F457561

General Info

Members Datasets Scaffolds Average Seq Length
513 279 490 639

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10001363|Ga0105249_100013633
Length 686
Sequence MGYLPHVSKLCRGELFSRLFVMESLATTGYKKLNFTPQKMNMQITPGPLLNTINSPADLKKLSRENLHQLCDELRQYIIDVVSVHGGHFGASLGVVELTVALHYIYNTPYDQLVWDVGHQAYGHKILTGRRDNFPTNRKYKGLSGFPKRSESEYDTFGVGHSSTSISAALGMAMAAQYKGEKNRKSVAIIGDGAMTAGLAFEAMNHAGVADADLLIILNDNCMSIDPNVGALKEYLTDITTSPTYNKFRDELWKLMGKLPVGKKFTRDMASKMEAGLKGMVSKSSNLFEALNLRYFGPIDGHNITKLVDTLKDLREISGPKLLHIVTVKGKGYSLAEKDQTKWHAPGLFDKVTGEIQKKKFDLPQPPKYQDVFGHTIIELAEQNEKIFGITPAMPSGSSLKYMMEKMPHRAFDVGIAEQHAVTLSAGMATQGMKVFCNIYSSFMQRAYDQVVHDVAIQNLPVIFCLDRAGLVGDDGPTHHGCYDIAYMRCVPNMIVSAPMNESELRNLMYTAQLDSTNHPFVIRYPRGEGVMPEWKTEMKEIKIGTGRKLRDGNDIAILSFGHPGNFAAAAIRDLKNDGLNPAHYDMRFAKPLDEELLHEIFNKFDKIITVEDGTVKGGFGSAVLEFMNEQNYKAEMKILGIPDRLVEHGTPKELHKECGYDAQAIKEAVLEMMRGKVSINNSVLG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2738541284 Pedobacter sp. YR016 Isolate Unclassified
4 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
5 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
6 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
7 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
8 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
9 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
10 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
11 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
12 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
13 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
14 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
15 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
16 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
17 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
18 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
19 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
20 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
21 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
22 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
108 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
109 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
110 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
169 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
176 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
177 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
178 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
179 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
195 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
196 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
197 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
198 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
233 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
247 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
248 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
249 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
250 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
251 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
252 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
253 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
254 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
255 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
256 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
257 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
258 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
259 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
270 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
271 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
277 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.52
Metatranscriptomes 0
Isolates 4.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.02
Nodule 1.36
Rhizoplane 0.78
Rhizosphere 81.87
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1482467 2162886007 Bacteria 8665
2 SwRhRL2b_contig_3612275 2162886007 Bacteria 3601
3 JGI24740J21852_10002493 3300001979 Bacteria 8324
4 JGI24739J22299_10000408 3300001989 Bacteria 14855
5 JGI25154J39366_1000006 3300002738 Bacteria 336396
6 JGI25153J46596_10004282 3300003215 Bacteria 7716
7 rootH2_10015620 3300003320 Bacteria 27832
8 rootL2_10014283 3300003322 Bacteria 15569
9 JGI25160J50197_1001309 3300003354 Bacteria 12570
10 Ga0055535_1001754 3300003761 Bacteria 9677
11 Ga0055536_1005887 3300003781 Bacteria 5877
12 Ga0055530_10003528 3300003791 Bacteria 8825
13 Ga0055531_10000005 3300003794 Bacteria 242179
14 Ga0065165_1000042 3300005262 Bacteria 203874
15 Ga0065165_1000302 3300005262 Bacteria 82711
16 Ga0065165_1005428 3300005262 Bacteria 7175
17 Ga0065714_10009714 3300005288 Bacteria 6617
18 Ga0065704_10000373 3300005289 Bacteria 25770
19 Ga0065704_10000425 3300005289 Bacteria 76756
20 Ga0065704_10074597 3300005289 Bacteria 6146
21 Ga0065712_10068022 3300005290 Bacteria 16959
22 Ga0070658_10000515 3300005327 Bacteria 33566
23 Ga0070676_10000341 3300005328 Bacteria 21305
24 Ga0070676_10019525 3300005328 Bacteria 3772
25 Ga0070676_10027075 3300005328 Bacteria 3249
26 Ga0070683_100001831 3300005329 Bacteria 16578
27 Ga0070683_100015612 3300005329 Bacteria 6675
28 Ga0070683_100155313 3300005329 Bacteria 2170
29 Ga0070677_10004350 3300005333 Bacteria 4615
30 Ga0068869_100011207 3300005334 Bacteria 5874
31 Ga0068869_100032646 3300005334 Bacteria 3670
32 Ga0070666_10000172 3300005335 Bacteria 44437
33 Ga0070666_10000301 3300005335 Bacteria 31985
34 Ga0070666_10016404 3300005335 Bacteria 4739
35 Ga0070666_10018149 3300005335 Bacteria 4519
36 Ga0070680_100001715 3300005336 Bacteria 16104
37 Ga0070682_100000259 3300005337 Bacteria 38232
38 Ga0070682_100004034 3300005337 Bacteria 8160
39 Ga0068868_100001522 3300005338 Bacteria 15890
40 Ga0068868_100007141 3300005338 Bacteria 7938
41 Ga0070689_100045900 3300005340 Bacteria 3366
42 Ga0070691_10000875 3300005341 Bacteria 12204
43 Ga0070661_100000522 3300005344 Bacteria 29477
44 Ga0070661_100009090 3300005344 Bacteria 6872
45 Ga0070668_100000169 3300005347 Bacteria 41705
46 Ga0070669_100013473 3300005353 Bacteria 5813
47 Ga0070675_100022678 3300005354 Bacteria 5016
48 Ga0070671_100008404 3300005355 Bacteria 8274
49 Ga0070671_100015305 3300005355 Bacteria 6195
50 Ga0070671_100097828 3300005355 Bacteria 2461
51 Ga0070674_100004573 3300005356 Bacteria 7901
52 Ga0070673_100000813 3300005364 Bacteria 17473
53 Ga0070673_100012277 3300005364 Bacteria 5876
54 Ga0070659_100003003 3300005366 Bacteria 12009
55 Ga0070659_100008285 3300005366 Bacteria 7589
56 Ga0070667_100000553 3300005367 Bacteria 37217
57 Ga0070667_100003932 3300005367 Bacteria 12623
58 Ga0070667_100057985 3300005367 Bacteria 3273
59 Ga0070662_100002884 3300005457 Bacteria 10668
60 Ga0070662_100049363 3300005457 Bacteria 3035
61 Ga0070662_100052922 3300005457 Bacteria 2938
62 Ga0070681_10028230 3300005458 Bacteria 5641
63 Ga0070681_10057386 3300005458 Bacteria 3873
64 Ga0068867_100001171 3300005459 Bacteria 17945
65 Ga0070698_100004398 3300005471 Bacteria 15482
66 Ga0070679_100015506 3300005530 Bacteria 7323
67 Ga0070684_100001645 3300005535 Bacteria 16198
68 Ga0070684_100036540 3300005535 Bacteria 4209
69 Ga0068853_100000272 3300005539 Bacteria 36612
70 Ga0068853_100004671 3300005539 Bacteria 10620
71 Ga0068853_100013077 3300005539 Bacteria 6770
72 Ga0068853_100058737 3300005539 Bacteria 3321
73 Ga0070672_100000061 3300005543 Bacteria 49701
74 Ga0070665_100000002 3300005548 Bacteria 849037
75 Ga0070665_100000612 3300005548 Bacteria 48973
76 Ga0070665_100001635 3300005548 Bacteria 25828
77 Ga0068855_100010495 3300005563 Bacteria 11174
78 Ga0068855_100045651 3300005563 Bacteria 5182
79 Ga0070664_100000325 3300005564 Bacteria 34677
80 Ga0070664_100009965 3300005564 Bacteria 7703
81 Ga0070664_100039019 3300005564 Bacteria 4000
82 Ga0068857_100000003 3300005577 Bacteria 174630
83 Ga0068857_100004404 3300005577 Bacteria 11902
84 Ga0068857_100023055 3300005577 Bacteria 5475
85 Ga0068852_100000787 3300005616 Bacteria 20834
86 Ga0068852_100022230 3300005616 Bacteria 5083
87 Ga0068859_100000006 3300005617 Bacteria 421509
88 Ga0068859_100006881 3300005617 Bacteria 11542
89 Ga0068859_100014449 3300005617 Bacteria 7924
90 Ga0068859_100014669 3300005617 Bacteria 7875
91 Ga0068859_100018620 3300005617 Bacteria 6980
92 Ga0068859_100056937 3300005617 Bacteria 3937
93 Ga0068864_100004846 3300005618 Bacteria 11021
94 Ga0068864_100014270 3300005618 Bacteria 6597
95 Ga0068864_100025401 3300005618 Bacteria 4988
96 Ga0068864_100030131 3300005618 Bacteria 4599
97 Ga0068863_100001273 3300005841 Bacteria 25131
98 Ga0068863_100052504 3300005841 Bacteria 3863
99 Ga0068858_100000930 3300005842 Bacteria 30365
100 Ga0068858_100004200 3300005842 Bacteria 14178
101 Ga0068860_100000003 3300005843 Bacteria 575741
102 Ga0068860_100001345 3300005843 Bacteria 26726
103 Ga0068860_100007018 3300005843 Bacteria 11278
104 Ga0068860_100009699 3300005843 Bacteria 9564
105 Ga0068860_100028647 3300005843 Bacteria 5361
106 Ga0068860_100162265 3300005843 Bacteria 2155
107 Ga0097621_100000531 3300006237 Bacteria 26760
108 Ga0097621_100000821 3300006237 Bacteria 21965
109 Ga0097621_100004954 3300006237 Bacteria 9336
110 Ga0068871_100000042 3300006358 Bacteria 67951
111 Ga0068871_100016561 3300006358 Bacteria 5558
112 Ga0068871_100048895 3300006358 Bacteria 3416
113 Ga0075428_100011475 3300006844 Bacteria 9856
114 Ga0075428_100062058 3300006844 Bacteria 4092
115 Ga0068865_100003524 3300006881 Bacteria 9385
116 Ga0097620_100000006 3300006931 Bacteria 421509
117 Ga0097620_100006881 3300006931 Bacteria 11542
118 Ga0097620_100014449 3300006931 Bacteria 7924
119 Ga0097620_100014669 3300006931 Bacteria 7875
120 Ga0097620_100018620 3300006931 Bacteria 6980
121 Ga0097620_100056934 3300006931 Bacteria 3937
122 Ga0079104_1000166 3300006946 Bacteria 94027
123 Ga0079104_1005234 3300006946 Bacteria 5238
124 Ga0079104_1006425 3300006946 Bacteria 4448
125 Ga0079104_1007032 3300006946 Bacteria 4143
126 Ga0105251_10013195 3300009011 Bacteria 4632
127 Ga0105244_10000105 3300009036 Bacteria 86528
128 Ga0105240_10000367 3300009093 Bacteria 84666
129 Ga0105240_10050390 3300009093 Bacteria 5250
130 Ga0105240_10067456 3300009093 Bacteria 4434
131 Ga0105240_10087392 3300009093 Bacteria 3818
132 Ga0105241_10000213 3300009174 Bacteria 43667
133 Ga0105241_10009515 3300009174 Bacteria 7139
134 Ga0105241_10037679 3300009174 Bacteria 3643
135 Ga0105242_10071688 3300009176 Bacteria 2876
136 Ga0105248_10014203 3300009177 Bacteria 8767
137 Ga0105248_10016765 3300009177 Bacteria 8067
138 Ga0105237_10002608 3300009545 Bacteria 22196
139 Ga0105237_10013195 3300009545 Bacteria 8670
140 Ga0105237_10014498 3300009545 Bacteria 8238
141 Ga0105238_10001981 3300009551 Bacteria 20624
142 Ga0105249_10001226 3300009553 Bacteria 22548
143 Ga0105249_10001363 3300009553 Bacteria 21359
144 Ga0105249_10005776 3300009553 Bacteria 10700
145 Ga0105249_10008479 3300009553 Bacteria 8957
146 Ga0105249_10058817 3300009553 Bacteria 3524
147 Ga0105239_10093265 3300010375 Bacteria 3324
148 Ga0157373_10000916 3300013100 Bacteria 22855
149 Ga0157373_10016557 3300013100 Bacteria 5376
150 Ga0157373_10061402 3300013100 Bacteria 2662
151 Ga0157371_10007402 3300013102 Bacteria 8894
152 Ga0157371_10009469 3300013102 Bacteria 7664
153 Ga0157371_10013997 3300013102 Bacteria 6072
154 Ga0157371_10024734 3300013102 Bacteria 4381
155 Ga0157371_10025845 3300013102 Bacteria 4273
156 Ga0157370_10009908 3300013104 Bacteria 10095
157 Ga0157370_10027824 3300013104 Bacteria 5571
158 Ga0157374_10000013 3300013296 Bacteria 461240
159 Ga0157374_10002119 3300013296 Bacteria 16701
160 Ga0157374_10005427 3300013296 Bacteria 10712
161 Ga0157374_10009778 3300013296 Bacteria 8237
162 Ga0157374_10011557 3300013296 Bacteria 7653
163 Ga0157374_10022337 3300013296 Bacteria 5643
164 Ga0157378_10000859 3300013297 Bacteria 28140
165 Ga0157378_10006615 3300013297 Bacteria 10125
166 Ga0163162_10000244 3300013306 Bacteria 49260
167 Ga0163162_10000752 3300013306 Bacteria 30172
168 Ga0163162_10000952 3300013306 Bacteria 26875
169 Ga0163162_10001071 3300013306 Bacteria 25453
170 Ga0163162_10001214 3300013306 Bacteria 24073
171 Ga0163162_10001265 3300013306 Bacteria 23633
172 Ga0163162_10001632 3300013306 Bacteria 20996
173 Ga0163162_10003537 3300013306 Bacteria 14946
174 Ga0163162_10212902 3300013306 Bacteria 2063
175 Ga0157372_10035531 3300013307 Bacteria 5487
176 Ga0157372_10127472 3300013307 Bacteria 2926
177 Ga0157375_10000098 3300013308 Bacteria 88130
178 Ga0157375_10001055 3300013308 Bacteria 23768
179 Ga0157375_10017905 3300013308 Bacteria 6409
180 Ga0157375_10028440 3300013308 Bacteria 5239
181 Ga0157375_10051617 3300013308 Bacteria 4039
182 Ga0163163_10000272 3300014325 Bacteria 51699
183 Ga0163163_10000888 3300014325 Bacteria 25452
184 Ga0163163_10001753 3300014325 Bacteria 18282
185 Ga0163163_10013960 3300014325 Bacteria 7371
186 Ga0163163_10113661 3300014325 Bacteria 2738
187 Ga0157380_10000602 3300014326 Bacteria 22163
188 Ga0157380_10058138 3300014326 Bacteria 3082
189 Ga0182008_10000022 3300014497 Bacteria 207052
190 Ga0182008_10008974 3300014497 Bacteria 5418
191 Ga0182008_10046774 3300014497 Bacteria 2150
192 Ga0182008_10047019 3300014497 Bacteria 2144
193 Ga0157379_10000103 3300014968 Bacteria 58102
194 Ga0157379_10074646 3300014968 Bacteria 3036
195 Ga0157379_10115632 3300014968 Bacteria 2412
196 Ga0157376_10010045 3300014969 Bacteria 6909
197 Ga0157376_10017770 3300014969 Bacteria 5434
198 Ga0157376_10020364 3300014969 Bacteria 5130
199 Ga0157376_10066099 3300014969 Bacteria 3056
200 Ga0182006_1005184 3300015261 Bacteria 6250
201 Ga0182005_1000017 3300015265 Bacteria 331828
202 Ga0183366_1001 3300015679 Bacteria 2743932
203 Ga0183370_1001 3300015680 Bacteria 2743932
204 Ga0183369_1001 3300015685 Bacteria 2743932
205 Ga0183368_1001 3300015687 Bacteria 2743932
206 Ga0163161_10003083 3300017792 Bacteria 11762
207 Ga0163161_10003213 3300017792 Bacteria 11494
208 Ga0163161_10032349 3300017792 Bacteria 3734
209 Ga0209436_101519 3300025208 Bacteria 7956
210 Ga0209258_100029 3300025242 Bacteria 490648
211 Ga0209646_1000031 3300025246 Bacteria 381260
212 Ga0209026_1000019 3300025250 Bacteria 381260
213 Ga0209148_1000089 3300025254 Bacteria 253548
214 Ga0209673_1000113 3300025273 Bacteria 179012
215 Ga0209130_1002000 3300025284 Bacteria 11129
216 Ga0209676_1004327 3300025292 Bacteria 7976
217 Ga0209758_1004657 3300025297 Bacteria 11228
218 Ga0209758_1018212 3300025297 Bacteria 3456
219 Ga0209050_1000185 3300025298 Bacteria 141889
220 Ga0207426_1000263 3300025302 Bacteria 110923
221 Ga0207426_1000513 3300025302 Bacteria 56488
222 Ga0207426_1001392 3300025302 Bacteria 20412
223 Ga0207426_1017373 3300025302 Bacteria 2560
224 Ga0209257_1000004 3300025304 Bacteria 1678347
225 Ga0209257_1000257 3300025304 Bacteria 122448
226 Ga0207655_1000087 3300025728 Bacteria 205876
227 Ga0207655_1000226 3300025728 Bacteria 94688
228 Ga0207655_1003596 3300025728 Bacteria 11459
229 Ga0207713_1000021 3300025735 Bacteria 353108
230 Ga0207682_10005836 3300025893 Bacteria 4990
231 Ga0207682_10009478 3300025893 Bacteria 3842
232 Ga0207710_10000417 3300025900 Bacteria 28186
233 Ga0207680_10000748 3300025903 Bacteria 15314
234 Ga0207680_10001345 3300025903 Bacteria 11631
235 Ga0207647_10000050 3300025904 Bacteria 88099
236 Ga0207645_10000793 3300025907 Bacteria 26435
237 Ga0207645_10007581 3300025907 Bacteria 7650
238 Ga0207705_10005062 3300025909 Bacteria 9880
239 Ga0207705_10035485 3300025909 Bacteria 3567
240 Ga0207654_10001001 3300025911 Bacteria 15487
241 Ga0207654_10008792 3300025911 Bacteria 5123
242 Ga0207707_10000160 3300025912 Bacteria 70695
243 Ga0207707_10079021 3300025912 Bacteria 2873
244 Ga0207695_10000550 3300025913 Bacteria 77346
245 Ga0207695_10002404 3300025913 Bacteria 27705
246 Ga0207695_10039740 3300025913 Bacteria 5053
247 Ga0207671_10000761 3300025914 Bacteria 40954
248 Ga0207671_10001002 3300025914 Bacteria 34718
249 Ga0207671_10003071 3300025914 Bacteria 17063
250 Ga0207671_10015636 3300025914 Bacteria 5933
251 Ga0207671_10033866 3300025914 Bacteria 3799
252 Ga0207660_10073788 3300025917 Bacteria 2488
253 Ga0207649_10001758 3300025920 Bacteria 12433
254 Ga0207652_10000406 3300025921 Bacteria 44756
255 Ga0207681_10010625 3300025923 Bacteria 5645
256 Ga0207694_10008991 3300025924 Bacteria 7542
257 Ga0207650_10064512 3300025925 Bacteria 2742
258 Ga0207659_10026799 3300025926 Bacteria 3894
259 Ga0207644_10008218 3300025931 Bacteria 6835
260 Ga0207644_10074528 3300025931 Bacteria 2491
261 Ga0207690_10005330 3300025932 Bacteria 7578
262 Ga0207690_10009623 3300025932 Bacteria 5737
263 Ga0207706_10006661 3300025933 Bacteria 10681
264 Ga0207706_10024337 3300025933 Bacteria 5428
265 Ga0207706_10036288 3300025933 Bacteria 4379
266 Ga0207706_10114797 3300025933 Bacteria 2368
267 Ga0207686_10000626 3300025934 Bacteria 21965
268 Ga0207704_10004460 3300025938 Bacteria 6400
269 Ga0207704_10051892 3300025938 Bacteria 2483
270 Ga0207691_10000154 3300025940 Bacteria 64281
271 Ga0207691_10011687 3300025940 Bacteria 8431
272 Ga0207691_10013466 3300025940 Bacteria 7827
273 Ga0207711_10026152 3300025941 Bacteria 4895
274 Ga0207689_10001148 3300025942 Bacteria 25510
275 Ga0207689_10006615 3300025942 Bacteria 10224
276 Ga0207689_10017807 3300025942 Bacteria 6003
277 Ga0207689_10029427 3300025942 Bacteria 4586
278 Ga0207661_10000680 3300025944 Bacteria 22011
279 Ga0207679_10000152 3300025945 Bacteria 56780
280 Ga0207679_10008672 3300025945 Bacteria 6482
281 Ga0207679_10026961 3300025945 Bacteria 3968
282 Ga0207667_10007145 3300025949 Bacteria 13481
283 Ga0207667_10046979 3300025949 Bacteria 4571
284 Ga0207651_10002520 3300025960 Bacteria 8743
285 Ga0207651_10037823 3300025960 Bacteria 3165
286 Ga0207712_10001184 3300025961 Bacteria 18048
287 Ga0207712_10001895 3300025961 Bacteria 13750
288 Ga0207712_10002022 3300025961 Bacteria 13312
289 Ga0207712_10013652 3300025961 Bacteria 5208
290 Ga0207712_10032837 3300025961 Bacteria 3505
291 Ga0207668_10011546 3300025972 Bacteria 5372
292 Ga0207658_10001366 3300025986 Bacteria 19064
293 Ga0207658_10018309 3300025986 Bacteria 4836
294 Ga0207658_10113251 3300025986 Bacteria 2149
295 Ga0207677_10000862 3300026023 Bacteria 17343
296 Ga0207677_10072504 3300026023 Bacteria 2434
297 Ga0207703_10000883 3300026035 Bacteria 29482
298 Ga0207703_10031664 3300026035 Bacteria 4184
299 Ga0207639_10001017 3300026041 Bacteria 19080
300 Ga0207639_10015986 3300026041 Bacteria 5300
301 Ga0207639_10077960 3300026041 Bacteria 2614
302 Ga0207641_10000159 3300026088 Bacteria 96072
303 Ga0207641_10000467 3300026088 Bacteria 45772
304 Ga0207641_10006669 3300026088 Bacteria 9691
305 Ga0207641_10020159 3300026088 Bacteria 5474
306 Ga0207641_10024328 3300026088 Bacteria 4991
307 Ga0207641_10061387 3300026088 Bacteria 3206
308 Ga0207648_10007945 3300026089 Bacteria 10346
309 Ga0207648_10012083 3300026089 Bacteria 8099
310 Ga0207648_10056701 3300026089 Bacteria 3418
311 Ga0207648_10074293 3300026089 Bacteria 2963
312 Ga0207648_10079703 3300026089 Bacteria 2857
313 Ga0207676_10001829 3300026095 Bacteria 15586
314 Ga0207676_10003634 3300026095 Bacteria 10911
315 Ga0207674_10002103 3300026116 Bacteria 25211
316 Ga0207674_10004065 3300026116 Bacteria 17727
317 Ga0207674_10012180 3300026116 Bacteria 9626
318 Ga0207674_10040174 3300026116 Bacteria 4848
319 Ga0207674_10090457 3300026116 Bacteria 3052
320 Ga0207674_10106505 3300026116 Bacteria 2781
321 Ga0207674_10112775 3300026116 Bacteria 2692
322 Ga0207675_100005907 3300026118 Bacteria 11682
323 Ga0207675_100019140 3300026118 Bacteria 6390
324 Ga0207675_100023999 3300026118 Bacteria 5669
325 Ga0207675_100027055 3300026118 Bacteria 5340
326 Ga0207683_10011591 3300026121 Bacteria 7527
327 Ga0207698_10007436 3300026142 Bacteria 6859
328 Ga0207698_10010804 3300026142 Bacteria 5890
329 Ga0207698_10066546 3300026142 Bacteria 2837
330 Ga0207698_10073167 3300026142 Bacteria 2728
331 Ga0209281_1000001 3300027111 Bacteria 1933496
332 Ga0209281_1001594 3300027111 Bacteria 12274
333 Ga0209281_1003420 3300027111 Bacteria 5260
334 Ga0209371_1000001 3300027312 Bacteria 2771503
335 Ga0209371_1005217 3300027312 Bacteria 5255
336 Ga0268266_10000022 3300028379 Bacteria 508060
337 Ga0268266_10000084 3300028379 Bacteria 201874
338 Ga0268266_10003931 3300028379 Bacteria 14446
339 Ga0268264_10000082 3300028381 Bacteria 246913
340 Ga0268264_10004522 3300028381 Bacteria 11860
341 Ga0268264_10004873 3300028381 Bacteria 11372
342 Ga0268264_10019816 3300028381 Bacteria 5496
343 Ga0268264_10021296 3300028381 Bacteria 5296
344 Ga0265318_10013047 3300028577 Bacteria 3522
345 Ga0307517_10005192 3300028786 Bacteria 19741
346 Ga0307515_10000001 3300028794 Bacteria 4259510
347 Ga0307515_10000021 3300028794 Bacteria 406008
348 Ga0307515_10011199 3300028794 Bacteria 17050
349 Ga0268256_1000001 3300030500 Bacteria 2771065
350 Ga0268256_1005087 3300030500 Bacteria 5255
351 Ga0307511_10000027 3300030521 Bacteria 109500
352 Ga0316176_1063677 3300030732 Bacteria 21616
353 Ga0316176_1065190 3300030732 Bacteria 30397
354 Ga0316183_1041279 3300030742 Bacteria 41122
355 Ga0316183_1201626 3300030742 Bacteria 37918
356 Ga0316181_1239604 3300030744 Bacteria 5996
357 Ga0316181_1276674 3300030744 Bacteria 2307
358 Ga0265327_10000013 3300031251 Bacteria 519549
359 Ga0307516_10000869 3300031730 Bacteria 41512
360 Ga0307407_10000007 3300031903 Bacteria 210716
361 Ga0307412_10000001 3300031911 Bacteria 822691
362 Ga0307416_100000015 3300032002 Bacteria 210716
363 Ga0307414_10009961 3300032004 Bacteria 5486
364 Ga0373955_0018193 3300035172 Bacteria 3491
365 Ga0316574_0053066 3300035398 Bacteria 2530
366 Ga0373937_0000626 3300036401 Bacteria 31047
367 Ga0373937_0011023 3300036401 Bacteria 7925
368 Ga0395899_0000006 3300037312 Bacteria 666341
369 Ga0395900_0034792 3300037418 Bacteria 5189
370 Ga0395900_0094830 3300037418 Bacteria 3066
371 Ga0395905_0000227 3300037471 Bacteria 85540
372 Ga0395905_0002345 3300037471 Bacteria 21118
373 Ga0395901_0000598 3300038443 Bacteria 42043
374 Ga0436365_1886446 3300039437 Bacteria 15773
375 Ga0439438_002353 3300041405 Bacteria 8066
376 Ga0439432_004403 3300042006 Bacteria 5145
377 Ga0439452_000033 3300042010 Bacteria 178345
378 Ga0439452_000380 3300042010 Bacteria 26638
379 Ga0439457_005713 3300042014 Bacteria 3095
380 Ga0450898_001793 3300042134 Bacteria 2891
381 Ga0466972_0002481 3300044658 Bacteria 9128
382 Ga0466981_0000055 3300044669 Bacteria 29078
383 Ga0453684_0000549 3300044712 Bacteria 141927
384 Ga0453684_0028623 3300044712 Bacteria 7943
385 Ga0453684_0030869 3300044712 Bacteria 7555
386 Ga0453684_0032612 3300044712 Bacteria 7285
387 Ga0466960_0034244 3300044901 Bacteria 2366
388 Ga0495629_0053928 3300046459 Bacteria 2812
389 Ga0495650_0000205 3300046471 Bacteria 128197
390 Ga0495608_0011961 3300046511 Bacteria 6037
391 Ga0495630_0031080 3300046517 Bacteria 3974
392 Ga0495648_0000879 3300046524 Bacteria 31662
393 Ga0495587_0024372 3300046536 Bacteria 3709
394 Ga0495633_0000025 3300046558 Bacteria 218627
395 Ga0495668_0000114 3300046616 Bacteria 127503
396 Ga0495668_0003434 3300046616 Bacteria 11874
397 Ga0495634_0047864 3300046642 Bacteria 2880
398 Ga0495635_0027872 3300046663 Bacteria 3928
399 Ga0495658_0001473 3300046683 Bacteria 12392
400 Ga0495670_0043141 3300046691 Bacteria 2251
401 Ga0495600_0054098 3300046809 Bacteria 2622
402 Ga0495604_0046806 3300047317 Bacteria 3372
403 Ga0495687_000179 3300047443 Bacteria 92387
404 Ga0496100_0074591 3300048903 Bacteria 2273
405 Ga0496101_0024430 3300048904 Bacteria 4183
406 Ga0496104_0000828 3300048907 Bacteria 26653
407 Ga0496110_0032160 3300048913 Bacteria 4529
408 Ga0496116_0005691 3300048919 Bacteria 11463
409 Ga0496118_0013170 3300048921 Bacteria 7847
410 Ga0496119_0034164 3300048922 Bacteria 3355
411 Ga0496120_0005022 3300048923 Bacteria 10730
412 Ga0496120_0018354 3300048923 Bacteria 4511
413 Ga0496121_0000008 3300048924 Bacteria 843593
414 Ga0496121_0009129 3300048924 Bacteria 11472
415 Ga0496121_0012828 3300048924 Bacteria 9070
416 Ga0496122_0000925 3300048925 Bacteria 53549
417 Ga0496122_0006031 3300048925 Bacteria 14135
418 Ga0496123_0001642 3300048926 Bacteria 30044
419 Ga0496123_0003026 3300048926 Bacteria 19380
420 Ga0496123_0056342 3300048926 Bacteria 2569
421 Ga0496124_0007790 3300048927 Bacteria 11311
422 Ga0496125_0038841 3300048928 Bacteria 4110
423 Ga0496126_0022154 3300048929 Bacteria 6189
424 Ga0496126_0059586 3300048929 Bacteria 3437
425 Ga0501292_002171 3300049515 Bacteria 2502
426 Ga0501298_000863 3300049521 Bacteria 4287
427 Ga0501031_0009981 3300049568 Bacteria 6184
428 Ga0501031_0013524 3300049568 Bacteria 5319
429 Ga0501032_0027679 3300049569 Bacteria 3896
430 Ga0501032_0030466 3300049569 Bacteria 3702
431 Ga0501032_0039394 3300049569 Bacteria 3215
432 Ga0501033_0000085 3300049570 Bacteria 88350
433 Ga0501034_0000308 3300049571 Bacteria 86738
434 Ga0501034_0010456 3300049571 Bacteria 9664
435 Ga0501034_0029202 3300049571 Bacteria 5605
436 Ga0501036_0014936 3300049572 Bacteria 6478
437 Ga0501037_0000824 3300049573 Bacteria 23171
438 Ga0501038_0001133 3300049574 Bacteria 24176
439 Ga0501038_0010673 3300049574 Bacteria 8401
440 Ga0501038_0052433 3300049574 Bacteria 3517
441 Ga0501039_0010696 3300049575 Bacteria 6990
442 Ga0501039_0023254 3300049575 Bacteria 4756
443 Ga0501039_0027566 3300049575 Bacteria 4368
444 Ga0501043_0014571 3300049579 Bacteria 6156
445 Ga0501043_0033508 3300049579 Bacteria 4041
446 Ga0501046_0032390 3300049580 Bacteria 4232
447 Ga0501046_0036206 3300049580 Bacteria 3974
448 Ga0501047_0059765 3300049581 Bacteria 3680
449 Ga0501048_0033057 3300049582 Bacteria 3738
450 Ga0501198_000680 3300049649 Bacteria 4222
451 Ga0501201_000009 3300049651 Bacteria 11297
452 Ga0501202_000340 3300049652 Bacteria 6517
453 Ga0501206_000111 3300049653 Bacteria 8446
454 Ga0501207_000455 3300049654 Bacteria 4577
455 Ga0501223_001079 3300049663 Bacteria 6434
456 Ga0501224_000138 3300049664 Bacteria 8030
457 Ga0501252_000040 3300049682 Bacteria 6796
458 Ga0501259_000120 3300049688 Bacteria 11437
459 Ga0501261_000469 3300049690 Bacteria 5196
460 Ga0501221_000038 3300049704 Bacteria 12982
461 Ga0501225_0003204 3300049705 Bacteria 4998
462 Ga0501234_001449 3300049707 Bacteria 3725
463 Ga0501245_000227 3300049708 Bacteria 6347
464 Ga0501080_0115354 3300049742 Bacteria 2490
465 Ga0501083_0001228 3300049744 Bacteria 17354
466 Ga0501083_0021960 3300049744 Bacteria 4431
467 Ga0501035_0001789 3300049822 Bacteria 21715
468 Ga0501035_0005656 3300049822 Bacteria 11799
469 Ga0501035_0052851 3300049822 Bacteria 3635
470 Ga0501044_0000180 3300049823 Bacteria 78387
471 Ga0501044_0006371 3300049823 Bacteria 13046
472 Ga0501044_0008422 3300049823 Bacteria 11308
473 Ga0501044_0052468 3300049823 Bacteria 4202
474 Ga0501045_0005140 3300049824 Bacteria 9061
475 nmdc:mga0k408_896_c1 3300050493 Bacteria 16294
476 nmdc:mga05p37_137619_c1 3300050507 Bacteria 2993
477 nmdc:mga06r32_35892_c1 3300050510 Bacteria 4679
478 nmdc:mga08y16_177019_c1 3300050511 Bacteria 2215
479 Ga0500644_0000094 3300053088 Bacteria 55669
480 Ga0500651_0000128 3300053093 Bacteria 46966
481 Ga0500569_000197 3300053109 Bacteria 9577
482 Ga0500658_0001922 3300053134 Bacteria 8130
483 Ga0500559_0003519 3300053136 Bacteria 7669
484 Ga0500568_0002133 3300053139 Bacteria 11937
485 Ga0500568_0011709 3300053139 Bacteria 4055
486 Ga0500622_0000161 3300053156 Bacteria 70719
487 Ga0500622_0002778 3300053156 Bacteria 12307
488 Ga0500633_0001095 3300053160 Bacteria 4867
489 Ga0500611_000061 3300053727 Bacteria 45387
490 Ga0501082_0030413 3300060353 Bacteria 4653

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025986 Ga0207658_10113251 Ga0207658_101132512 535
2 3300009036 Ga0105244_10000105 Ga0105244_1000010564 578
3 3300025728 Ga0207655_1000226 Ga0207655_100022663 578
4 3300050511 nmdc:mga08y16_177019_c1 nmdc:mga08y16_177019_c1_357_2201 583
5 2162886007 SwRhRL2b_contig_3612275 SwRhRL2b_0185.00001840 584
6 3300003320 rootH2_10015620 rootH2_1001562011 584
7 3300005289 Ga0065704_10000373 Ga0065704_1000037316 584
8 3300005548 Ga0070665_100001635 Ga0070665_10000163517 584
9 3300005577 Ga0068857_100000003 Ga0068857_100000003150 584
10 3300006946 Ga0079104_1005234 Ga0079104_10052343 584
11 3300006946 Ga0079104_1006425 Ga0079104_10064254 584
12 3300006946 Ga0079104_1007032 Ga0079104_10070323 584
13 3300009011 Ga0105251_10013195 Ga0105251_100131951 584
14 3300009093 Ga0105240_10087392 Ga0105240_100873924 584
15 3300013100 Ga0157373_10061402 Ga0157373_100614022 584
16 3300013102 Ga0157371_10025845 Ga0157371_100258452 584
17 3300013104 Ga0157370_10027824 Ga0157370_100278243 584
18 3300015679 Ga0183366_1001 Ga0183366_1001164 584
19 3300015680 Ga0183370_1001 Ga0183370_1001164 584
20 3300015685 Ga0183369_1001 Ga0183369_1001164 584
21 3300015687 Ga0183368_1001 Ga0183368_1001164 584
22 3300025728 Ga0207655_1000087 Ga0207655_1000087131 584
23 3300025728 Ga0207655_1003596 Ga0207655_10035964 584
24 3300025735 Ga0207713_1000021 Ga0207713_1000021328 584
25 3300026116 Ga0207674_10002103 Ga0207674_1000210317 584
26 3300027111 Ga0209281_1001594 Ga0209281_10015949 584
27 3300027111 Ga0209281_1003420 Ga0209281_10034203 584
28 3300027312 Ga0209371_1000001 Ga0209371_1000001120 584
29 3300027312 Ga0209371_1005217 Ga0209371_10052173 584
30 3300028379 Ga0268266_10000084 Ga0268266_10000084193 584
31 3300030500 Ga0268256_1000001 Ga0268256_10000012521 584
32 3300030500 Ga0268256_1005087 Ga0268256_10050873 584
33 3300041405 Ga0439438_002353 Ga0439438_002353_4367_6229 584
34 3300042006 Ga0439432_004403 Ga0439432_004403_645_2507 584
35 3300042010 Ga0439452_000033 Ga0439452_000033_3177_5039 584
36 3300042010 Ga0439452_000380 Ga0439452_000380_22710_24572 584
37 3300044669 Ga0466981_0000055 Ga0466981_0000055_11729_13591 584
38 3300046471 Ga0495650_0000205 Ga0495650_0000205_115084_116946 584
39 3300048907 Ga0496104_0000828 Ga0496104_0000828_7614_9476 584
40 3300048919 Ga0496116_0005691 Ga0496116_0005691_2513_4375 584
41 3300048921 Ga0496118_0013170 Ga0496118_0013170_4189_6051 584
42 3300048922 Ga0496119_0034164 Ga0496119_0034164_408_2270 584
43 3300048923 Ga0496120_0005022 Ga0496120_0005022_8719_10581 584
44 3300048923 Ga0496120_0018354 Ga0496120_0018354_224_2086 584
45 3300048924 Ga0496121_0009129 Ga0496121_0009129_2694_4556 584
46 3300048924 Ga0496121_0012828 Ga0496121_0012828_122_1984 584
47 3300048925 Ga0496122_0000925 Ga0496122_0000925_2514_4376 584
48 3300048926 Ga0496123_0003026 Ga0496123_0003026_15005_16867 584
49 3300048926 Ga0496123_0056342 Ga0496123_0056342_644_2506 584
50 3300048927 Ga0496124_0007790 Ga0496124_0007790_2458_4320 584
51 3300048928 Ga0496125_0038841 Ga0496125_0038841_2069_3931 584
52 3300048929 Ga0496126_0059586 Ga0496126_0059586_114_1976 584
53 3300006946 Ga0079104_1000166 Ga0079104_100016625 590
54 3300027111 Ga0209281_1000001 Ga0209281_10000011721 590
55 3300005329 Ga0070683_100155313 Ga0070683_1001553131 611
56 3300025933 Ga0207706_10114797 Ga0207706_101147971 611
57 3300049581 Ga0501047_0059765 Ga0501047_0059765_1356_3224 611
58 3300049822 Ga0501035_0052851 Ga0501035_0052851_56_1924 611
59 3300049823 Ga0501044_0052468 Ga0501044_0052468_559_2427 611
60 3300005354 Ga0070675_100022678 Ga0070675_1000226783 612
61 3300025926 Ga0207659_10026799 Ga0207659_100267993 612
62 3300006844 Ga0075428_100011475 Ga0075428_1000114753 614
63 3300050510 nmdc:mga06r32_35892_c1 nmdc:mga06r32_35892_c1_1870_3804 614
64 3300025942 Ga0207689_10006615 Ga0207689_100066155 617
65 3300025961 Ga0207712_10001895 Ga0207712_100018955 617
66 3300026116 Ga0207674_10112775 Ga0207674_101127752 617
67 3300026118 Ga0207675_100027055 Ga0207675_1000270553 617
68 3300009553 Ga0105249_10008479 Ga0105249_100084797 618
69 3300039437 Ga0436365_1886446 Ga0436365_1886446_2134_4059 618
70 3300013296 Ga0157374_10005427 Ga0157374_100054275 620
71 3300050507 nmdc:mga05p37_137619_c1 nmdc:mga05p37_137619_c1_26_1963 620
72 3300025920 Ga0207649_10001758 Ga0207649_100017587 621
73 3300026116 Ga0207674_10106505 Ga0207674_101065052 624
74 3300035398 Ga0316574_0053066 Ga0316574_0053066_237_2144 625
75 iso_pu_bacteria 2522125168 2522553730 625
76 iso_pu_bacteria 2839989709 2839990212 625
77 iso_pu_bacteria 2910245624 2910249642 625
78 iso_pu_bacteria 2818991460 2819677290 626
79 iso_pu_bacteria 2911138879 2911139388 626
80 iso_pu_bacteria 2929177148 2929177303 626
81 iso_pu_bacteria 2929921140 2929921390 626
82 iso_pu_bacteria 2945977869 2945979669 626
83 iso_pu_bacteria 2946013367 2946014464 626
84 iso_pu_bacteria 8003151029 8003157570 626
85 3300044712 Ga0453684_0032612 Ga0453684_0032612_1287_3203 627
86 iso_pu_bacteria 2818991442 2819575299 627
87 iso_pu_bacteria 2821136567 2821141399 627
88 iso_pu_bacteria 2840677318 2840679132 627
89 iso_pu_bacteria 2883068021 2883070198 627
90 iso_pu_bacteria 2896085136 2896086943 627
91 iso_pu_bacteria 2896109856 2896115743 627
92 iso_pu_bacteria 2904467357 2904470996 627
93 3300005843 Ga0068860_100162265 Ga0068860_1001622651 628
94 3300044712 Ga0453684_0000549 Ga0453684_0000549_110239_112155 628
95 3300049569 Ga0501032_0039394 Ga0501032_0039394_132_2051 628
96 3300005337 Ga0070682_100000259 Ga0070682_10000025930 629
97 3300013306 Ga0163162_10000244 Ga0163162_1000024410 629
98 3300013306 Ga0163162_10001632 Ga0163162_100016328 629
99 3300013308 Ga0157375_10017905 Ga0157375_100179053 629
100 3300028577 Ga0265318_10013047 Ga0265318_100130472 629
101 3300036401 Ga0373937_0011023 Ga0373937_0011023_4913_6835 629
102 iso_pu_bacteria 2738541284 2738763191 629
103 iso_pu_bacteria 2739367866 2740031592 629
104 iso_pu_bacteria 2842903701 2842905398 629
105 iso_pu_bacteria 2842903701 2842909510 629
106 iso_pu_bacteria 2852627209 2852629732 629
107 iso_pu_bacteria 2898713307 2898714629 629
108 3300001979 JGI24740J21852_10002493 JGI24740J21852_100024937 630
109 3300002738 JGI25154J39366_1000006 JGI25154J39366_100000630 630
110 3300003215 JGI25153J46596_10004282 JGI25153J46596_100042826 630
111 3300003322 rootL2_10014283 rootL2_1001428310 630
112 3300003761 Ga0055535_1001754 Ga0055535_10017548 630
113 3300003794 Ga0055531_10000005 Ga0055531_1000000514 630
114 3300005290 Ga0065712_10068022 Ga0065712_1006802216 630
115 3300005327 Ga0070658_10000515 Ga0070658_1000051517 630
116 3300005328 Ga0070676_10000341 Ga0070676_1000034114 630
117 3300005334 Ga0068869_100032646 Ga0068869_1000326463 630
118 3300005335 Ga0070666_10000172 Ga0070666_100001722 630
119 3300005336 Ga0070680_100001715 Ga0070680_10000171513 630
120 3300005337 Ga0070682_100004034 Ga0070682_1000040348 630
121 3300005338 Ga0068868_100001522 Ga0068868_1000015224 630
122 3300005341 Ga0070691_10000875 Ga0070691_100008759 630
123 3300005347 Ga0070668_100000169 Ga0070668_10000016928 630
124 3300005364 Ga0070673_100000813 Ga0070673_1000008136 630
125 3300005367 Ga0070667_100000553 Ga0070667_1000005536 630
126 3300005457 Ga0070662_100002884 Ga0070662_1000028848 630
127 3300005458 Ga0070681_10057386 Ga0070681_100573861 630
128 3300005459 Ga0068867_100001171 Ga0068867_1000011712 630
129 3300005530 Ga0070679_100015506 Ga0070679_1000155062 630
130 3300005539 Ga0068853_100000272 Ga0068853_10000027210 630
131 3300005539 Ga0068853_100013077 Ga0068853_1000130776 630
132 3300005539 Ga0068853_100058737 Ga0068853_1000587372 630
133 3300005543 Ga0070672_100000061 Ga0070672_10000006117 630
134 3300005548 Ga0070665_100000612 Ga0070665_1000006127 630
135 3300005563 Ga0068855_100010495 Ga0068855_1000104952 630
136 3300005564 Ga0070664_100039019 Ga0070664_1000390192 630
137 3300005616 Ga0068852_100022230 Ga0068852_1000222302 630
138 3300005617 Ga0068859_100006881 Ga0068859_1000068817 630
139 3300005618 Ga0068864_100004846 Ga0068864_1000048466 630
140 3300005841 Ga0068863_100001273 Ga0068863_10000127317 630
141 3300005842 Ga0068858_100000930 Ga0068858_10000093013 630
142 3300006237 Ga0097621_100000821 Ga0097621_1000008217 630
143 3300006358 Ga0068871_100016561 Ga0068871_1000165613 630
144 3300006881 Ga0068865_100003524 Ga0068865_1000035247 630
145 3300006931 Ga0097620_100006881 Ga0097620_1000068817 630
146 3300009093 Ga0105240_10067456 Ga0105240_100674562 630
147 3300009174 Ga0105241_10009515 Ga0105241_100095153 630
148 3300009177 Ga0105248_10016765 Ga0105248_100167654 630
149 3300009553 Ga0105249_10001226 Ga0105249_1000122611 630
150 3300013104 Ga0157370_10009908 Ga0157370_100099082 630
151 3300013296 Ga0157374_10002119 Ga0157374_100021197 630
152 3300013306 Ga0163162_10000752 Ga0163162_1000075212 630
153 3300013308 Ga0157375_10000098 Ga0157375_1000009875 630
154 3300014325 Ga0163163_10000272 Ga0163163_1000027216 630
155 3300014325 Ga0163163_10113661 Ga0163163_101136612 630
156 3300014326 Ga0157380_10000602 Ga0157380_100006025 630
157 3300014968 Ga0157379_10000103 Ga0157379_1000010317 630
158 3300025208 Ga0209436_101519 Ga0209436_1015195 630
159 3300025242 Ga0209258_100029 Ga0209258_100029247 630
160 3300025246 Ga0209646_1000031 Ga0209646_100003164 630
161 3300025250 Ga0209026_1000019 Ga0209026_100001964 630
162 3300025254 Ga0209148_1000089 Ga0209148_1000089155 630
163 3300025284 Ga0209130_1002000 Ga0209130_100200010 630
164 3300025297 Ga0209758_1018212 Ga0209758_10182122 630
165 3300025302 Ga0207426_1000263 Ga0207426_100026367 630
166 3300025302 Ga0207426_1000513 Ga0207426_100051321 630
167 3300025304 Ga0209257_1000004 Ga0209257_1000004394 630
168 3300025903 Ga0207680_10001345 Ga0207680_100013457 630
169 3300025907 Ga0207645_10000793 Ga0207645_1000079317 630
170 3300025909 Ga0207705_10005062 Ga0207705_100050627 630
171 3300025911 Ga0207654_10001001 Ga0207654_1000100113 630
172 3300025912 Ga0207707_10000160 Ga0207707_1000016028 630
173 3300025913 Ga0207695_10002404 Ga0207695_100024047 630
174 3300025917 Ga0207660_10073788 Ga0207660_100737881 630
175 3300025921 Ga0207652_10000406 Ga0207652_100004063 630
176 3300025933 Ga0207706_10006661 Ga0207706_100066618 630
177 3300025938 Ga0207704_10004460 Ga0207704_100044604 630
178 3300025940 Ga0207691_10000154 Ga0207691_1000015441 630
179 3300025941 Ga0207711_10026152 Ga0207711_100261522 630
180 3300025942 Ga0207689_10029427 Ga0207689_100294274 630
181 3300025945 Ga0207679_10026961 Ga0207679_100269613 630
182 3300025949 Ga0207667_10046979 Ga0207667_100469794 630
183 3300025960 Ga0207651_10002520 Ga0207651_100025204 630
184 3300025961 Ga0207712_10013652 Ga0207712_100136523 630
185 3300025972 Ga0207668_10011546 Ga0207668_100115465 630
186 3300025986 Ga0207658_10001366 Ga0207658_1000136611 630
187 3300026023 Ga0207677_10000862 Ga0207677_1000086214 630
188 3300026035 Ga0207703_10000883 Ga0207703_1000088320 630
189 3300026041 Ga0207639_10001017 Ga0207639_1000101714 630
190 3300026041 Ga0207639_10077960 Ga0207639_100779601 630
191 3300026088 Ga0207641_10006669 Ga0207641_100066694 630
192 3300026089 Ga0207648_10079703 Ga0207648_100797032 630
193 3300026095 Ga0207676_10003634 Ga0207676_100036346 630
194 3300026142 Ga0207698_10010804 Ga0207698_100108042 630
195 3300028379 Ga0268266_10003931 Ga0268266_100039317 630
196 3300028381 Ga0268264_10004873 Ga0268264_100048737 630
197 3300028794 Ga0307515_10000001 Ga0307515_100000012088 630
198 3300031251 Ga0265327_10000013 Ga0265327_1000001318 630
199 3300046558 Ga0495633_0000025 Ga0495633_0000025_214965_216890 630
200 3300048904 Ga0496101_0024430 Ga0496101_0024430_385_2310 630
201 3300048929 Ga0496126_0022154 Ga0496126_0022154_3903_5828 630
202 3300049568 Ga0501031_0009981 Ga0501031_0009981_1964_3907 630
203 3300049569 Ga0501032_0030466 Ga0501032_0030466_714_2657 630
204 3300049571 Ga0501034_0000308 Ga0501034_0000308_56163_58106 630
205 3300049573 Ga0501037_0000824 Ga0501037_0000824_18176_20119 630
206 3300049574 Ga0501038_0001133 Ga0501038_0001133_8697_10640 630
207 3300049575 Ga0501039_0010696 Ga0501039_0010696_1964_3907 630
208 3300049579 Ga0501043_0014571 Ga0501043_0014571_1046_2989 630
209 3300049744 Ga0501083_0021960 Ga0501083_0021960_695_2623 630
210 3300049822 Ga0501035_0005656 Ga0501035_0005656_2546_4489 630
211 3300049823 Ga0501044_0000180 Ga0501044_0000180_28468_30411 630
212 3300049824 Ga0501045_0005140 Ga0501045_0005140_4706_6649 630
213 3300053088 Ga0500644_0000094 Ga0500644_0000094_27071_28996 630
214 3300053109 Ga0500569_000197 Ga0500569_000197_1675_3600 630
215 3300053134 Ga0500658_0001922 Ga0500658_0001922_5054_6979 630
216 3300053136 Ga0500559_0003519 Ga0500559_0003519_1296_3221 630
217 3300053156 Ga0500622_0000161 Ga0500622_0000161_37488_39413 630
218 3300053160 Ga0500633_0001095 Ga0500633_0001095_337_2262 630
219 3300001989 JGI24739J22299_10000408 JGI24739J22299_100004085 631
220 3300003354 JGI25160J50197_1001309 JGI25160J50197_10013096 631
221 3300003781 Ga0055536_1005887 Ga0055536_10058874 631
222 3300003791 Ga0055530_10003528 Ga0055530_100035285 631
223 3300005262 Ga0065165_1000042 Ga0065165_100004217 631
224 3300005262 Ga0065165_1000302 Ga0065165_100030275 631
225 3300005289 Ga0065704_10074597 Ga0065704_100745975 631
226 3300005353 Ga0070669_100013473 Ga0070669_1000134731 631
227 3300005356 Ga0070674_100004573 Ga0070674_1000045733 631
228 3300005458 Ga0070681_10028230 Ga0070681_100282302 631
229 3300005617 Ga0068859_100014669 Ga0068859_1000146694 631
230 3300005843 Ga0068860_100007018 Ga0068860_1000070184 631
231 3300006931 Ga0097620_100014669 Ga0097620_1000146694 631
232 3300013102 Ga0157371_10024734 Ga0157371_100247342 631
233 3300013306 Ga0163162_10212902 Ga0163162_102129021 631
234 3300014968 Ga0157379_10074646 Ga0157379_100746461 631
235 3300015265 Ga0182005_1000017 Ga0182005_1000017198 631
236 3300025273 Ga0209673_1000113 Ga0209673_1000113104 631
237 3300025292 Ga0209676_1004327 Ga0209676_10043274 631
238 3300025297 Ga0209758_1004657 Ga0209758_10046578 631
239 3300025298 Ga0209050_1000185 Ga0209050_1000185111 631
240 3300025302 Ga0207426_1001392 Ga0207426_10013927 631
241 3300025304 Ga0209257_1000257 Ga0209257_100025747 631
242 3300025900 Ga0207710_10000417 Ga0207710_1000041719 631
243 3300025912 Ga0207707_10079021 Ga0207707_100790212 631
244 3300025923 Ga0207681_10010625 Ga0207681_100106251 631
245 3300026089 Ga0207648_10074293 Ga0207648_100742932 631
246 3300026116 Ga0207674_10040174 Ga0207674_100401743 631
247 3300028381 Ga0268264_10019816 Ga0268264_100198162 631
248 3300035172 Ga0373955_0018193 Ga0373955_0018193_1100_3040 631
249 3300037418 Ga0395900_0034792 Ga0395900_0034792_2738_4666 631
250 3300037471 Ga0395905_0000227 Ga0395905_0000227_32907_34835 631
251 3300046459 Ga0495629_0053928 Ga0495629_0053928_535_2475 631
252 3300046683 Ga0495658_0001473 Ga0495658_0001473_485_2425 631
253 3300046691 Ga0495670_0043141 Ga0495670_0043141_20_1951 631
254 3300048924 Ga0496121_0000008 Ga0496121_0000008_30954_32978 631
255 3300049570 Ga0501033_0000085 Ga0501033_0000085_58150_60096 631
256 3300005262 Ga0065165_1005428 Ga0065165_10054283 632
257 3300005328 Ga0070676_10019525 Ga0070676_100195252 632
258 3300005329 Ga0070683_100001831 Ga0070683_10000183110 632
259 3300005329 Ga0070683_100015612 Ga0070683_1000156122 632
260 3300005333 Ga0070677_10004350 Ga0070677_100043503 632
261 3300005334 Ga0068869_100011207 Ga0068869_1000112075 632
262 3300005335 Ga0070666_10000301 Ga0070666_1000030129 632
263 3300005335 Ga0070666_10018149 Ga0070666_100181491 632
264 3300005338 Ga0068868_100007141 Ga0068868_1000071414 632
265 3300005340 Ga0070689_100045900 Ga0070689_1000459002 632
266 3300005344 Ga0070661_100000522 Ga0070661_10000052226 632
267 3300005344 Ga0070661_100009090 Ga0070661_1000090908 632
268 3300005355 Ga0070671_100008404 Ga0070671_1000084045 632
269 3300005355 Ga0070671_100015305 Ga0070671_1000153052 632
270 3300005364 Ga0070673_100012277 Ga0070673_1000122771 632
271 3300005366 Ga0070659_100008285 Ga0070659_1000082856 632
272 3300005367 Ga0070667_100003932 Ga0070667_10000393214 632
273 3300005367 Ga0070667_100057985 Ga0070667_1000579852 632
274 3300005457 Ga0070662_100052922 Ga0070662_1000529222 632
275 3300005535 Ga0070684_100001645 Ga0070684_10000164511 632
276 3300005539 Ga0068853_100004671 Ga0068853_1000046711 632
277 3300005564 Ga0070664_100000325 Ga0070664_10000032532 632
278 3300005577 Ga0068857_100004404 Ga0068857_1000044047 632
279 3300005617 Ga0068859_100000006 Ga0068859_100000006414 632
280 3300005617 Ga0068859_100014449 Ga0068859_1000144492 632
281 3300005617 Ga0068859_100056937 Ga0068859_1000569374 632
282 3300005618 Ga0068864_100014270 Ga0068864_1000142702 632
283 3300005618 Ga0068864_100025401 Ga0068864_1000254014 632
284 3300005841 Ga0068863_100052504 Ga0068863_1000525041 632
285 3300005842 Ga0068858_100004200 Ga0068858_1000042003 632
286 3300005843 Ga0068860_100001345 Ga0068860_1000013454 632
287 3300006237 Ga0097621_100000531 Ga0097621_1000005319 632
288 3300006237 Ga0097621_100004954 Ga0097621_1000049548 632
289 3300006358 Ga0068871_100000042 Ga0068871_1000000426 632
290 3300006931 Ga0097620_100000006 Ga0097620_100000006414 632
291 3300006931 Ga0097620_100014449 Ga0097620_1000144492 632
292 3300006931 Ga0097620_100056934 Ga0097620_1000569341 632
293 3300009093 Ga0105240_10000367 Ga0105240_1000036736 632
294 3300009174 Ga0105241_10000213 Ga0105241_100002137 632
295 3300009174 Ga0105241_10037679 Ga0105241_100376792 632
296 3300009177 Ga0105248_10014203 Ga0105248_100142034 632
297 3300009545 Ga0105237_10013195 Ga0105237_100131952 632
298 3300009545 Ga0105237_10014498 Ga0105237_100144985 632
299 3300009551 Ga0105238_10001981 Ga0105238_1000198117 632
300 3300009553 Ga0105249_10005776 Ga0105249_100057768 632
301 3300009553 Ga0105249_10058817 Ga0105249_100588172 632
302 3300010375 Ga0105239_10093265 Ga0105239_100932651 632
303 3300013100 Ga0157373_10016557 Ga0157373_100165571 632
304 3300013102 Ga0157371_10013997 Ga0157371_100139972 632
305 3300013296 Ga0157374_10000013 Ga0157374_10000013161 632
306 3300013296 Ga0157374_10009778 Ga0157374_100097789 632
307 3300013296 Ga0157374_10011557 Ga0157374_100115575 632
308 3300013296 Ga0157374_10022337 Ga0157374_100223372 632
309 3300013297 Ga0157378_10000859 Ga0157378_100008594 632
310 3300013297 Ga0157378_10006615 Ga0157378_100066154 632
311 3300013306 Ga0163162_10001071 Ga0163162_1000107111 632
312 3300013306 Ga0163162_10001214 Ga0163162_1000121424 632
313 3300013306 Ga0163162_10001265 Ga0163162_1000126517 632
314 3300013306 Ga0163162_10003537 Ga0163162_1000353715 632
315 3300013307 Ga0157372_10035531 Ga0157372_100355314 632
316 3300013308 Ga0157375_10001055 Ga0157375_1000105511 632
317 3300013308 Ga0157375_10028440 Ga0157375_100284402 632
318 3300013308 Ga0157375_10051617 Ga0157375_100516172 632
319 3300014325 Ga0163163_10000888 Ga0163163_1000088812 632
320 3300014325 Ga0163163_10001753 Ga0163163_1000175313 632
321 3300014326 Ga0157380_10058138 Ga0157380_100581382 632
322 3300014968 Ga0157379_10115632 Ga0157379_101156321 632
323 3300014969 Ga0157376_10010045 Ga0157376_100100454 632
324 3300014969 Ga0157376_10017770 Ga0157376_100177702 632
325 3300014969 Ga0157376_10020364 Ga0157376_100203643 632
326 3300014969 Ga0157376_10066099 Ga0157376_100660992 632
327 3300017792 Ga0163161_10003083 Ga0163161_100030833 632
328 3300017792 Ga0163161_10032349 Ga0163161_100323492 632
329 3300025302 Ga0207426_1017373 Ga0207426_10173732 632
330 3300025893 Ga0207682_10009478 Ga0207682_100094782 632
331 3300025903 Ga0207680_10000748 Ga0207680_1000074812 632
332 3300025907 Ga0207645_10007581 Ga0207645_100075817 632
333 3300025909 Ga0207705_10035485 Ga0207705_100354853 632
334 3300025911 Ga0207654_10008792 Ga0207654_100087922 632
335 3300025913 Ga0207695_10000550 Ga0207695_1000055035 632
336 3300025914 Ga0207671_10001002 Ga0207671_100010025 632
337 3300025914 Ga0207671_10003071 Ga0207671_1000307113 632
338 3300025924 Ga0207694_10008991 Ga0207694_100089914 632
339 3300025931 Ga0207644_10008218 Ga0207644_100082184 632
340 3300025932 Ga0207690_10005330 Ga0207690_100053303 632
341 3300025933 Ga0207706_10024337 Ga0207706_100243372 632
342 3300025933 Ga0207706_10036288 Ga0207706_100362882 632
343 3300025934 Ga0207686_10000626 Ga0207686_100006265 632
344 3300025938 Ga0207704_10051892 Ga0207704_100518922 632
345 3300025940 Ga0207691_10011687 Ga0207691_100116876 632
346 3300025942 Ga0207689_10017807 Ga0207689_100178075 632
347 3300025944 Ga0207661_10000680 Ga0207661_100006809 632
348 3300025945 Ga0207679_10000152 Ga0207679_1000015236 632
349 3300025960 Ga0207651_10037823 Ga0207651_100378232 632
350 3300025961 Ga0207712_10002022 Ga0207712_100020226 632
351 3300025961 Ga0207712_10032837 Ga0207712_100328372 632
352 3300025986 Ga0207658_10018309 Ga0207658_100183094 632
353 3300026023 Ga0207677_10072504 Ga0207677_100725041 632
354 3300026041 Ga0207639_10015986 Ga0207639_100159863 632
355 3300026088 Ga0207641_10000159 Ga0207641_1000015979 632
356 3300026088 Ga0207641_10020159 Ga0207641_100201593 632
357 3300026088 Ga0207641_10024328 Ga0207641_100243282 632
358 3300026088 Ga0207641_10061387 Ga0207641_100613872 632
359 3300026089 Ga0207648_10056701 Ga0207648_100567011 632
360 3300026116 Ga0207674_10004065 Ga0207674_100040656 632
361 3300026118 Ga0207675_100023999 Ga0207675_1000239992 632
362 3300026142 Ga0207698_10073167 Ga0207698_100731671 632
363 3300028794 Ga0307515_10000021 Ga0307515_10000021264 632
364 3300036401 Ga0373937_0000626 Ga0373937_0000626_14761_16692 632
365 3300037312 Ga0395899_0000006 Ga0395899_0000006_124798_126747 632
366 3300037418 Ga0395900_0094830 Ga0395900_0094830_694_2643 632
367 3300037471 Ga0395905_0002345 Ga0395905_0002345_14121_16070 632
368 3300038443 Ga0395901_0000598 Ga0395901_0000598_18046_20001 632
369 3300044658 Ga0466972_0002481 Ga0466972_0002481_4916_6847 632
370 3300044901 Ga0466960_0034244 Ga0466960_0034244_234_2165 632
371 3300046511 Ga0495608_0011961 Ga0495608_0011961_3214_5145 632
372 3300046517 Ga0495630_0031080 Ga0495630_0031080_1782_3713 632
373 3300046536 Ga0495587_0024372 Ga0495587_0024372_1314_3245 632
374 3300046616 Ga0495668_0000114 Ga0495668_0000114_62726_64657 632
375 3300046616 Ga0495668_0003434 Ga0495668_0003434_204_2135 632
376 3300046642 Ga0495634_0047864 Ga0495634_0047864_696_2627 632
377 3300046663 Ga0495635_0027872 Ga0495635_0027872_1984_3915 632
378 3300046809 Ga0495600_0054098 Ga0495600_0054098_123_2054 632
379 3300047317 Ga0495604_0046806 Ga0495604_0046806_1102_3033 632
380 3300048903 Ga0496100_0074591 Ga0496100_0074591_331_2262 632
381 3300048913 Ga0496110_0032160 Ga0496110_0032160_1975_3906 632
382 3300049515 Ga0501292_002171 Ga0501292_002171_553_2484 632
383 3300049521 Ga0501298_000863 Ga0501298_000863_1021_2952 632
384 3300049649 Ga0501198_000680 Ga0501198_000680_1321_3252 632
385 3300049651 Ga0501201_000009 Ga0501201_000009_7075_9006 632
386 3300049652 Ga0501202_000340 Ga0501202_000340_2044_3975 632
387 3300049653 Ga0501206_000111 Ga0501206_000111_5206_7137 632
388 3300049654 Ga0501207_000455 Ga0501207_000455_1333_3264 632
389 3300049663 Ga0501223_001079 Ga0501223_001079_2239_4170 632
390 3300049664 Ga0501224_000138 Ga0501224_000138_3984_5915 632
391 3300049682 Ga0501252_000040 Ga0501252_000040_2582_4513 632
392 3300049688 Ga0501259_000120 Ga0501259_000120_2329_4260 632
393 3300049690 Ga0501261_000469 Ga0501261_000469_2040_3971 632
394 3300049704 Ga0501221_000038 Ga0501221_000038_2034_3965 632
395 3300049705 Ga0501225_0003204 Ga0501225_0003204_1445_3376 632
396 3300049707 Ga0501234_001449 Ga0501234_001449_863_2794 632
397 3300049708 Ga0501245_000227 Ga0501245_000227_2308_4239 632
398 3300050493 nmdc:mga0k408_896_c1 nmdc:mga0k408_896_c1_4368_6299 632
399 3300060353 Ga0501082_0030413 Ga0501082_0030413_551_2506 632
400 2162886007 SwRhRL2b_contig_1482467 SwRhRL2b_0599.00006320 633
401 3300005288 Ga0065714_10009714 Ga0065714_100097146 633
402 3300005289 Ga0065704_10000425 Ga0065704_1000042557 633
403 3300005328 Ga0070676_10027075 Ga0070676_100270751 633
404 3300005335 Ga0070666_10016404 Ga0070666_100164042 633
405 3300005355 Ga0070671_100097828 Ga0070671_1000978282 633
406 3300005366 Ga0070659_100003003 Ga0070659_1000030037 633
407 3300005457 Ga0070662_100049363 Ga0070662_1000493632 633
408 3300005471 Ga0070698_100004398 Ga0070698_1000043988 633
409 3300005535 Ga0070684_100036540 Ga0070684_1000365403 633
410 3300005548 Ga0070665_100000002 Ga0070665_100000002418 633
411 3300005563 Ga0068855_100045651 Ga0068855_1000456512 633
412 3300005564 Ga0070664_100009965 Ga0070664_1000099657 633
413 3300005577 Ga0068857_100023055 Ga0068857_1000230552 633
414 3300005616 Ga0068852_100000787 Ga0068852_10000078718 633
415 3300005617 Ga0068859_100018620 Ga0068859_1000186204 633
416 3300005618 Ga0068864_100030131 Ga0068864_1000301314 633
417 3300005843 Ga0068860_100000003 Ga0068860_10000000336 633
418 3300005843 Ga0068860_100009699 Ga0068860_1000096992 633
419 3300005843 Ga0068860_100028647 Ga0068860_1000286472 633
420 3300006358 Ga0068871_100048895 Ga0068871_1000488955 633
421 3300006844 Ga0075428_100062058 Ga0075428_1000620582 633
422 3300006931 Ga0097620_100018620 Ga0097620_1000186205 633
423 3300009093 Ga0105240_10050390 Ga0105240_100503904 633
424 3300009176 Ga0105242_10071688 Ga0105242_100716881 633
425 3300009545 Ga0105237_10002608 Ga0105237_100026084 633
426 3300009553 Ga0105249_10001363 Ga0105249_100013633 633
427 3300013100 Ga0157373_10000916 Ga0157373_1000091613 633
428 3300013102 Ga0157371_10007402 Ga0157371_100074025 633
429 3300013102 Ga0157371_10009469 Ga0157371_100094691 633
430 3300013306 Ga0163162_10000952 Ga0163162_1000095210 633
431 3300013307 Ga0157372_10127472 Ga0157372_101274722 633
432 3300014325 Ga0163163_10013960 Ga0163163_100139606 633
433 3300014497 Ga0182008_10000022 Ga0182008_1000002265 633
434 3300014497 Ga0182008_10008974 Ga0182008_100089743 633
435 3300014497 Ga0182008_10046774 Ga0182008_100467741 633
436 3300014497 Ga0182008_10047019 Ga0182008_100470191 633
437 3300015261 Ga0182006_1005184 Ga0182006_10051842 633
438 3300017792 Ga0163161_10003213 Ga0163161_100032134 633
439 3300025893 Ga0207682_10005836 Ga0207682_100058364 633
440 3300025904 Ga0207647_10000050 Ga0207647_1000005024 633
441 3300025913 Ga0207695_10039740 Ga0207695_100397403 633
442 3300025914 Ga0207671_10000761 Ga0207671_1000076127 633
443 3300025914 Ga0207671_10015636 Ga0207671_100156361 633
444 3300025914 Ga0207671_10033866 Ga0207671_100338662 633
445 3300025925 Ga0207650_10064512 Ga0207650_100645122 633
446 3300025931 Ga0207644_10074528 Ga0207644_100745282 633
447 3300025932 Ga0207690_10009623 Ga0207690_100096234 633
448 3300025940 Ga0207691_10013466 Ga0207691_100134665 633
449 3300025942 Ga0207689_10001148 Ga0207689_100011481 633
450 3300025945 Ga0207679_10008672 Ga0207679_100086724 633
451 3300025949 Ga0207667_10007145 Ga0207667_100071452 633
452 3300025961 Ga0207712_10001184 Ga0207712_100011847 633
453 3300026035 Ga0207703_10031664 Ga0207703_100316643 633
454 3300026088 Ga0207641_10000467 Ga0207641_1000046736 633
455 3300026089 Ga0207648_10007945 Ga0207648_100079452 633
456 3300026089 Ga0207648_10012083 Ga0207648_100120835 633
457 3300026095 Ga0207676_10001829 Ga0207676_100018293 633
458 3300026116 Ga0207674_10012180 Ga0207674_100121805 633
459 3300026116 Ga0207674_10090457 Ga0207674_100904572 633
460 3300026118 Ga0207675_100005907 Ga0207675_1000059071 633
461 3300026118 Ga0207675_100019140 Ga0207675_1000191404 633
462 3300026121 Ga0207683_10011591 Ga0207683_100115915 633
463 3300026142 Ga0207698_10007436 Ga0207698_100074364 633
464 3300026142 Ga0207698_10066546 Ga0207698_100665461 633
465 3300028379 Ga0268266_10000022 Ga0268266_1000002220 633
466 3300028381 Ga0268264_10000082 Ga0268264_10000082193 633
467 3300028381 Ga0268264_10004522 Ga0268264_100045223 633
468 3300028381 Ga0268264_10021296 Ga0268264_100212963 633
469 3300028786 Ga0307517_10005192 Ga0307517_1000519211 633
470 3300028794 Ga0307515_10011199 Ga0307515_100111992 633
471 3300030521 Ga0307511_10000027 Ga0307511_1000002754 633
472 3300030732 Ga0316176_1063677 Ga0316176_10636775 633
473 3300030732 Ga0316176_1065190 Ga0316176_10651902 633
474 3300030742 Ga0316183_1041279 Ga0316183_104127931 633
475 3300030742 Ga0316183_1201626 Ga0316183_120162612 633
476 3300030744 Ga0316181_1239604 Ga0316181_12396042 633
477 3300030744 Ga0316181_1276674 Ga0316181_12766742 633
478 3300031730 Ga0307516_10000869 Ga0307516_1000086918 633
479 3300031903 Ga0307407_10000007 Ga0307407_10000007144 633
480 3300031911 Ga0307412_10000001 Ga0307412_1000000193 633
481 3300032002 Ga0307416_100000015 Ga0307416_10000001543 633
482 3300032004 Ga0307414_10009961 Ga0307414_100099613 633
483 3300042014 Ga0439457_005713 Ga0439457_005713_1046_2980 633
484 3300042134 Ga0450898_001793 Ga0450898_001793_194_2128 633
485 3300044712 Ga0453684_0028623 Ga0453684_0028623_576_2510 633
486 3300044712 Ga0453684_0030869 Ga0453684_0030869_3549_5486 633
487 3300046524 Ga0495648_0000879 Ga0495648_0000879_18476_20410 633
488 3300047443 Ga0495687_000179 Ga0495687_000179_43490_45424 633
489 3300048925 Ga0496122_0006031 Ga0496122_0006031_2841_4769 633
490 3300048926 Ga0496123_0001642 Ga0496123_0001642_14405_16333 633
491 3300049568 Ga0501031_0013524 Ga0501031_0013524_288_2222 633
492 3300049569 Ga0501032_0027679 Ga0501032_0027679_857_2791 633
493 3300049571 Ga0501034_0010456 Ga0501034_0010456_4674_6611 633
494 3300049571 Ga0501034_0029202 Ga0501034_0029202_2663_4597 633
495 3300049572 Ga0501036_0014936 Ga0501036_0014936_2646_4583 633
496 3300049574 Ga0501038_0010673 Ga0501038_0010673_421_2355 633
497 3300049574 Ga0501038_0052433 Ga0501038_0052433_372_2309 633
498 3300049575 Ga0501039_0023254 Ga0501039_0023254_338_2272 633
499 3300049575 Ga0501039_0027566 Ga0501039_0027566_775_2712 633
500 3300049579 Ga0501043_0033508 Ga0501043_0033508_1743_3680 633
501 3300049580 Ga0501046_0032390 Ga0501046_0032390_2062_3999 633
502 3300049580 Ga0501046_0036206 Ga0501046_0036206_551_2485 633
503 3300049582 Ga0501048_0033057 Ga0501048_0033057_954_2891 633
504 3300049742 Ga0501080_0115354 Ga0501080_0115354_234_2171 633
505 3300049744 Ga0501083_0001228 Ga0501083_0001228_1893_3830 633
506 3300049822 Ga0501035_0001789 Ga0501035_0001789_4057_5994 633
507 3300049823 Ga0501044_0006371 Ga0501044_0006371_9565_11502 633
508 3300049823 Ga0501044_0008422 Ga0501044_0008422_2346_4280 633
509 3300053093 Ga0500651_0000128 Ga0500651_0000128_25250_27178 633
510 3300053139 Ga0500568_0002133 Ga0500568_0002133_2047_3984 633
511 3300053139 Ga0500568_0011709 Ga0500568_0011709_1449_3383 633
512 3300053156 Ga0500622_0002778 Ga0500622_0002778_1625_3559 633
513 3300053727 Ga0500611_000061 Ga0500611_000061_37468_39405 633

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02779

Transket_pyr

Transketolase, pyrimidine binding domain

365

531

0.98

PF02780

Transketolase_C

Transketolase, C-terminal domain

545

666

0.98

PF13292

DXP_synthase_N

1-deoxy-D-xylulose-5-phosphate synthase

50

327

0.97

PF00676

E1_dh

Dehydrogenase E1 component

124

239

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ouv-assembly1.cif.gz_B 1-deoxy-d-xylulose 5-phosphate synthase (dxps) from deinococcus radiodurans with methylacetylphosphonate (map) bound 0.9341 7 622
8a29-assembly3.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9333 7 626
2o1x-assembly1.cif.gz_B 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from deinococcus radiodurans 0.9287 7 622
8a29-assembly2.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9278 7 626
2o1s-assembly1.cif.gz_B 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from escherichia coli 0.9252 6 624
ID Description Score Start End Superfamily
2o1sD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9598 7 284 3.40.50.970
2o1xD03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9596 494 622 3.40.50.920
af_A0A1D6M458_593_733_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9478 494 622 3.40.50.920
af_Q58092_187_315_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9445 494 621 3.40.50.920
2o1sD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9441 7 284 3.40.50.970
ID Description Score Start End GO Terms
AF-J9FQV9-F1-model_v4 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) 0.9798 383 597 GO:0005829
GO:0008661
GO:0009228
GO:0016114
GO:0019288
GO:0046872
GO:0052865
AF-A0A7V6ALR3-F1-model_v4 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) 0.9775 383 621 GO:0005829
GO:0008661
GO:0009228
GO:0016114
GO:0019288
GO:0046872
GO:0052865
AF-A0A3B8YP93-F1-model_v4 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) 0.976 441 618 GO:0005829
GO:0008661
GO:0016114
GO:0019288
AF-J9FQV9-F1-model_v4 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) 0.9753 383 597 GO:0005829
GO:0008661
GO:0009228
GO:0016114
GO:0019288
GO:0046872
GO:0052865
AF-A0A3D0J5U4-F1-model_v4 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) 0.9697 394 621 GO:0005829
GO:0008661
GO:0009228
GO:0016114
GO:0019288
GO:0046872
GO:0052865

Feature Viewer

pLDDT pTM Quality
82.72 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map