_9036 280
86 3300061719 Ga0466962_0042096 Ga0466962_0042096_1101_1964 280
87 3300003316 rootH1_10014318 rootH1_100143183 281
88 3300003322 rootL2_10000415 rootL2_10000415154 281
89 3300003323 rootH1_10023430 rootH1_100234303 281
90 3300005366 Ga0070659_100116749 Ga0070659_1001167491 281
91 3300005457 Ga0070662_100008001 Ga0070662_1000080015 281
92 3300005616 Ga0068852_100375988 Ga0068852_1003759882 281
93 3300025933 Ga0207706_10101250 Ga0207706_101012502 281
94 3300026142 Ga0207698_10107134 Ga0207698_101071342 281
95 3300048919 Ga0496116_0018757 Ga0496116_0018757_1807_2721 281
96 3300048920 Ga0496117_0061917 Ga0496117_0061917_1379_2293 281
97 3300048921 Ga0496118_0010901 Ga0496118_0010901_7712_8626 281
98 3300005328 Ga0070676_10006380 Ga0070676_100063804 282
99 3300005355 Ga0070671_100112423 Ga0070671_1001124232 282
100 3300005578 Ga0068854_100148744 Ga0068854_1001487442 282
101 3300013296 Ga0157374_10297421 Ga0157374_102974212 282
102 3300013297 Ga0157378_10084844 Ga0157378_100848443 282
103 3300025907 Ga0207645_10002729 Ga0207645_1000272911 282
104 3300025981 Ga0207640_10087560 Ga0207640_100875602 282
105 3300026089 Ga0207648_10010070 Ga0207648_100100704 282
106 3300046473 Ga0495582_0199725 Ga0495582_0199725_56_916 282
107 3300005564 Ga0070664_100189310 Ga0070664_1001893102 283
108 3300006237 Ga0097621_100290687 Ga0097621_1002906872 283
109 3300009036 Ga0105244_10002508 Ga0105244_100025088 283
110 3300009148 Ga0105243_10002595 Ga0105243_100025953 283
111 3300011119 Ga0105246_10284539 Ga0105246_102845391 283
112 3300014497 Ga0182008_10024907 Ga0182008_100249073 283
113 3300014969 Ga0157376_10458006 Ga0157376_104580061 283
114 3300015261 Ga0182006_1005201 Ga0182006_10052014 283
115 3300015262 Ga0182007_10003952 Ga0182007_100039522 283
116 3300025728 Ga0207655_1034294 Ga0207655_10342942 283
117 3300025924 Ga0207694_10037157 Ga0207694_100371573 283
118 3300025935 Ga0207709_10000762 Ga0207709_1000076213 283
119 3300025945 Ga0207679_10031030 Ga0207679_100310303 283
120 3300026041 Ga0207639_10096554 Ga0207639_100965541 283
121 3300042011 Ga0439454_007759 Ga0439454_007759_196_1101 283
122 3300042012 Ga0439455_0018192 Ga0439455_0018192_494_1399 283
123 3300042532 Ga0450893_0015020 Ga0450893_0015020_306_1211 283
124 3300048928 Ga0496125_0020311 Ga0496125_0020311_3636_4544 283
125 3300050489 nmdc:mga03683_69067_c1 nmdc:mga03683_69067_c1_212_1117 283
126 iso_pu_bacteria 2547132374 2548498082 283
127 iso_pu_bacteria 2643221717 2644645965 283
128 3300005539 Ga0068853_100504089 Ga0068853_1005040891 284
129 3300009545 Ga0105237_10001808 Ga0105237_1000180822 284
130 3300009551 Ga0105238_10025139 Ga0105238_100251394 284
131 3300010375 Ga0105239_10008675 Ga0105239_100086757 284
132 3300025913 Ga0207695_10014701 Ga0207695_100147013 284
133 3300025914 Ga0207671_10005941 Ga0207671_100059416 284
134 3300025924 Ga0207694_10018637 Ga0207694_100186374 284
135 3300026041 Ga0207639_10018865 Ga0207639_100188651 284
136 3300028379 Ga0268266_10142866 Ga0268266_101428662 284
137 3300041413 Ga0439465_0012978 Ga0439465_0012978_469_1332 284
138 3300042002 Ga0439442_003895 Ga0439442_003895_1873_2736 284
139 3300042122 Ga0450920_007056 Ga0450920_007056_163_1026 284
140 3300042124 Ga0450922_003686 Ga0450922_003686_302_1165 284
141 3300042147 Ga0450910_000479 Ga0450910_000479_1744_2607 284
142 3300042157 Ga0439458_0041490 Ga0439458_0041490_13_885 284
143 3300042435 Ga0439434_0007134 Ga0439434_0007134_2127_2990 284
144 3300042531 Ga0450918_000535 Ga0450918_000535_3158_4021 284
145 iso_pu_bacteria 2643221544 2643746302 285
146 3300006177 Ga0075362_10090153 Ga0075362_100901532 286
147 3300042438 Ga0439459_0011334 Ga0439459_0011334_534_1439 286
148 3300042876 Ga0451577_0004473 Ga0451577_0004473_1460_2350 286
149 3300044712 Ga0453684_0010698 Ga0453684_0010698_2922_3812 286
150 3300045051 Ga0451576_0214035 Ga0451576_0214035_832_1722 286
151 3300048904 Ga0496101_0116536 Ga0496101_0116536_432_1352 286
152 3300048911 Ga0496108_0011171 Ga0496108_0011171_2203_3123 286
153 3300048912 Ga0496109_0287684 Ga0496109_0287684_171_1091 286
154 3300048916 Ga0496113_0152184 Ga0496113_0152184_469_1389 286
155 3300050489 nmdc:mga03683_53572_c1 nmdc:mga03683_53572_c1_568_1473 286
156 3300050493 nmdc:mga0k408_80394_c1 nmdc:mga0k408_80394_c1_510_1415 286
157 3300005328 Ga0070676_10015329 Ga0070676_100153293 287
158 3300005331 Ga0070670_100042075 Ga0070670_1000420753 287
159 3300005333 Ga0070677_10046061 Ga0070677_100460612 287
160 3300005334 Ga0068869_100010836 Ga0068869_1000108364 287
161 3300005335 Ga0070666_10046895 Ga0070666_100468952 287
162 3300005338 Ga0068868_100010681 Ga0068868_1000106813 287
163 3300005353 Ga0070669_100013521 Ga0070669_1000135212 287
164 3300005354 Ga0070675_100070374 Ga0070675_1000703742 287
165 3300005354 Ga0070675_100076965 Ga0070675_1000769652 287
166 3300005355 Ga0070671_100005117 Ga0070671_1000051175 287
167 3300005356 Ga0070674_100003286 Ga0070674_1000032866 287
168 3300005367 Ga0070667_100004999 Ga0070667_1000049997 287
169 3300005367 Ga0070667_100026171 Ga0070667_1000261712 287
170 3300005367 Ga0070667_100133429 Ga0070667_1001334292 287
171 3300005456 Ga0070678_100003546 Ga0070678_1000035463 287
172 3300005456 Ga0070678_100084237 Ga0070678_1000842372 287
173 3300005457 Ga0070662_100017744 Ga0070662_1000177442 287
174 3300005457 Ga0070662_100161651 Ga0070662_1001616512 287
175 3300005457 Ga0070662_100165606 Ga0070662_1001656062 287
176 3300005459 Ga0068867_100001097 Ga0068867_1000010974 287
177 3300005459 Ga0068867_100047636 Ga0068867_1000476363 287
178 3300005539 Ga0068853_100014990 Ga0068853_1000149903 287
179 3300005543 Ga0070672_100000385 Ga0070672_1000003857 287
180 3300005543 Ga0070672_100011464 Ga0070672_1000114644 287
181 3300005548 Ga0070665_100028675 Ga0070665_1000286753 287
182 3300005563 Ga0068855_100414717 Ga0068855_1004147172 287
183 3300005578 Ga0068854_100351470 Ga0068854_1003514702 287
184 3300005616 Ga0068852_100106374 Ga0068852_1001063742 287
185 3300005718 Ga0068866_10155701 Ga0068866_101557012 287
186 3300005719 Ga0068861_100074757 Ga0068861_1000747572 287
187 3300005840 Ga0068870_10227423 Ga0068870_102274231 287
188 3300005844 Ga0068862_100099319 Ga0068862_1000993192 287
189 3300006353 Ga0075370_10002778 Ga0075370_100027783 287
190 3300006358 Ga0068871_100001360 Ga0068871_10000136017 287
191 3300006846 Ga0075430_100035730 Ga0075430_1000357303 287
192 3300006880 Ga0075429_100000391 Ga0075429_10000039122 287
193 3300006881 Ga0068865_100190776 Ga0068865_1001907762 287
194 3300009094 Ga0111539_10136942 Ga0111539_101369422 287
195 3300009098 Ga0105245_10123097 Ga0105245_101230972 287
196 3300013104 Ga0157370_10008667 Ga0157370_100086673 287
197 3300013297 Ga0157378_10042890 Ga0157378_100428902 287
198 3300013306 Ga0163162_10018032 Ga0163162_100180323 287
199 3300013308 Ga0157375_10008195 Ga0157375_100081953 287
200 3300013308 Ga0157375_10036361 Ga0157375_100363614 287
201 3300014497 Ga0182008_10002215 Ga0182008_100022154 287
202 3300025893 Ga0207682_10048026 Ga0207682_100480262 287
203 3300025903 Ga0207680_10002712 Ga0207680_100027128 287
204 3300025907 Ga0207645_10190223 Ga0207645_101902231 287
205 3300025908 Ga0207643_10271995 Ga0207643_102719952 287
206 3300025920 Ga0207649_10168442 Ga0207649_101684422 287
207 3300025923 Ga0207681_10023385 Ga0207681_100233852 287
208 3300025925 Ga0207650_10123326 Ga0207650_101233262 287
209 3300025931 Ga0207644_10001695 Ga0207644_100016952 287
210 3300025931 Ga0207644_10087428 Ga0207644_100874282 287
211 3300025933 Ga0207706_10049062 Ga0207706_100490623 287
212 3300025933 Ga0207706_10058965 Ga0207706_100589652 287
213 3300025937 Ga0207669_10004075 Ga0207669_100040754 287
214 3300025937 Ga0207669_10033374 Ga0207669_100333742 287
215 3300025938 Ga0207704_10025320 Ga0207704_100253202 287
216 3300025940 Ga0207691_10002117 Ga0207691_1000211717 287
217 3300025940 Ga0207691_10056892 Ga0207691_100568922 287
218 3300025940 Ga0207691_10105695 Ga0207691_101056952 287
219 3300025942 Ga0207689_10036374 Ga0207689_100363743 287
220 3300025942 Ga0207689_10351088 Ga0207689_103510882 287
221 3300025960 Ga0207651_10005747 Ga0207651_100057475 287
222 3300025981 Ga0207640_10225876 Ga0207640_102258762 287
223 3300025986 Ga0207658_10023403 Ga0207658_100234033 287
224 3300026041 Ga0207639_10010235 Ga0207639_100102353 287
225 3300026075 Ga0207708_10029490 Ga0207708_100294903 287
226 3300026089 Ga0207648_10001677 Ga0207648_100016775 287
227 3300026089 Ga0207648_10011635 Ga0207648_100116352 287
228 3300026095 Ga0207676_10344982 Ga0207676_103449822 287
229 3300026116 Ga0207674_10023050 Ga0207674_100230504 287
230 3300026121 Ga0207683_10001175 Ga0207683_1000117519 287
231 3300026142 Ga0207698_10046901 Ga0207698_100469012 287
232 3300026142 Ga0207698_10062576 Ga0207698_100625762 287
233 3300027907 Ga0207428_10297628 Ga0207428_102976282 287
234 3300028794 Ga0307515_10063943 Ga0307515_100639434 287
235 3300031456 Ga0307513_10001531 Ga0307513_1000153111 287
236 3300031548 Ga0307408_100000939 Ga0307408_10000093919 287
237 3300031901 Ga0307406_10000738 Ga0307406_100007383 287
238 3300032002 Ga0307416_100052505 Ga0307416_1000525052 287
239 3300041459 Ga0451800_0175717 Ga0451800_0175717_229_1110 287
240 3300041512 Ga0451853_3557593 Ga0451853_3557593_92_976 287
241 3300044658 Ga0466972_0028113 Ga0466972_0028113_1676_2551 287
242 3300046520 Ga0495637_0015742 Ga0495637_0015742_2284_3189 287
243 3300046538 Ga0495609_0034785 Ga0495609_0034785_431_1336 287
244 3300049521 Ga0501298_000677 Ga0501298_000677_1399_2274 287
245 3300049759 Ga0501262_001467 Ga0501262_001467_868_1743 287
246 3300050493 nmdc:mga0k408_121639_c1 nmdc:mga0k408_121639_c1_41_916 287
247 3300050496 nmdc:mga07m45_8155_c1 nmdc:mga07m45_8155_c1_1631_2506 287
248 3300050508 nmdc:mga09592_728_c1 nmdc:mga09592_728_c1_3242_4117 287
249 3300050511 nmdc:mga08y16_237336_c1 nmdc:mga08y16_237336_c1_285_1160 287
250 3300003316 rootH1_10003890 rootH1_100038902 288
251 3300005334 Ga0068869_100049835 Ga0068869_1000498352 288
252 3300005367 Ga0070667_100237067 Ga0070667_1002370672 288
253 3300005457 Ga0070662_100030131 Ga0070662_1000301313 288
254 3300005577 Ga0068857_100338087 Ga0068857_1003380872 288
255 3300005617 Ga0068859_100633243 Ga0068859_1006332432 288
256 3300006038 Ga0075365_10086978 Ga0075365_100869782 288
257 3300006042 Ga0075368_10045075 Ga0075368_100450752 288
258 3300006048 Ga0075363_100051015 Ga0075363_1000510152 288
259 3300006048 Ga0075363_100078129 Ga0075363_1000781292 288
260 3300006177 Ga0075362_10018612 Ga0075362_100186123 288
261 3300006177 Ga0075362_10096719 Ga0075362_100967192 288
262 3300006178 Ga0075367_10027357 Ga0075367_100273573 288
263 3300006186 Ga0075369_10002113 Ga0075369_100021132 288
264 3300006186 Ga0075369_10021716 Ga0075369_100217162 288
265 3300006353 Ga0075370_10020711 Ga0075370_100207113 288
266 3300006353 Ga0075370_10075847 Ga0075370_100758472 288
267 3300006353 Ga0075370_10084653 Ga0075370_100846532 288
268 3300006931 Ga0097620_100633292 Ga0097620_1006332922 288
269 3300009036 Ga0105244_10043492 Ga0105244_100434923 288
270 3300009093 Ga0105240_10009916 Ga0105240_100099165 288
271 3300009098 Ga0105245_10303453 Ga0105245_103034532 288
272 3300009148 Ga0105243_10403569 Ga0105243_104035692 288
273 3300010375 Ga0105239_10007228 Ga0105239_100072283 288
274 3300025263 Ga0209565_1000182 Ga0209565_100018229 288
275 3300025273 Ga0209673_1000106 Ga0209673_100010645 288
276 3300025291 Ga0209675_1000058 Ga0209675_100005845 288
277 3300025913 Ga0207695_10241623 Ga0207695_102416232 288
278 3300025914 Ga0207671_10011317 Ga0207671_100113175 288
279 3300025932 Ga0207690_10198788 Ga0207690_101987881 288
280 3300025933 Ga0207706_10005300 Ga0207706_100053003 288
281 3300025942 Ga0207689_10064467 Ga0207689_100644672 288
282 3300025986 Ga0207658_10586484 Ga0207658_105864841 288
283 3300026067 Ga0207678_10024716 Ga0207678_100247164 288
284 3300026116 Ga0207674_10064216 Ga0207674_100642162 288
285 3300026142 Ga0207698_10275886 Ga0207698_102758861 288
286 3300028794 Ga0307515_10021154 Ga0307515_100211544 288
287 3300028794 Ga0307515_10029411 Ga0307515_100294112 288
288 3300030522 Ga0307512_10063559 Ga0307512_100635592 288
289 3300031456 Ga0307513_10058728 Ga0307513_100587283 288
290 3300031730 Ga0307516_10025853 Ga0307516_100258532 288
291 3300032002 Ga0307416_100691522 Ga0307416_1006915222 288
292 3300033179 Ga0307507_10104515 Ga0307507_101045152 288
293 3300046460 Ga0495638_0069462 Ga0495638_0069462_345_1217 288
294 3300046506 Ga0495583_0097412 Ga0495583_0097412_70_957 288
295 3300046512 Ga0495610_0052598 Ga0495610_0052598_103_975 288
296 3300046513 Ga0495616_0000220 Ga0495616_0000220_21195_22067 288
297 3300046515 Ga0495620_0021944 Ga0495620_0021944_260_1132 288
298 3300046518 Ga0495631_0000512 Ga0495631_0000512_22768_23640 288
299 3300046519 Ga0495632_0023011 Ga0495632_0023011_2347_3234 288
300 3300046530 Ga0495654_0029878 Ga0495654_0029878_1384_2256 288
301 3300047443 Ga0495687_021154 Ga0495687_021154_501_1388 288
302 3300047443 Ga0495687_044313 Ga0495687_044313_770_1657 288
303 3300047673 Ga0495593_0042628 Ga0495593_0042628_541_1422 288
304 3300048926 Ga0496123_0032119 Ga0496123_0032119_743_1615 288
305 3300048929 Ga0496126_0103587 Ga0496126_0103587_174_1046 288
306 3300049759 Ga0501262_000340 Ga0501262_000340_3343_4257 288
307 3300050489 nmdc:mga03683_25055_c1 nmdc:mga03683_25055_c1_1399_2286 288
308 3300050490 nmdc:mga03n38_40105_c1 nmdc:mga03n38_40105_c1_862_1749 288
309 3300050492 nmdc:mga0yw44_129643_c1 nmdc:mga0yw44_129643_c1_120_1007 288
310 3300050493 nmdc:mga0k408_52679_c1 nmdc:mga0k408_52679_c1_1061_1948 288
311 3300050494 nmdc:mga06z11_52835_c1 nmdc:mga06z11_52835_c1_13_900 288
312 3300050496 nmdc:mga07m45_16151_c1 nmdc:mga07m45_16151_c1_555_1442 288
313 3300050496 nmdc:mga07m45_35054_c1 nmdc:mga07m45_35054_c1_409_1296 288
314 3300053087 Ga0500643_006387 Ga0500643_006387_201_1073 288
315 3300053110 Ga0500571_000013 Ga0500571_000013_35870_36751 288
316 3300053120 Ga0500597_069739 Ga0500597_069739_381_1262 288
317 3300053128 Ga0500626_032153 Ga0500626_032153_932_1813 288
318 3300053133 Ga0500655_005312 Ga0500655_005312_982_1854 288
319 3300053134 Ga0500658_0000332 Ga0500658_0000332_18834_19706 288
320 3300053134 Ga0500658_0006167 Ga0500658_0006167_2150_3037 288
321 3300053138 Ga0500564_101518 Ga0500564_101518_282_1163 288
322 3300053139 Ga0500568_0000409 Ga0500568_0000409_5643_6515 288
323 3300053139 Ga0500568_0025138 Ga0500568_0025138_1160_2047 288
324 3300053141 Ga0500574_054337 Ga0500574_054337_117_989 288
325 3300053153 Ga0500616_0011574 Ga0500616_0011574_387_1259 288
326 3300053161 Ga0500634_0109903 Ga0500634_0109903_187_1059 288
327 3300053162 Ga0500638_103784 Ga0500638_103784_170_1051 288
328 3300030522 Ga0307512_10188126 Ga0307512_101881262 289
329 3300030742 Ga0316183_1111195 Ga0316183_11111952 289
330 3300031911 Ga0307412_10454017 Ga0307412_104540172 289
331 3300032005 Ga0307411_10000452 Ga0307411_100004525 289
332 3300037471 Ga0395905_0133536 Ga0395905_0133536_1209_2084 289
333 3300046453 Ga0495627_011304 Ga0495627_011304_957_1865 289
334 3300046515 Ga0495620_0003900 Ga0495620_0003900_5406_6314 289
335 3300046616 Ga0495668_0167650 Ga0495668_0167650_261_1169 289
336 3300050493 nmdc:mga0k408_6824_c1 nmdc:mga0k408_6824_c1_3369_4259 289
337 3300050496 nmdc:mga07m45_10356_c1 nmdc:mga07m45_10356_c1_3078_3968 289
338 3300053093 Ga0500651_0000123 Ga0500651_0000123_7657_8565 289
339 3300053117 Ga0500593_001517 Ga0500593_001517_4008_4916 289
340 3300053134 Ga0500658_0016790 Ga0500658_0016790_534_1442 289
341 3300053158 Ga0500627_0001945 Ga0500627_0001945_2122_3030 289
342 3300005335 Ga0070666_10146902 Ga0070666_101469022 290
343 3300005356 Ga0070674_100198113 Ga0070674_1001981132 290
344 3300006042 Ga0075368_10031736 Ga0075368_100317362 290
345 3300006195 Ga0075366_10021865 Ga0075366_100218652 290
346 3300006353 Ga0075370_10170927 Ga0075370_101709271 290
347 3300009148 Ga0105243_10028283 Ga0105243_100282833 290
348 3300025899 Ga0207642_10045253 Ga0207642_100452532 290
349 3300025907 Ga0207645_10250490 Ga0207645_102504902 290
350 3300025935 Ga0207709_10034199 Ga0207709_100341992 290
351 3300026089 Ga0207648_10171025 Ga0207648_101710252 290
352 3300027866 Ga0209813_10024316 Ga0209813_100243162 290
353 3300050496 nmdc:mga07m45_24957_c1 nmdc:mga07m45_24957_c1_1663_2562 290
354 3300005456 Ga0070678_100262652 Ga0070678_1002626522 291
355 3300028794 Ga0307515_10084863 Ga0307515_100848634 292
356 iso_pu_bacteria 2945909444 2945915872 293
357 iso_pu_bacteria 2643221628 2644158807 294
358 iso_pu_bacteria 2643221658 2644326449 294
359 iso_pu_bacteria 2842677519 2842678387 294
360 iso_pu_bacteria 2885192300 2885197075 294
361 iso_pu_bacteria 2885198086 2885202426 294
362 iso_pu_bacteria 2885211737 2885216079 294
363 iso_pu_bacteria 2904449895 2904453704 294
364 iso_pu_bacteria 2904456579 2904458989 294
365 iso_pu_bacteria 2929520902 2929524244 294
366 iso_pu_bacteria 2945945610 2945948507 294
367 iso_pu_bacteria 2599185214 2599622274 295
368 iso_pu_bacteria 2599185226 2599676983 295
369 iso_pu_bacteria 2599185227 2599680319 295
370 iso_pu_bacteria 2599185229 2599692335 295
371 iso_pu_bacteria 2818991446 2819598244 295
372 iso_pu_bacteria 2831265667 2831269718 295
373 iso_pu_bacteria 2838054893 2838055264 295
374 iso_pu_bacteria 2899924645 2899926356 295
375 iso_pu_bacteria 2928037797 2928044382 295
376 iso_pu_bacteria 2928044640 2928051223 295
377 iso_pu_bacteria 2928051484 2928058471 295
378 iso_pu_bacteria 2928064002 2928069116 295
379 iso_pu_bacteria 2928070936 2928074173 295
380 iso_pu_bacteria 2945984333 2945988694 295
381 iso_pu_bacteria 2513020051 2513226795 296
382 iso_pu_bacteria 2643221672 2644397049 296
383 3300017792 Ga0163161_10000165 Ga0163161_1000016546 297
384 3300025273 Ga0209673_1001604 Ga0209673_100160418 297
385 3300031901 Ga0307406_10119347 Ga0307406_101193471 297
386 3300031911 Ga0307412_10042638 Ga0307412_100426382 297
387 3300003187 JGI25151J46595_10001430 JGI25151J46595_100014308 298
388 3300003578 Ga0006562J51391_1024902 Ga0006562J51391_10249021 298
389 3300003578 Ga0006562J51391_1024904 Ga0006562J51391_10249042 298
390 3300003781 Ga0055536_1006382 Ga0055536_10063822 298
391 3300003791 Ga0055530_10007070 Ga0055530_100070703 298
392 3300003792 Ga0055540_1001328 Ga0055540_10013282 298
393 3300003792 Ga0055540_1031353 Ga0055540_10313532 298
394 3300003794 Ga0055531_10001703 Ga0055531_100017033 298
395 3300005288 Ga0065714_10083208 Ga0065714_100832082 298
396 3300005548 Ga0070665_100109145 Ga0070665_1001091452 298
397 3300006051 Ga0075364_10031671 Ga0075364_100316712 298
398 3300006058 Ga0075432_10028524 Ga0075432_100285242 298
399 3300006177 Ga0075362_10031289 Ga0075362_100312892 298
400 3300006353 Ga0075370_10166314 Ga0075370_101663142 298
401 3300006948 Ga0099826_10000118 Ga0099826_1000011829 298
402 3300006948 Ga0099826_10119078 Ga0099826_101190782 298
403 3300009093 Ga0105240_10129440 Ga0105240_101294402 298
404 3300009551 Ga0105238_10548520 Ga0105238_105485202 298
405 3300010375 Ga0105239_10192067 Ga0105239_101920672 298
406 3300013100 Ga0157373_10052934 Ga0157373_100529343 298
407 3300013104 Ga0157370_10021814 Ga0157370_100218143 298
408 3300013105 Ga0157369_10001241 Ga0157369_1000124120 298
409 3300014497 Ga0182008_10002418 Ga0182008_1000241812 298
410 3300015262 Ga0182007_10000193 Ga0182007_1000019312 298
411 3300017792 Ga0163161_10044860 Ga0163161_100448602 298
412 3300025258 Ga0209129_1002422 Ga0209129_10024223 298
413 3300025292 Ga0209676_1000912 Ga0209676_100091220 298
414 3300025294 Ga0209025_1000174 Ga0209025_100017428 298
415 3300025298 Ga0209050_1000699 Ga0209050_100069915 298
416 3300025303 Ga0209051_1000126 Ga0209051_100012697 298
417 3300025303 Ga0209051_1000355 Ga0209051_100035544 298
418 3300025304 Ga0209257_1000214 Ga0209257_100021483 298
419 3300025913 Ga0207695_10143937 Ga0207695_101439372 298
420 3300025914 Ga0207671_10069790 Ga0207671_100697902 298
421 3300025937 Ga0207669_10072471 Ga0207669_100724712 298
422 3300026089 Ga0207648_10406261 Ga0207648_104062612 298
423 3300026142 Ga0207698_10157878 Ga0207698_101578782 298
424 3300027666 Ga0209282_1000893 Ga0209282_100089312 298
425 3300030733 Ga0314311_1036622 Ga0314311_10366222 298
426 3300031731 Ga0307405_10032061 Ga0307405_100320612 298
427 3300031901 Ga0307406_10006122 Ga0307406_100061224 298
428 3300032005 Ga0307411_10012742 Ga0307411_100127423 298
429 3300032005 Ga0307411_10097028 Ga0307411_100970281 298
430 3300041404 Ga0439436_0017664 Ga0439436_0017664_274_1179 298
431 3300041407 Ga0439447_010115 Ga0439447_010115_1816_2721 298
432 3300041410 Ga0439461_0006998 Ga0439461_0006998_374_1285 298
433 3300041411 Ga0439466_0004713 Ga0439466_0004713_4074_4985 298
434 3300041411 Ga0439466_0048340 Ga0439466_0048340_373_1278 298
435 3300041413 Ga0439465_0000713 Ga0439465_0000713_2131_3036 298
436 3300041997 Ga0439431_0001073 Ga0439431_0001073_1986_2891 298
437 3300041997 Ga0439431_0008323 Ga0439431_0008323_255_1166 298
438 3300041999 Ga0439433_0001657 Ga0439433_0001657_1706_2611 298
439 3300042002 Ga0439442_004850 Ga0439442_004850_799_1704 298
440 3300042002 Ga0439442_016052 Ga0439442_016052_290_1201 298
441 3300042004 Ga0439445_0001873 Ga0439445_0001873_2613_3524 298
442 3300042004 Ga0439445_0005692 Ga0439445_0005692_956_1861 298
443 3300042006 Ga0439432_018189 Ga0439432_018189_460_1365 298
444 3300042007 Ga0439449_0009465 Ga0439449_0009465_2321_3226 298
445 3300042007 Ga0439449_0030927 Ga0439449_0030927_318_1223 298
446 3300042010 Ga0439452_003220 Ga0439452_003220_3643_4554 298
447 3300042010 Ga0439452_006084 Ga0439452_006084_1118_2023 298
448 3300042014 Ga0439457_003147 Ga0439457_003147_2452_3360 298
449 3300042014 Ga0439457_003203 Ga0439457_003203_2055_2960 298
450 3300042015 Ga0439462_0003329 Ga0439462_0003329_2129_3034 298
451 3300042015 Ga0439462_0010897 Ga0439462_0010897_237_1148 298
452 3300042125 Ga0450923_000920 Ga0450923_000920_69_977 298
453 3300042128 Ga0450897_000032 Ga0450897_000032_1201_2112 298
454 3300042132 Ga0450895_002968 Ga0450895_002968_123_1034 298
455 3300042134 Ga0450898_000702 Ga0450898_000702_982_1893 298
456 3300042135 Ga0450899_000336 Ga0450899_000336_1046_1957 298
457 3300042145 Ga0450906_001370 Ga0450906_001370_314_1225 298
458 3300042146 Ga0450907_007476 Ga0450907_007476_215_1126 298
459 3300042147 Ga0450910_001490 Ga0450910_001490_659_1570 298
460 3300042156 Ga0439446_0001731 Ga0439446_0001731_3177_4082 298
461 3300042184 Ga0450908_000605 Ga0450908_000605_4626_5537 298
462 3300042435 Ga0439434_0008678 Ga0439434_0008678_892_1797 298
463 3300046674 Ga0495588_0019458 Ga0495588_0019458_1962_2867 298
464 3300048905 Ga0496102_0032427 Ga0496102_0032427_1302_2222 298
465 3300048908 Ga0496105_0089725 Ga0496105_0089725_1551_2471 298
466 3300048921 Ga0496118_0189605 Ga0496118_0189605_109_1014 298
467 3300048927 Ga0496124_0006696 Ga0496124_0006696_484_1389 298
468 3300049679 Ga0501249_002002 Ga0501249_002002_2888_3793 298
469 3300049705 Ga0501225_0004839 Ga0501225_0004839_2913_3818 298
470 3300050489 nmdc:mga03683_264_c1 nmdc:mga03683_264_c1_589_1494 298
471 3300050496 nmdc:mga07m45_39174_c1 nmdc:mga07m45_39174_c1_80_985 298
472 3300053121 Ga0500607_000211 Ga0500607_000211_50536_51447 298
473 3300001989 JGI24739J22299_10041869 JGI24739J22299_100418692 299
474 3300003316 rootH1_10004212 rootH1_100042122 299
475 3300003323 rootH1_10031315 rootH1_100313153 299
476 3300003323 rootH1_10031316 rootH1_100313162 299
477 3300003761 Ga0055535_1000136 Ga0055535_100013616 299
478 3300003762 Ga0055542_1000095 Ga0055542_100009557 299
479 3300003773 Ga0055537_1006203 Ga0055537_10062033 299
480 3300003781 Ga0055536_1005765 Ga0055536_10057653 299
481 3300003784 Ga0055534_1005510 Ga0055534_10055103 299
482 3300003790 Ga0055528_1019892 Ga0055528_10198922 299
483 3300003791 Ga0055530_10000807 Ga0055530_100008073 299
484 3300003791 Ga0055530_10001091 Ga0055530_1000109112 299
485 3300013102 Ga0157371_10086328 Ga0157371_100863282 299
486 3300013307 Ga0157372_10353694 Ga0157372_103536942 299
487 3300025208 Ga0209436_108738 Ga0209436_1087382 299
488 3300025228 Ga0209672_100385 Ga0209672_10038520 299
489 3300025229 Ga0209147_101099 Ga0209147_1010993 299
490 3300025242 Ga0209258_100069 Ga0209258_10006939 299
491 3300025245 Ga0207425_1000236 Ga0207425_100023620 299
492 3300025254 Ga0209148_1000076 Ga0209148_1000076217 299
493 3300025258 Ga0209129_1000055 Ga0209129_100005559 299
494 3300025263 Ga0209565_1000275 Ga0209565_100027520 299
495 3300025263 Ga0209565_1006859 Ga0209565_10068593 299
496 3300025273 Ga0209673_1000415 Ga0209673_100041527 299
497 3300025273 Ga0209673_1013932 Ga0209673_10139323 299
498 3300025292 Ga0209676_1000028 Ga0209676_1000028444 299
499 3300025292 Ga0209676_1000216 Ga0209676_100021675 299
500 3300025294 Ga0209025_1003933 Ga0209025_10039337 299
501 3300025295 Ga0209564_1000220 Ga0209564_100022076 299
502 3300025295 Ga0209564_1000442 Ga0209564_100044232 299
503 3300025297 Ga0209758_1000042 Ga0209758_1000042301 299
504 3300025298 Ga0209050_1000072 Ga0209050_1000072200 299
505 3300025298 Ga0209050_1000133 Ga0209050_100013366 299
506 3300025299 Ga0209256_1000117 Ga0209256_100011776 299
507 3300025299 Ga0209256_1000148 Ga0209256_100014899 299
508 3300025302 Ga0207426_1000055 Ga0207426_100005530 299
509 3300025302 Ga0207426_1000166 Ga0207426_100016676 299
510 3300025303 Ga0209051_1000015 Ga0209051_1000015373 299
511 3300025303 Ga0209051_1000056 Ga0209051_100005627 299
512 3300025304 Ga0209257_1000037 Ga0209257_1000037372 299
513 3300025321 Ga0207656_10005634 Ga0207656_100056341 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

130

310

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7052 87 284
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.7028 86 287
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.652 87 284
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.638 86 291
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6149 86 291
ID Description Score Start End Superfamily
af_Q2FZR6_145_349_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7806 87 289 1.10.3720.10
af_Q2FZQ8_74_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7714 86 289 1.10.3720.10
af_Q2FZR6_145_349_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7703 87 289 1.10.3720.10
af_P33915_131_335_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7659 87 291 1.10.3720.10
af_P0AGH5_85_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7659 86 292 1.10.3720.10
ID Description Score Start End GO Terms
AF-W1WJM0-F1-model_v4 Putative D,D-dipeptide transport system permease protein ddpC 0.9573 95 225 GO:0005886
GO:0071916
AF-W1WJM0-F1-model_v4 Putative D,D-dipeptide transport system permease protein ddpC 0.9233 95 225 GO:0005886
GO:0071916
AF-A0A529N9P4-F1-model_v4 ABC transporter permease 0.8877 78 228 GO:0005886
GO:0055085
AF-X0TP74-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8829 83 242 GO:0005886
GO:0055085
AF-X0TP74-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8628 83 242 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
67.33 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map