F457561
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 513 | 279 | 490 | 639 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_10001363|Ga0105249_100013633 |
| Length | 686 |
| Sequence | MGYLPHVSKLCRGELFSRLFVMESLATTGYKKLNFTPQKMNMQITPGPLLNTINSPADLKKLSRENLHQLCDELRQYIIDVVSVHGGHFGASLGVVELTVALHYIYNTPYDQLVWDVGHQAYGHKILTGRRDNFPTNRKYKGLSGFPKRSESEYDTFGVGHSSTSISAALGMAMAAQYKGEKNRKSVAIIGDGAMTAGLAFEAMNHAGVADADLLIILNDNCMSIDPNVGALKEYLTDITTSPTYNKFRDELWKLMGKLPVGKKFTRDMASKMEAGLKGMVSKSSNLFEALNLRYFGPIDGHNITKLVDTLKDLREISGPKLLHIVTVKGKGYSLAEKDQTKWHAPGLFDKVTGEIQKKKFDLPQPPKYQDVFGHTIIELAEQNEKIFGITPAMPSGSSLKYMMEKMPHRAFDVGIAEQHAVTLSAGMATQGMKVFCNIYSSFMQRAYDQVVHDVAIQNLPVIFCLDRAGLVGDDGPTHHGCYDIAYMRCVPNMIVSAPMNESELRNLMYTAQLDSTNHPFVIRYPRGEGVMPEWKTEMKEIKIGTGRKLRDGNDIAILSFGHPGNFAAAAIRDLKNDGLNPAHYDMRFAKPLDEELLHEIFNKFDKIITVEDGTVKGGFGSAVLEFMNEQNYKAEMKILGIPDRLVEHGTPKELHKECGYDAQAIKEAVLEMMRGKVSINNSVLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 3 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 4 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 5 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 6 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 7 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 8 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 9 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 10 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 11 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 12 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 13 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 14 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 15 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 16 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 17 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 18 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 19 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 20 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 21 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 22 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 23 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 24 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 25 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 28 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 29 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 30 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 108 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 109 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 110 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 169 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 173 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 174 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 175 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 177 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 178 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 179 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 180 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 186 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 194 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 195 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 196 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 197 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 198 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 199 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 200 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 201 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 202 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 203 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 222 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 223 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 224 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 225 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 226 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 227 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 228 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 229 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 230 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 231 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 232 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 233 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 234 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 247 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 248 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 249 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 250 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 251 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 254 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 255 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 256 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 257 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 258 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 259 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 260 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 270 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 271 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 272 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 273 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 274 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 276 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 277 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 278 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.52 |
| Metatranscriptomes | 0 |
| Isolates | 4.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.02 |
| Nodule | 1.36 |
| Rhizoplane | 0.78 |
| Rhizosphere | 81.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1482467 | 2162886007 | Bacteria | 8665 |
| 2 | SwRhRL2b_contig_3612275 | 2162886007 | Bacteria | 3601 |
| 3 | JGI24740J21852_10002493 | 3300001979 | Bacteria | 8324 |
| 4 | JGI24739J22299_10000408 | 3300001989 | Bacteria | 14855 |
| 5 | JGI25154J39366_1000006 | 3300002738 | Bacteria | 336396 |
| 6 | JGI25153J46596_10004282 | 3300003215 | Bacteria | 7716 |
| 7 | rootH2_10015620 | 3300003320 | Bacteria | 27832 |
| 8 | rootL2_10014283 | 3300003322 | Bacteria | 15569 |
| 9 | JGI25160J50197_1001309 | 3300003354 | Bacteria | 12570 |
| 10 | Ga0055535_1001754 | 3300003761 | Bacteria | 9677 |
| 11 | Ga0055536_1005887 | 3300003781 | Bacteria | 5877 |
| 12 | Ga0055530_10003528 | 3300003791 | Bacteria | 8825 |
| 13 | Ga0055531_10000005 | 3300003794 | Bacteria | 242179 |
| 14 | Ga0065165_1000042 | 3300005262 | Bacteria | 203874 |
| 15 | Ga0065165_1000302 | 3300005262 | Bacteria | 82711 |
| 16 | Ga0065165_1005428 | 3300005262 | Bacteria | 7175 |
| 17 | Ga0065714_10009714 | 3300005288 | Bacteria | 6617 |
| 18 | Ga0065704_10000373 | 3300005289 | Bacteria | 25770 |
| 19 | Ga0065704_10000425 | 3300005289 | Bacteria | 76756 |
| 20 | Ga0065704_10074597 | 3300005289 | Bacteria | 6146 |
| 21 | Ga0065712_10068022 | 3300005290 | Bacteria | 16959 |
| 22 | Ga0070658_10000515 | 3300005327 | Bacteria | 33566 |
| 23 | Ga0070676_10000341 | 3300005328 | Bacteria | 21305 |
| 24 | Ga0070676_10019525 | 3300005328 | Bacteria | 3772 |
| 25 | Ga0070676_10027075 | 3300005328 | Bacteria | 3249 |
| 26 | Ga0070683_100001831 | 3300005329 | Bacteria | 16578 |
| 27 | Ga0070683_100015612 | 3300005329 | Bacteria | 6675 |
| 28 | Ga0070683_100155313 | 3300005329 | Bacteria | 2170 |
| 29 | Ga0070677_10004350 | 3300005333 | Bacteria | 4615 |
| 30 | Ga0068869_100011207 | 3300005334 | Bacteria | 5874 |
| 31 | Ga0068869_100032646 | 3300005334 | Bacteria | 3670 |
| 32 | Ga0070666_10000172 | 3300005335 | Bacteria | 44437 |
| 33 | Ga0070666_10000301 | 3300005335 | Bacteria | 31985 |
| 34 | Ga0070666_10016404 | 3300005335 | Bacteria | 4739 |
| 35 | Ga0070666_10018149 | 3300005335 | Bacteria | 4519 |
| 36 | Ga0070680_100001715 | 3300005336 | Bacteria | 16104 |
| 37 | Ga0070682_100000259 | 3300005337 | Bacteria | 38232 |
| 38 | Ga0070682_100004034 | 3300005337 | Bacteria | 8160 |
| 39 | Ga0068868_100001522 | 3300005338 | Bacteria | 15890 |
| 40 | Ga0068868_100007141 | 3300005338 | Bacteria | 7938 |
| 41 | Ga0070689_100045900 | 3300005340 | Bacteria | 3366 |
| 42 | Ga0070691_10000875 | 3300005341 | Bacteria | 12204 |
| 43 | Ga0070661_100000522 | 3300005344 | Bacteria | 29477 |
| 44 | Ga0070661_100009090 | 3300005344 | Bacteria | 6872 |
| 45 | Ga0070668_100000169 | 3300005347 | Bacteria | 41705 |
| 46 | Ga0070669_100013473 | 3300005353 | Bacteria | 5813 |
| 47 | Ga0070675_100022678 | 3300005354 | Bacteria | 5016 |
| 48 | Ga0070671_100008404 | 3300005355 | Bacteria | 8274 |
| 49 | Ga0070671_100015305 | 3300005355 | Bacteria | 6195 |
| 50 | Ga0070671_100097828 | 3300005355 | Bacteria | 2461 |
| 51 | Ga0070674_100004573 | 3300005356 | Bacteria | 7901 |
| 52 | Ga0070673_100000813 | 3300005364 | Bacteria | 17473 |
| 53 | Ga0070673_100012277 | 3300005364 | Bacteria | 5876 |
| 54 | Ga0070659_100003003 | 3300005366 | Bacteria | 12009 |
| 55 | Ga0070659_100008285 | 3300005366 | Bacteria | 7589 |
| 56 | Ga0070667_100000553 | 3300005367 | Bacteria | 37217 |
| 57 | Ga0070667_100003932 | 3300005367 | Bacteria | 12623 |
| 58 | Ga0070667_100057985 | 3300005367 | Bacteria | 3273 |
| 59 | Ga0070662_100002884 | 3300005457 | Bacteria | 10668 |
| 60 | Ga0070662_100049363 | 3300005457 | Bacteria | 3035 |
| 61 | Ga0070662_100052922 | 3300005457 | Bacteria | 2938 |
| 62 | Ga0070681_10028230 | 3300005458 | Bacteria | 5641 |
| 63 | Ga0070681_10057386 | 3300005458 | Bacteria | 3873 |
| 64 | Ga0068867_100001171 | 3300005459 | Bacteria | 17945 |
| 65 | Ga0070698_100004398 | 3300005471 | Bacteria | 15482 |
| 66 | Ga0070679_100015506 | 3300005530 | Bacteria | 7323 |
| 67 | Ga0070684_100001645 | 3300005535 | Bacteria | 16198 |
| 68 | Ga0070684_100036540 | 3300005535 | Bacteria | 4209 |
| 69 | Ga0068853_100000272 | 3300005539 | Bacteria | 36612 |
| 70 | Ga0068853_100004671 | 3300005539 | Bacteria | 10620 |
| 71 | Ga0068853_100013077 | 3300005539 | Bacteria | 6770 |
| 72 | Ga0068853_100058737 | 3300005539 | Bacteria | 3321 |
| 73 | Ga0070672_100000061 | 3300005543 | Bacteria | 49701 |
| 74 | Ga0070665_100000002 | 3300005548 | Bacteria | 849037 |
| 75 | Ga0070665_100000612 | 3300005548 | Bacteria | 48973 |
| 76 | Ga0070665_100001635 | 3300005548 | Bacteria | 25828 |
| 77 | Ga0068855_100010495 | 3300005563 | Bacteria | 11174 |
| 78 | Ga0068855_100045651 | 3300005563 | Bacteria | 5182 |
| 79 | Ga0070664_100000325 | 3300005564 | Bacteria | 34677 |
| 80 | Ga0070664_100009965 | 3300005564 | Bacteria | 7703 |
| 81 | Ga0070664_100039019 | 3300005564 | Bacteria | 4000 |
| 82 | Ga0068857_100000003 | 3300005577 | Bacteria | 174630 |
| 83 | Ga0068857_100004404 | 3300005577 | Bacteria | 11902 |
| 84 | Ga0068857_100023055 | 3300005577 | Bacteria | 5475 |
| 85 | Ga0068852_100000787 | 3300005616 | Bacteria | 20834 |
| 86 | Ga0068852_100022230 | 3300005616 | Bacteria | 5083 |
| 87 | Ga0068859_100000006 | 3300005617 | Bacteria | 421509 |
| 88 | Ga0068859_100006881 | 3300005617 | Bacteria | 11542 |
| 89 | Ga0068859_100014449 | 3300005617 | Bacteria | 7924 |
| 90 | Ga0068859_100014669 | 3300005617 | Bacteria | 7875 |
| 91 | Ga0068859_100018620 | 3300005617 | Bacteria | 6980 |
| 92 | Ga0068859_100056937 | 3300005617 | Bacteria | 3937 |
| 93 | Ga0068864_100004846 | 3300005618 | Bacteria | 11021 |
| 94 | Ga0068864_100014270 | 3300005618 | Bacteria | 6597 |
| 95 | Ga0068864_100025401 | 3300005618 | Bacteria | 4988 |
| 96 | Ga0068864_100030131 | 3300005618 | Bacteria | 4599 |
| 97 | Ga0068863_100001273 | 3300005841 | Bacteria | 25131 |
| 98 | Ga0068863_100052504 | 3300005841 | Bacteria | 3863 |
| 99 | Ga0068858_100000930 | 3300005842 | Bacteria | 30365 |
| 100 | Ga0068858_100004200 | 3300005842 | Bacteria | 14178 |
| 101 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 102 | Ga0068860_100001345 | 3300005843 | Bacteria | 26726 |
| 103 | Ga0068860_100007018 | 3300005843 | Bacteria | 11278 |
| 104 | Ga0068860_100009699 | 3300005843 | Bacteria | 9564 |
| 105 | Ga0068860_100028647 | 3300005843 | Bacteria | 5361 |
| 106 | Ga0068860_100162265 | 3300005843 | Bacteria | 2155 |
| 107 | Ga0097621_100000531 | 3300006237 | Bacteria | 26760 |
| 108 | Ga0097621_100000821 | 3300006237 | Bacteria | 21965 |
| 109 | Ga0097621_100004954 | 3300006237 | Bacteria | 9336 |
| 110 | Ga0068871_100000042 | 3300006358 | Bacteria | 67951 |
| 111 | Ga0068871_100016561 | 3300006358 | Bacteria | 5558 |
| 112 | Ga0068871_100048895 | 3300006358 | Bacteria | 3416 |
| 113 | Ga0075428_100011475 | 3300006844 | Bacteria | 9856 |
| 114 | Ga0075428_100062058 | 3300006844 | Bacteria | 4092 |
| 115 | Ga0068865_100003524 | 3300006881 | Bacteria | 9385 |
| 116 | Ga0097620_100000006 | 3300006931 | Bacteria | 421509 |
| 117 | Ga0097620_100006881 | 3300006931 | Bacteria | 11542 |
| 118 | Ga0097620_100014449 | 3300006931 | Bacteria | 7924 |
| 119 | Ga0097620_100014669 | 3300006931 | Bacteria | 7875 |
| 120 | Ga0097620_100018620 | 3300006931 | Bacteria | 6980 |
| 121 | Ga0097620_100056934 | 3300006931 | Bacteria | 3937 |
| 122 | Ga0079104_1000166 | 3300006946 | Bacteria | 94027 |
| 123 | Ga0079104_1005234 | 3300006946 | Bacteria | 5238 |
| 124 | Ga0079104_1006425 | 3300006946 | Bacteria | 4448 |
| 125 | Ga0079104_1007032 | 3300006946 | Bacteria | 4143 |
| 126 | Ga0105251_10013195 | 3300009011 | Bacteria | 4632 |
| 127 | Ga0105244_10000105 | 3300009036 | Bacteria | 86528 |
| 128 | Ga0105240_10000367 | 3300009093 | Bacteria | 84666 |
| 129 | Ga0105240_10050390 | 3300009093 | Bacteria | 5250 |
| 130 | Ga0105240_10067456 | 3300009093 | Bacteria | 4434 |
| 131 | Ga0105240_10087392 | 3300009093 | Bacteria | 3818 |
| 132 | Ga0105241_10000213 | 3300009174 | Bacteria | 43667 |
| 133 | Ga0105241_10009515 | 3300009174 | Bacteria | 7139 |
| 134 | Ga0105241_10037679 | 3300009174 | Bacteria | 3643 |
| 135 | Ga0105242_10071688 | 3300009176 | Bacteria | 2876 |
| 136 | Ga0105248_10014203 | 3300009177 | Bacteria | 8767 |
| 137 | Ga0105248_10016765 | 3300009177 | Bacteria | 8067 |
| 138 | Ga0105237_10002608 | 3300009545 | Bacteria | 22196 |
| 139 | Ga0105237_10013195 | 3300009545 | Bacteria | 8670 |
| 140 | Ga0105237_10014498 | 3300009545 | Bacteria | 8238 |
| 141 | Ga0105238_10001981 | 3300009551 | Bacteria | 20624 |
| 142 | Ga0105249_10001226 | 3300009553 | Bacteria | 22548 |
| 143 | Ga0105249_10001363 | 3300009553 | Bacteria | 21359 |
| 144 | Ga0105249_10005776 | 3300009553 | Bacteria | 10700 |
| 145 | Ga0105249_10008479 | 3300009553 | Bacteria | 8957 |
| 146 | Ga0105249_10058817 | 3300009553 | Bacteria | 3524 |
| 147 | Ga0105239_10093265 | 3300010375 | Bacteria | 3324 |
| 148 | Ga0157373_10000916 | 3300013100 | Bacteria | 22855 |
| 149 | Ga0157373_10016557 | 3300013100 | Bacteria | 5376 |
| 150 | Ga0157373_10061402 | 3300013100 | Bacteria | 2662 |
| 151 | Ga0157371_10007402 | 3300013102 | Bacteria | 8894 |
| 152 | Ga0157371_10009469 | 3300013102 | Bacteria | 7664 |
| 153 | Ga0157371_10013997 | 3300013102 | Bacteria | 6072 |
| 154 | Ga0157371_10024734 | 3300013102 | Bacteria | 4381 |
| 155 | Ga0157371_10025845 | 3300013102 | Bacteria | 4273 |
| 156 | Ga0157370_10009908 | 3300013104 | Bacteria | 10095 |
| 157 | Ga0157370_10027824 | 3300013104 | Bacteria | 5571 |
| 158 | Ga0157374_10000013 | 3300013296 | Bacteria | 461240 |
| 159 | Ga0157374_10002119 | 3300013296 | Bacteria | 16701 |
| 160 | Ga0157374_10005427 | 3300013296 | Bacteria | 10712 |
| 161 | Ga0157374_10009778 | 3300013296 | Bacteria | 8237 |
| 162 | Ga0157374_10011557 | 3300013296 | Bacteria | 7653 |
| 163 | Ga0157374_10022337 | 3300013296 | Bacteria | 5643 |
| 164 | Ga0157378_10000859 | 3300013297 | Bacteria | 28140 |
| 165 | Ga0157378_10006615 | 3300013297 | Bacteria | 10125 |
| 166 | Ga0163162_10000244 | 3300013306 | Bacteria | 49260 |
| 167 | Ga0163162_10000752 | 3300013306 | Bacteria | 30172 |
| 168 | Ga0163162_10000952 | 3300013306 | Bacteria | 26875 |
| 169 | Ga0163162_10001071 | 3300013306 | Bacteria | 25453 |
| 170 | Ga0163162_10001214 | 3300013306 | Bacteria | 24073 |
| 171 | Ga0163162_10001265 | 3300013306 | Bacteria | 23633 |
| 172 | Ga0163162_10001632 | 3300013306 | Bacteria | 20996 |
| 173 | Ga0163162_10003537 | 3300013306 | Bacteria | 14946 |
| 174 | Ga0163162_10212902 | 3300013306 | Bacteria | 2063 |
| 175 | Ga0157372_10035531 | 3300013307 | Bacteria | 5487 |
| 176 | Ga0157372_10127472 | 3300013307 | Bacteria | 2926 |
| 177 | Ga0157375_10000098 | 3300013308 | Bacteria | 88130 |
| 178 | Ga0157375_10001055 | 3300013308 | Bacteria | 23768 |
| 179 | Ga0157375_10017905 | 3300013308 | Bacteria | 6409 |
| 180 | Ga0157375_10028440 | 3300013308 | Bacteria | 5239 |
| 181 | Ga0157375_10051617 | 3300013308 | Bacteria | 4039 |
| 182 | Ga0163163_10000272 | 3300014325 | Bacteria | 51699 |
| 183 | Ga0163163_10000888 | 3300014325 | Bacteria | 25452 |
| 184 | Ga0163163_10001753 | 3300014325 | Bacteria | 18282 |
| 185 | Ga0163163_10013960 | 3300014325 | Bacteria | 7371 |
| 186 | Ga0163163_10113661 | 3300014325 | Bacteria | 2738 |
| 187 | Ga0157380_10000602 | 3300014326 | Bacteria | 22163 |
| 188 | Ga0157380_10058138 | 3300014326 | Bacteria | 3082 |
| 189 | Ga0182008_10000022 | 3300014497 | Bacteria | 207052 |
| 190 | Ga0182008_10008974 | 3300014497 | Bacteria | 5418 |
| 191 | Ga0182008_10046774 | 3300014497 | Bacteria | 2150 |
| 192 | Ga0182008_10047019 | 3300014497 | Bacteria | 2144 |
| 193 | Ga0157379_10000103 | 3300014968 | Bacteria | 58102 |
| 194 | Ga0157379_10074646 | 3300014968 | Bacteria | 3036 |
| 195 | Ga0157379_10115632 | 3300014968 | Bacteria | 2412 |
| 196 | Ga0157376_10010045 | 3300014969 | Bacteria | 6909 |
| 197 | Ga0157376_10017770 | 3300014969 | Bacteria | 5434 |
| 198 | Ga0157376_10020364 | 3300014969 | Bacteria | 5130 |
| 199 | Ga0157376_10066099 | 3300014969 | Bacteria | 3056 |
| 200 | Ga0182006_1005184 | 3300015261 | Bacteria | 6250 |
| 201 | Ga0182005_1000017 | 3300015265 | Bacteria | 331828 |
| 202 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 203 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 204 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 205 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 206 | Ga0163161_10003083 | 3300017792 | Bacteria | 11762 |
| 207 | Ga0163161_10003213 | 3300017792 | Bacteria | 11494 |
| 208 | Ga0163161_10032349 | 3300017792 | Bacteria | 3734 |
| 209 | Ga0209436_101519 | 3300025208 | Bacteria | 7956 |
| 210 | Ga0209258_100029 | 3300025242 | Bacteria | 490648 |
| 211 | Ga0209646_1000031 | 3300025246 | Bacteria | 381260 |
| 212 | Ga0209026_1000019 | 3300025250 | Bacteria | 381260 |
| 213 | Ga0209148_1000089 | 3300025254 | Bacteria | 253548 |
| 214 | Ga0209673_1000113 | 3300025273 | Bacteria | 179012 |
| 215 | Ga0209130_1002000 | 3300025284 | Bacteria | 11129 |
| 216 | Ga0209676_1004327 | 3300025292 | Bacteria | 7976 |
| 217 | Ga0209758_1004657 | 3300025297 | Bacteria | 11228 |
| 218 | Ga0209758_1018212 | 3300025297 | Bacteria | 3456 |
| 219 | Ga0209050_1000185 | 3300025298 | Bacteria | 141889 |
| 220 | Ga0207426_1000263 | 3300025302 | Bacteria | 110923 |
| 221 | Ga0207426_1000513 | 3300025302 | Bacteria | 56488 |
| 222 | Ga0207426_1001392 | 3300025302 | Bacteria | 20412 |
| 223 | Ga0207426_1017373 | 3300025302 | Bacteria | 2560 |
| 224 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 225 | Ga0209257_1000257 | 3300025304 | Bacteria | 122448 |
| 226 | Ga0207655_1000087 | 3300025728 | Bacteria | 205876 |
| 227 | Ga0207655_1000226 | 3300025728 | Bacteria | 94688 |
| 228 | Ga0207655_1003596 | 3300025728 | Bacteria | 11459 |
| 229 | Ga0207713_1000021 | 3300025735 | Bacteria | 353108 |
| 230 | Ga0207682_10005836 | 3300025893 | Bacteria | 4990 |
| 231 | Ga0207682_10009478 | 3300025893 | Bacteria | 3842 |
| 232 | Ga0207710_10000417 | 3300025900 | Bacteria | 28186 |
| 233 | Ga0207680_10000748 | 3300025903 | Bacteria | 15314 |
| 234 | Ga0207680_10001345 | 3300025903 | Bacteria | 11631 |
| 235 | Ga0207647_10000050 | 3300025904 | Bacteria | 88099 |
| 236 | Ga0207645_10000793 | 3300025907 | Bacteria | 26435 |
| 237 | Ga0207645_10007581 | 3300025907 | Bacteria | 7650 |
| 238 | Ga0207705_10005062 | 3300025909 | Bacteria | 9880 |
| 239 | Ga0207705_10035485 | 3300025909 | Bacteria | 3567 |
| 240 | Ga0207654_10001001 | 3300025911 | Bacteria | 15487 |
| 241 | Ga0207654_10008792 | 3300025911 | Bacteria | 5123 |
| 242 | Ga0207707_10000160 | 3300025912 | Bacteria | 70695 |
| 243 | Ga0207707_10079021 | 3300025912 | Bacteria | 2873 |
| 244 | Ga0207695_10000550 | 3300025913 | Bacteria | 77346 |
| 245 | Ga0207695_10002404 | 3300025913 | Bacteria | 27705 |
| 246 | Ga0207695_10039740 | 3300025913 | Bacteria | 5053 |
| 247 | Ga0207671_10000761 | 3300025914 | Bacteria | 40954 |
| 248 | Ga0207671_10001002 | 3300025914 | Bacteria | 34718 |
| 249 | Ga0207671_10003071 | 3300025914 | Bacteria | 17063 |
| 250 | Ga0207671_10015636 | 3300025914 | Bacteria | 5933 |
| 251 | Ga0207671_10033866 | 3300025914 | Bacteria | 3799 |
| 252 | Ga0207660_10073788 | 3300025917 | Bacteria | 2488 |
| 253 | Ga0207649_10001758 | 3300025920 | Bacteria | 12433 |
| 254 | Ga0207652_10000406 | 3300025921 | Bacteria | 44756 |
| 255 | Ga0207681_10010625 | 3300025923 | Bacteria | 5645 |
| 256 | Ga0207694_10008991 | 3300025924 | Bacteria | 7542 |
| 257 | Ga0207650_10064512 | 3300025925 | Bacteria | 2742 |
| 258 | Ga0207659_10026799 | 3300025926 | Bacteria | 3894 |
| 259 | Ga0207644_10008218 | 3300025931 | Bacteria | 6835 |
| 260 | Ga0207644_10074528 | 3300025931 | Bacteria | 2491 |
| 261 | Ga0207690_10005330 | 3300025932 | Bacteria | 7578 |
| 262 | Ga0207690_10009623 | 3300025932 | Bacteria | 5737 |
| 263 | Ga0207706_10006661 | 3300025933 | Bacteria | 10681 |
| 264 | Ga0207706_10024337 | 3300025933 | Bacteria | 5428 |
| 265 | Ga0207706_10036288 | 3300025933 | Bacteria | 4379 |
| 266 | Ga0207706_10114797 | 3300025933 | Bacteria | 2368 |
| 267 | Ga0207686_10000626 | 3300025934 | Bacteria | 21965 |
| 268 | Ga0207704_10004460 | 3300025938 | Bacteria | 6400 |
| 269 | Ga0207704_10051892 | 3300025938 | Bacteria | 2483 |
| 270 | Ga0207691_10000154 | 3300025940 | Bacteria | 64281 |
| 271 | Ga0207691_10011687 | 3300025940 | Bacteria | 8431 |
| 272 | Ga0207691_10013466 | 3300025940 | Bacteria | 7827 |
| 273 | Ga0207711_10026152 | 3300025941 | Bacteria | 4895 |
| 274 | Ga0207689_10001148 | 3300025942 | Bacteria | 25510 |
| 275 | Ga0207689_10006615 | 3300025942 | Bacteria | 10224 |
| 276 | Ga0207689_10017807 | 3300025942 | Bacteria | 6003 |
| 277 | Ga0207689_10029427 | 3300025942 | Bacteria | 4586 |
| 278 | Ga0207661_10000680 | 3300025944 | Bacteria | 22011 |
| 279 | Ga0207679_10000152 | 3300025945 | Bacteria | 56780 |
| 280 | Ga0207679_10008672 | 3300025945 | Bacteria | 6482 |
| 281 | Ga0207679_10026961 | 3300025945 | Bacteria | 3968 |
| 282 | Ga0207667_10007145 | 3300025949 | Bacteria | 13481 |
| 283 | Ga0207667_10046979 | 3300025949 | Bacteria | 4571 |
| 284 | Ga0207651_10002520 | 3300025960 | Bacteria | 8743 |
| 285 | Ga0207651_10037823 | 3300025960 | Bacteria | 3165 |
| 286 | Ga0207712_10001184 | 3300025961 | Bacteria | 18048 |
| 287 | Ga0207712_10001895 | 3300025961 | Bacteria | 13750 |
| 288 | Ga0207712_10002022 | 3300025961 | Bacteria | 13312 |
| 289 | Ga0207712_10013652 | 3300025961 | Bacteria | 5208 |
| 290 | Ga0207712_10032837 | 3300025961 | Bacteria | 3505 |
| 291 | Ga0207668_10011546 | 3300025972 | Bacteria | 5372 |
| 292 | Ga0207658_10001366 | 3300025986 | Bacteria | 19064 |
| 293 | Ga0207658_10018309 | 3300025986 | Bacteria | 4836 |
| 294 | Ga0207658_10113251 | 3300025986 | Bacteria | 2149 |
| 295 | Ga0207677_10000862 | 3300026023 | Bacteria | 17343 |
| 296 | Ga0207677_10072504 | 3300026023 | Bacteria | 2434 |
| 297 | Ga0207703_10000883 | 3300026035 | Bacteria | 29482 |
| 298 | Ga0207703_10031664 | 3300026035 | Bacteria | 4184 |
| 299 | Ga0207639_10001017 | 3300026041 | Bacteria | 19080 |
| 300 | Ga0207639_10015986 | 3300026041 | Bacteria | 5300 |
| 301 | Ga0207639_10077960 | 3300026041 | Bacteria | 2614 |
| 302 | Ga0207641_10000159 | 3300026088 | Bacteria | 96072 |
| 303 | Ga0207641_10000467 | 3300026088 | Bacteria | 45772 |
| 304 | Ga0207641_10006669 | 3300026088 | Bacteria | 9691 |
| 305 | Ga0207641_10020159 | 3300026088 | Bacteria | 5474 |
| 306 | Ga0207641_10024328 | 3300026088 | Bacteria | 4991 |
| 307 | Ga0207641_10061387 | 3300026088 | Bacteria | 3206 |
| 308 | Ga0207648_10007945 | 3300026089 | Bacteria | 10346 |
| 309 | Ga0207648_10012083 | 3300026089 | Bacteria | 8099 |
| 310 | Ga0207648_10056701 | 3300026089 | Bacteria | 3418 |
| 311 | Ga0207648_10074293 | 3300026089 | Bacteria | 2963 |
| 312 | Ga0207648_10079703 | 3300026089 | Bacteria | 2857 |
| 313 | Ga0207676_10001829 | 3300026095 | Bacteria | 15586 |
| 314 | Ga0207676_10003634 | 3300026095 | Bacteria | 10911 |
| 315 | Ga0207674_10002103 | 3300026116 | Bacteria | 25211 |
| 316 | Ga0207674_10004065 | 3300026116 | Bacteria | 17727 |
| 317 | Ga0207674_10012180 | 3300026116 | Bacteria | 9626 |
| 318 | Ga0207674_10040174 | 3300026116 | Bacteria | 4848 |
| 319 | Ga0207674_10090457 | 3300026116 | Bacteria | 3052 |
| 320 | Ga0207674_10106505 | 3300026116 | Bacteria | 2781 |
| 321 | Ga0207674_10112775 | 3300026116 | Bacteria | 2692 |
| 322 | Ga0207675_100005907 | 3300026118 | Bacteria | 11682 |
| 323 | Ga0207675_100019140 | 3300026118 | Bacteria | 6390 |
| 324 | Ga0207675_100023999 | 3300026118 | Bacteria | 5669 |
| 325 | Ga0207675_100027055 | 3300026118 | Bacteria | 5340 |
| 326 | Ga0207683_10011591 | 3300026121 | Bacteria | 7527 |
| 327 | Ga0207698_10007436 | 3300026142 | Bacteria | 6859 |
| 328 | Ga0207698_10010804 | 3300026142 | Bacteria | 5890 |
| 329 | Ga0207698_10066546 | 3300026142 | Bacteria | 2837 |
| 330 | Ga0207698_10073167 | 3300026142 | Bacteria | 2728 |
| 331 | Ga0209281_1000001 | 3300027111 | Bacteria | 1933496 |
| 332 | Ga0209281_1001594 | 3300027111 | Bacteria | 12274 |
| 333 | Ga0209281_1003420 | 3300027111 | Bacteria | 5260 |
| 334 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 335 | Ga0209371_1005217 | 3300027312 | Bacteria | 5255 |
| 336 | Ga0268266_10000022 | 3300028379 | Bacteria | 508060 |
| 337 | Ga0268266_10000084 | 3300028379 | Bacteria | 201874 |
| 338 | Ga0268266_10003931 | 3300028379 | Bacteria | 14446 |
| 339 | Ga0268264_10000082 | 3300028381 | Bacteria | 246913 |
| 340 | Ga0268264_10004522 | 3300028381 | Bacteria | 11860 |
| 341 | Ga0268264_10004873 | 3300028381 | Bacteria | 11372 |
| 342 | Ga0268264_10019816 | 3300028381 | Bacteria | 5496 |
| 343 | Ga0268264_10021296 | 3300028381 | Bacteria | 5296 |
| 344 | Ga0265318_10013047 | 3300028577 | Bacteria | 3522 |
| 345 | Ga0307517_10005192 | 3300028786 | Bacteria | 19741 |
| 346 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 347 | Ga0307515_10000021 | 3300028794 | Bacteria | 406008 |
| 348 | Ga0307515_10011199 | 3300028794 | Bacteria | 17050 |
| 349 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 350 | Ga0268256_1005087 | 3300030500 | Bacteria | 5255 |
| 351 | Ga0307511_10000027 | 3300030521 | Bacteria | 109500 |
| 352 | Ga0316176_1063677 | 3300030732 | Bacteria | 21616 |
| 353 | Ga0316176_1065190 | 3300030732 | Bacteria | 30397 |
| 354 | Ga0316183_1041279 | 3300030742 | Bacteria | 41122 |
| 355 | Ga0316183_1201626 | 3300030742 | Bacteria | 37918 |
| 356 | Ga0316181_1239604 | 3300030744 | Bacteria | 5996 |
| 357 | Ga0316181_1276674 | 3300030744 | Bacteria | 2307 |
| 358 | Ga0265327_10000013 | 3300031251 | Bacteria | 519549 |
| 359 | Ga0307516_10000869 | 3300031730 | Bacteria | 41512 |
| 360 | Ga0307407_10000007 | 3300031903 | Bacteria | 210716 |
| 361 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 362 | Ga0307416_100000015 | 3300032002 | Bacteria | 210716 |
| 363 | Ga0307414_10009961 | 3300032004 | Bacteria | 5486 |
| 364 | Ga0373955_0018193 | 3300035172 | Bacteria | 3491 |
| 365 | Ga0316574_0053066 | 3300035398 | Bacteria | 2530 |
| 366 | Ga0373937_0000626 | 3300036401 | Bacteria | 31047 |
| 367 | Ga0373937_0011023 | 3300036401 | Bacteria | 7925 |
| 368 | Ga0395899_0000006 | 3300037312 | Bacteria | 666341 |
| 369 | Ga0395900_0034792 | 3300037418 | Bacteria | 5189 |
| 370 | Ga0395900_0094830 | 3300037418 | Bacteria | 3066 |
| 371 | Ga0395905_0000227 | 3300037471 | Bacteria | 85540 |
| 372 | Ga0395905_0002345 | 3300037471 | Bacteria | 21118 |
| 373 | Ga0395901_0000598 | 3300038443 | Bacteria | 42043 |
| 374 | Ga0436365_1886446 | 3300039437 | Bacteria | 15773 |
| 375 | Ga0439438_002353 | 3300041405 | Bacteria | 8066 |
| 376 | Ga0439432_004403 | 3300042006 | Bacteria | 5145 |
| 377 | Ga0439452_000033 | 3300042010 | Bacteria | 178345 |
| 378 | Ga0439452_000380 | 3300042010 | Bacteria | 26638 |
| 379 | Ga0439457_005713 | 3300042014 | Bacteria | 3095 |
| 380 | Ga0450898_001793 | 3300042134 | Bacteria | 2891 |
| 381 | Ga0466972_0002481 | 3300044658 | Bacteria | 9128 |
| 382 | Ga0466981_0000055 | 3300044669 | Bacteria | 29078 |
| 383 | Ga0453684_0000549 | 3300044712 | Bacteria | 141927 |
| 384 | Ga0453684_0028623 | 3300044712 | Bacteria | 7943 |
| 385 | Ga0453684_0030869 | 3300044712 | Bacteria | 7555 |
| 386 | Ga0453684_0032612 | 3300044712 | Bacteria | 7285 |
| 387 | Ga0466960_0034244 | 3300044901 | Bacteria | 2366 |
| 388 | Ga0495629_0053928 | 3300046459 | Bacteria | 2812 |
| 389 | Ga0495650_0000205 | 3300046471 | Bacteria | 128197 |
| 390 | Ga0495608_0011961 | 3300046511 | Bacteria | 6037 |
| 391 | Ga0495630_0031080 | 3300046517 | Bacteria | 3974 |
| 392 | Ga0495648_0000879 | 3300046524 | Bacteria | 31662 |
| 393 | Ga0495587_0024372 | 3300046536 | Bacteria | 3709 |
| 394 | Ga0495633_0000025 | 3300046558 | Bacteria | 218627 |
| 395 | Ga0495668_0000114 | 3300046616 | Bacteria | 127503 |
| 396 | Ga0495668_0003434 | 3300046616 | Bacteria | 11874 |
| 397 | Ga0495634_0047864 | 3300046642 | Bacteria | 2880 |
| 398 | Ga0495635_0027872 | 3300046663 | Bacteria | 3928 |
| 399 | Ga0495658_0001473 | 3300046683 | Bacteria | 12392 |
| 400 | Ga0495670_0043141 | 3300046691 | Bacteria | 2251 |
| 401 | Ga0495600_0054098 | 3300046809 | Bacteria | 2622 |
| 402 | Ga0495604_0046806 | 3300047317 | Bacteria | 3372 |
| 403 | Ga0495687_000179 | 3300047443 | Bacteria | 92387 |
| 404 | Ga0496100_0074591 | 3300048903 | Bacteria | 2273 |
| 405 | Ga0496101_0024430 | 3300048904 | Bacteria | 4183 |
| 406 | Ga0496104_0000828 | 3300048907 | Bacteria | 26653 |
| 407 | Ga0496110_0032160 | 3300048913 | Bacteria | 4529 |
| 408 | Ga0496116_0005691 | 3300048919 | Bacteria | 11463 |
| 409 | Ga0496118_0013170 | 3300048921 | Bacteria | 7847 |
| 410 | Ga0496119_0034164 | 3300048922 | Bacteria | 3355 |
| 411 | Ga0496120_0005022 | 3300048923 | Bacteria | 10730 |
| 412 | Ga0496120_0018354 | 3300048923 | Bacteria | 4511 |
| 413 | Ga0496121_0000008 | 3300048924 | Bacteria | 843593 |
| 414 | Ga0496121_0009129 | 3300048924 | Bacteria | 11472 |
| 415 | Ga0496121_0012828 | 3300048924 | Bacteria | 9070 |
| 416 | Ga0496122_0000925 | 3300048925 | Bacteria | 53549 |
| 417 | Ga0496122_0006031 | 3300048925 | Bacteria | 14135 |
| 418 | Ga0496123_0001642 | 3300048926 | Bacteria | 30044 |
| 419 | Ga0496123_0003026 | 3300048926 | Bacteria | 19380 |
| 420 | Ga0496123_0056342 | 3300048926 | Bacteria | 2569 |
| 421 | Ga0496124_0007790 | 3300048927 | Bacteria | 11311 |
| 422 | Ga0496125_0038841 | 3300048928 | Bacteria | 4110 |
| 423 | Ga0496126_0022154 | 3300048929 | Bacteria | 6189 |
| 424 | Ga0496126_0059586 | 3300048929 | Bacteria | 3437 |
| 425 | Ga0501292_002171 | 3300049515 | Bacteria | 2502 |
| 426 | Ga0501298_000863 | 3300049521 | Bacteria | 4287 |
| 427 | Ga0501031_0009981 | 3300049568 | Bacteria | 6184 |
| 428 | Ga0501031_0013524 | 3300049568 | Bacteria | 5319 |
| 429 | Ga0501032_0027679 | 3300049569 | Bacteria | 3896 |
| 430 | Ga0501032_0030466 | 3300049569 | Bacteria | 3702 |
| 431 | Ga0501032_0039394 | 3300049569 | Bacteria | 3215 |
| 432 | Ga0501033_0000085 | 3300049570 | Bacteria | 88350 |
| 433 | Ga0501034_0000308 | 3300049571 | Bacteria | 86738 |
| 434 | Ga0501034_0010456 | 3300049571 | Bacteria | 9664 |
| 435 | Ga0501034_0029202 | 3300049571 | Bacteria | 5605 |
| 436 | Ga0501036_0014936 | 3300049572 | Bacteria | 6478 |
| 437 | Ga0501037_0000824 | 3300049573 | Bacteria | 23171 |
| 438 | Ga0501038_0001133 | 3300049574 | Bacteria | 24176 |
| 439 | Ga0501038_0010673 | 3300049574 | Bacteria | 8401 |
| 440 | Ga0501038_0052433 | 3300049574 | Bacteria | 3517 |
| 441 | Ga0501039_0010696 | 3300049575 | Bacteria | 6990 |
| 442 | Ga0501039_0023254 | 3300049575 | Bacteria | 4756 |
| 443 | Ga0501039_0027566 | 3300049575 | Bacteria | 4368 |
| 444 | Ga0501043_0014571 | 3300049579 | Bacteria | 6156 |
| 445 | Ga0501043_0033508 | 3300049579 | Bacteria | 4041 |
| 446 | Ga0501046_0032390 | 3300049580 | Bacteria | 4232 |
| 447 | Ga0501046_0036206 | 3300049580 | Bacteria | 3974 |
| 448 | Ga0501047_0059765 | 3300049581 | Bacteria | 3680 |
| 449 | Ga0501048_0033057 | 3300049582 | Bacteria | 3738 |
| 450 | Ga0501198_000680 | 3300049649 | Bacteria | 4222 |
| 451 | Ga0501201_000009 | 3300049651 | Bacteria | 11297 |
| 452 | Ga0501202_000340 | 3300049652 | Bacteria | 6517 |
| 453 | Ga0501206_000111 | 3300049653 | Bacteria | 8446 |
| 454 | Ga0501207_000455 | 3300049654 | Bacteria | 4577 |
| 455 | Ga0501223_001079 | 3300049663 | Bacteria | 6434 |
| 456 | Ga0501224_000138 | 3300049664 | Bacteria | 8030 |
| 457 | Ga0501252_000040 | 3300049682 | Bacteria | 6796 |
| 458 | Ga0501259_000120 | 3300049688 | Bacteria | 11437 |
| 459 | Ga0501261_000469 | 3300049690 | Bacteria | 5196 |
| 460 | Ga0501221_000038 | 3300049704 | Bacteria | 12982 |
| 461 | Ga0501225_0003204 | 3300049705 | Bacteria | 4998 |
| 462 | Ga0501234_001449 | 3300049707 | Bacteria | 3725 |
| 463 | Ga0501245_000227 | 3300049708 | Bacteria | 6347 |
| 464 | Ga0501080_0115354 | 3300049742 | Bacteria | 2490 |
| 465 | Ga0501083_0001228 | 3300049744 | Bacteria | 17354 |
| 466 | Ga0501083_0021960 | 3300049744 | Bacteria | 4431 |
| 467 | Ga0501035_0001789 | 3300049822 | Bacteria | 21715 |
| 468 | Ga0501035_0005656 | 3300049822 | Bacteria | 11799 |
| 469 | Ga0501035_0052851 | 3300049822 | Bacteria | 3635 |
| 470 | Ga0501044_0000180 | 3300049823 | Bacteria | 78387 |
| 471 | Ga0501044_0006371 | 3300049823 | Bacteria | 13046 |
| 472 | Ga0501044_0008422 | 3300049823 | Bacteria | 11308 |
| 473 | Ga0501044_0052468 | 3300049823 | Bacteria | 4202 |
| 474 | Ga0501045_0005140 | 3300049824 | Bacteria | 9061 |
| 475 | nmdc:mga0k408_896_c1 | 3300050493 | Bacteria | 16294 |
| 476 | nmdc:mga05p37_137619_c1 | 3300050507 | Bacteria | 2993 |
| 477 | nmdc:mga06r32_35892_c1 | 3300050510 | Bacteria | 4679 |
| 478 | nmdc:mga08y16_177019_c1 | 3300050511 | Bacteria | 2215 |
| 479 | Ga0500644_0000094 | 3300053088 | Bacteria | 55669 |
| 480 | Ga0500651_0000128 | 3300053093 | Bacteria | 46966 |
| 481 | Ga0500569_000197 | 3300053109 | Bacteria | 9577 |
| 482 | Ga0500658_0001922 | 3300053134 | Bacteria | 8130 |
| 483 | Ga0500559_0003519 | 3300053136 | Bacteria | 7669 |
| 484 | Ga0500568_0002133 | 3300053139 | Bacteria | 11937 |
| 485 | Ga0500568_0011709 | 3300053139 | Bacteria | 4055 |
| 486 | Ga0500622_0000161 | 3300053156 | Bacteria | 70719 |
| 487 | Ga0500622_0002778 | 3300053156 | Bacteria | 12307 |
| 488 | Ga0500633_0001095 | 3300053160 | Bacteria | 4867 |
| 489 | Ga0500611_000061 | 3300053727 | Bacteria | 45387 |
| 490 | Ga0501082_0030413 | 3300060353 | Bacteria | 4653 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025986 | Ga0207658_10113251 | Ga0207658_101132512 | 535 |
| 2 | 3300009036 | Ga0105244_10000105 | Ga0105244_1000010564 | 578 |
| 3 | 3300025728 | Ga0207655_1000226 | Ga0207655_100022663 | 578 |
| 4 | 3300050511 | nmdc:mga08y16_177019_c1 | nmdc:mga08y16_177019_c1_357_2201 | 583 |
| 5 | 2162886007 | SwRhRL2b_contig_3612275 | SwRhRL2b_0185.00001840 | 584 |
| 6 | 3300003320 | rootH2_10015620 | rootH2_1001562011 | 584 |
| 7 | 3300005289 | Ga0065704_10000373 | Ga0065704_1000037316 | 584 |
| 8 | 3300005548 | Ga0070665_100001635 | Ga0070665_10000163517 | 584 |
| 9 | 3300005577 | Ga0068857_100000003 | Ga0068857_100000003150 | 584 |
| 10 | 3300006946 | Ga0079104_1005234 | Ga0079104_10052343 | 584 |
| 11 | 3300006946 | Ga0079104_1006425 | Ga0079104_10064254 | 584 |
| 12 | 3300006946 | Ga0079104_1007032 | Ga0079104_10070323 | 584 |
| 13 | 3300009011 | Ga0105251_10013195 | Ga0105251_100131951 | 584 |
| 14 | 3300009093 | Ga0105240_10087392 | Ga0105240_100873924 | 584 |
| 15 | 3300013100 | Ga0157373_10061402 | Ga0157373_100614022 | 584 |
| 16 | 3300013102 | Ga0157371_10025845 | Ga0157371_100258452 | 584 |
| 17 | 3300013104 | Ga0157370_10027824 | Ga0157370_100278243 | 584 |
| 18 | 3300015679 | Ga0183366_1001 | Ga0183366_1001164 | 584 |
| 19 | 3300015680 | Ga0183370_1001 | Ga0183370_1001164 | 584 |
| 20 | 3300015685 | Ga0183369_1001 | Ga0183369_1001164 | 584 |
| 21 | 3300015687 | Ga0183368_1001 | Ga0183368_1001164 | 584 |
| 22 | 3300025728 | Ga0207655_1000087 | Ga0207655_1000087131 | 584 |
| 23 | 3300025728 | Ga0207655_1003596 | Ga0207655_10035964 | 584 |
| 24 | 3300025735 | Ga0207713_1000021 | Ga0207713_1000021328 | 584 |
| 25 | 3300026116 | Ga0207674_10002103 | Ga0207674_1000210317 | 584 |
| 26 | 3300027111 | Ga0209281_1001594 | Ga0209281_10015949 | 584 |
| 27 | 3300027111 | Ga0209281_1003420 | Ga0209281_10034203 | 584 |
| 28 | 3300027312 | Ga0209371_1000001 | Ga0209371_1000001120 | 584 |
| 29 | 3300027312 | Ga0209371_1005217 | Ga0209371_10052173 | 584 |
| 30 | 3300028379 | Ga0268266_10000084 | Ga0268266_10000084193 | 584 |
| 31 | 3300030500 | Ga0268256_1000001 | Ga0268256_10000012521 | 584 |
| 32 | 3300030500 | Ga0268256_1005087 | Ga0268256_10050873 | 584 |
| 33 | 3300041405 | Ga0439438_002353 | Ga0439438_002353_4367_6229 | 584 |
| 34 | 3300042006 | Ga0439432_004403 | Ga0439432_004403_645_2507 | 584 |
| 35 | 3300042010 | Ga0439452_000033 | Ga0439452_000033_3177_5039 | 584 |
| 36 | 3300042010 | Ga0439452_000380 | Ga0439452_000380_22710_24572 | 584 |
| 37 | 3300044669 | Ga0466981_0000055 | Ga0466981_0000055_11729_13591 | 584 |
| 38 | 3300046471 | Ga0495650_0000205 | Ga0495650_0000205_115084_116946 | 584 |
| 39 | 3300048907 | Ga0496104_0000828 | Ga0496104_0000828_7614_9476 | 584 |
| 40 | 3300048919 | Ga0496116_0005691 | Ga0496116_0005691_2513_4375 | 584 |
| 41 | 3300048921 | Ga0496118_0013170 | Ga0496118_0013170_4189_6051 | 584 |
| 42 | 3300048922 | Ga0496119_0034164 | Ga0496119_0034164_408_2270 | 584 |
| 43 | 3300048923 | Ga0496120_0005022 | Ga0496120_0005022_8719_10581 | 584 |
| 44 | 3300048923 | Ga0496120_0018354 | Ga0496120_0018354_224_2086 | 584 |
| 45 | 3300048924 | Ga0496121_0009129 | Ga0496121_0009129_2694_4556 | 584 |
| 46 | 3300048924 | Ga0496121_0012828 | Ga0496121_0012828_122_1984 | 584 |
| 47 | 3300048925 | Ga0496122_0000925 | Ga0496122_0000925_2514_4376 | 584 |
| 48 | 3300048926 | Ga0496123_0003026 | Ga0496123_0003026_15005_16867 | 584 |
| 49 | 3300048926 | Ga0496123_0056342 | Ga0496123_0056342_644_2506 | 584 |
| 50 | 3300048927 | Ga0496124_0007790 | Ga0496124_0007790_2458_4320 | 584 |
| 51 | 3300048928 | Ga0496125_0038841 | Ga0496125_0038841_2069_3931 | 584 |
| 52 | 3300048929 | Ga0496126_0059586 | Ga0496126_0059586_114_1976 | 584 |
| 53 | 3300006946 | Ga0079104_1000166 | Ga0079104_100016625 | 590 |
| 54 | 3300027111 | Ga0209281_1000001 | Ga0209281_10000011721 | 590 |
| 55 | 3300005329 | Ga0070683_100155313 | Ga0070683_1001553131 | 611 |
| 56 | 3300025933 | Ga0207706_10114797 | Ga0207706_101147971 | 611 |
| 57 | 3300049581 | Ga0501047_0059765 | Ga0501047_0059765_1356_3224 | 611 |
| 58 | 3300049822 | Ga0501035_0052851 | Ga0501035_0052851_56_1924 | 611 |
| 59 | 3300049823 | Ga0501044_0052468 | Ga0501044_0052468_559_2427 | 611 |
| 60 | 3300005354 | Ga0070675_100022678 | Ga0070675_1000226783 | 612 |
| 61 | 3300025926 | Ga0207659_10026799 | Ga0207659_100267993 | 612 |
| 62 | 3300006844 | Ga0075428_100011475 | Ga0075428_1000114753 | 614 |
| 63 | 3300050510 | nmdc:mga06r32_35892_c1 | nmdc:mga06r32_35892_c1_1870_3804 | 614 |
| 64 | 3300025942 | Ga0207689_10006615 | Ga0207689_100066155 | 617 |
| 65 | 3300025961 | Ga0207712_10001895 | Ga0207712_100018955 | 617 |
| 66 | 3300026116 | Ga0207674_10112775 | Ga0207674_101127752 | 617 |
| 67 | 3300026118 | Ga0207675_100027055 | Ga0207675_1000270553 | 617 |
| 68 | 3300009553 | Ga0105249_10008479 | Ga0105249_100084797 | 618 |
| 69 | 3300039437 | Ga0436365_1886446 | Ga0436365_1886446_2134_4059 | 618 |
| 70 | 3300013296 | Ga0157374_10005427 | Ga0157374_100054275 | 620 |
| 71 | 3300050507 | nmdc:mga05p37_137619_c1 | nmdc:mga05p37_137619_c1_26_1963 | 620 |
| 72 | 3300025920 | Ga0207649_10001758 | Ga0207649_100017587 | 621 |
| 73 | 3300026116 | Ga0207674_10106505 | Ga0207674_101065052 | 624 |
| 74 | 3300035398 | Ga0316574_0053066 | Ga0316574_0053066_237_2144 | 625 |
| 75 | iso_pu_bacteria | 2522125168 | 2522553730 | 625 |
| 76 | iso_pu_bacteria | 2839989709 | 2839990212 | 625 |
| 77 | iso_pu_bacteria | 2910245624 | 2910249642 | 625 |
| 78 | iso_pu_bacteria | 2818991460 | 2819677290 | 626 |
| 79 | iso_pu_bacteria | 2911138879 | 2911139388 | 626 |
| 80 | iso_pu_bacteria | 2929177148 | 2929177303 | 626 |
| 81 | iso_pu_bacteria | 2929921140 | 2929921390 | 626 |
| 82 | iso_pu_bacteria | 2945977869 | 2945979669 | 626 |
| 83 | iso_pu_bacteria | 2946013367 | 2946014464 | 626 |
| 84 | iso_pu_bacteria | 8003151029 | 8003157570 | 626 |
| 85 | 3300044712 | Ga0453684_0032612 | Ga0453684_0032612_1287_3203 | 627 |
| 86 | iso_pu_bacteria | 2818991442 | 2819575299 | 627 |
| 87 | iso_pu_bacteria | 2821136567 | 2821141399 | 627 |
| 88 | iso_pu_bacteria | 2840677318 | 2840679132 | 627 |
| 89 | iso_pu_bacteria | 2883068021 | 2883070198 | 627 |
| 90 | iso_pu_bacteria | 2896085136 | 2896086943 | 627 |
| 91 | iso_pu_bacteria | 2896109856 | 2896115743 | 627 |
| 92 | iso_pu_bacteria | 2904467357 | 2904470996 | 627 |
| 93 | 3300005843 | Ga0068860_100162265 | Ga0068860_1001622651 | 628 |
| 94 | 3300044712 | Ga0453684_0000549 | Ga0453684_0000549_110239_112155 | 628 |
| 95 | 3300049569 | Ga0501032_0039394 | Ga0501032_0039394_132_2051 | 628 |
| 96 | 3300005337 | Ga0070682_100000259 | Ga0070682_10000025930 | 629 |
| 97 | 3300013306 | Ga0163162_10000244 | Ga0163162_1000024410 | 629 |
| 98 | 3300013306 | Ga0163162_10001632 | Ga0163162_100016328 | 629 |
| 99 | 3300013308 | Ga0157375_10017905 | Ga0157375_100179053 | 629 |
| 100 | 3300028577 | Ga0265318_10013047 | Ga0265318_100130472 | 629 |
| 101 | 3300036401 | Ga0373937_0011023 | Ga0373937_0011023_4913_6835 | 629 |
| 102 | iso_pu_bacteria | 2738541284 | 2738763191 | 629 |
| 103 | iso_pu_bacteria | 2739367866 | 2740031592 | 629 |
| 104 | iso_pu_bacteria | 2842903701 | 2842905398 | 629 |
| 105 | iso_pu_bacteria | 2842903701 | 2842909510 | 629 |
| 106 | iso_pu_bacteria | 2852627209 | 2852629732 | 629 |
| 107 | iso_pu_bacteria | 2898713307 | 2898714629 | 629 |
| 108 | 3300001979 | JGI24740J21852_10002493 | JGI24740J21852_100024937 | 630 |
| 109 | 3300002738 | JGI25154J39366_1000006 | JGI25154J39366_100000630 | 630 |
| 110 | 3300003215 | JGI25153J46596_10004282 | JGI25153J46596_100042826 | 630 |
| 111 | 3300003322 | rootL2_10014283 | rootL2_1001428310 | 630 |
| 112 | 3300003761 | Ga0055535_1001754 | Ga0055535_10017548 | 630 |
| 113 | 3300003794 | Ga0055531_10000005 | Ga0055531_1000000514 | 630 |
| 114 | 3300005290 | Ga0065712_10068022 | Ga0065712_1006802216 | 630 |
| 115 | 3300005327 | Ga0070658_10000515 | Ga0070658_1000051517 | 630 |
| 116 | 3300005328 | Ga0070676_10000341 | Ga0070676_1000034114 | 630 |
| 117 | 3300005334 | Ga0068869_100032646 | Ga0068869_1000326463 | 630 |
| 118 | 3300005335 | Ga0070666_10000172 | Ga0070666_100001722 | 630 |
| 119 | 3300005336 | Ga0070680_100001715 | Ga0070680_10000171513 | 630 |
| 120 | 3300005337 | Ga0070682_100004034 | Ga0070682_1000040348 | 630 |
| 121 | 3300005338 | Ga0068868_100001522 | Ga0068868_1000015224 | 630 |
| 122 | 3300005341 | Ga0070691_10000875 | Ga0070691_100008759 | 630 |
| 123 | 3300005347 | Ga0070668_100000169 | Ga0070668_10000016928 | 630 |
| 124 | 3300005364 | Ga0070673_100000813 | Ga0070673_1000008136 | 630 |
| 125 | 3300005367 | Ga0070667_100000553 | Ga0070667_1000005536 | 630 |
| 126 | 3300005457 | Ga0070662_100002884 | Ga0070662_1000028848 | 630 |
| 127 | 3300005458 | Ga0070681_10057386 | Ga0070681_100573861 | 630 |
| 128 | 3300005459 | Ga0068867_100001171 | Ga0068867_1000011712 | 630 |
| 129 | 3300005530 | Ga0070679_100015506 | Ga0070679_1000155062 | 630 |
| 130 | 3300005539 | Ga0068853_100000272 | Ga0068853_10000027210 | 630 |
| 131 | 3300005539 | Ga0068853_100013077 | Ga0068853_1000130776 | 630 |
| 132 | 3300005539 | Ga0068853_100058737 | Ga0068853_1000587372 | 630 |
| 133 | 3300005543 | Ga0070672_100000061 | Ga0070672_10000006117 | 630 |
| 134 | 3300005548 | Ga0070665_100000612 | Ga0070665_1000006127 | 630 |
| 135 | 3300005563 | Ga0068855_100010495 | Ga0068855_1000104952 | 630 |
| 136 | 3300005564 | Ga0070664_100039019 | Ga0070664_1000390192 | 630 |
| 137 | 3300005616 | Ga0068852_100022230 | Ga0068852_1000222302 | 630 |
| 138 | 3300005617 | Ga0068859_100006881 | Ga0068859_1000068817 | 630 |
| 139 | 3300005618 | Ga0068864_100004846 | Ga0068864_1000048466 | 630 |
| 140 | 3300005841 | Ga0068863_100001273 | Ga0068863_10000127317 | 630 |
| 141 | 3300005842 | Ga0068858_100000930 | Ga0068858_10000093013 | 630 |
| 142 | 3300006237 | Ga0097621_100000821 | Ga0097621_1000008217 | 630 |
| 143 | 3300006358 | Ga0068871_100016561 | Ga0068871_1000165613 | 630 |
| 144 | 3300006881 | Ga0068865_100003524 | Ga0068865_1000035247 | 630 |
| 145 | 3300006931 | Ga0097620_100006881 | Ga0097620_1000068817 | 630 |
| 146 | 3300009093 | Ga0105240_10067456 | Ga0105240_100674562 | 630 |
| 147 | 3300009174 | Ga0105241_10009515 | Ga0105241_100095153 | 630 |
| 148 | 3300009177 | Ga0105248_10016765 | Ga0105248_100167654 | 630 |
| 149 | 3300009553 | Ga0105249_10001226 | Ga0105249_1000122611 | 630 |
| 150 | 3300013104 | Ga0157370_10009908 | Ga0157370_100099082 | 630 |
| 151 | 3300013296 | Ga0157374_10002119 | Ga0157374_100021197 | 630 |
| 152 | 3300013306 | Ga0163162_10000752 | Ga0163162_1000075212 | 630 |
| 153 | 3300013308 | Ga0157375_10000098 | Ga0157375_1000009875 | 630 |
| 154 | 3300014325 | Ga0163163_10000272 | Ga0163163_1000027216 | 630 |
| 155 | 3300014325 | Ga0163163_10113661 | Ga0163163_101136612 | 630 |
| 156 | 3300014326 | Ga0157380_10000602 | Ga0157380_100006025 | 630 |
| 157 | 3300014968 | Ga0157379_10000103 | Ga0157379_1000010317 | 630 |
| 158 | 3300025208 | Ga0209436_101519 | Ga0209436_1015195 | 630 |
| 159 | 3300025242 | Ga0209258_100029 | Ga0209258_100029247 | 630 |
| 160 | 3300025246 | Ga0209646_1000031 | Ga0209646_100003164 | 630 |
| 161 | 3300025250 | Ga0209026_1000019 | Ga0209026_100001964 | 630 |
| 162 | 3300025254 | Ga0209148_1000089 | Ga0209148_1000089155 | 630 |
| 163 | 3300025284 | Ga0209130_1002000 | Ga0209130_100200010 | 630 |
| 164 | 3300025297 | Ga0209758_1018212 | Ga0209758_10182122 | 630 |
| 165 | 3300025302 | Ga0207426_1000263 | Ga0207426_100026367 | 630 |
| 166 | 3300025302 | Ga0207426_1000513 | Ga0207426_100051321 | 630 |
| 167 | 3300025304 | Ga0209257_1000004 | Ga0209257_1000004394 | 630 |
| 168 | 3300025903 | Ga0207680_10001345 | Ga0207680_100013457 | 630 |
| 169 | 3300025907 | Ga0207645_10000793 | Ga0207645_1000079317 | 630 |
| 170 | 3300025909 | Ga0207705_10005062 | Ga0207705_100050627 | 630 |
| 171 | 3300025911 | Ga0207654_10001001 | Ga0207654_1000100113 | 630 |
| 172 | 3300025912 | Ga0207707_10000160 | Ga0207707_1000016028 | 630 |
| 173 | 3300025913 | Ga0207695_10002404 | Ga0207695_100024047 | 630 |
| 174 | 3300025917 | Ga0207660_10073788 | Ga0207660_100737881 | 630 |
| 175 | 3300025921 | Ga0207652_10000406 | Ga0207652_100004063 | 630 |
| 176 | 3300025933 | Ga0207706_10006661 | Ga0207706_100066618 | 630 |
| 177 | 3300025938 | Ga0207704_10004460 | Ga0207704_100044604 | 630 |
| 178 | 3300025940 | Ga0207691_10000154 | Ga0207691_1000015441 | 630 |
| 179 | 3300025941 | Ga0207711_10026152 | Ga0207711_100261522 | 630 |
| 180 | 3300025942 | Ga0207689_10029427 | Ga0207689_100294274 | 630 |
| 181 | 3300025945 | Ga0207679_10026961 | Ga0207679_100269613 | 630 |
| 182 | 3300025949 | Ga0207667_10046979 | Ga0207667_100469794 | 630 |
| 183 | 3300025960 | Ga0207651_10002520 | Ga0207651_100025204 | 630 |
| 184 | 3300025961 | Ga0207712_10013652 | Ga0207712_100136523 | 630 |
| 185 | 3300025972 | Ga0207668_10011546 | Ga0207668_100115465 | 630 |
| 186 | 3300025986 | Ga0207658_10001366 | Ga0207658_1000136611 | 630 |
| 187 | 3300026023 | Ga0207677_10000862 | Ga0207677_1000086214 | 630 |
| 188 | 3300026035 | Ga0207703_10000883 | Ga0207703_1000088320 | 630 |
| 189 | 3300026041 | Ga0207639_10001017 | Ga0207639_1000101714 | 630 |
| 190 | 3300026041 | Ga0207639_10077960 | Ga0207639_100779601 | 630 |
| 191 | 3300026088 | Ga0207641_10006669 | Ga0207641_100066694 | 630 |
| 192 | 3300026089 | Ga0207648_10079703 | Ga0207648_100797032 | 630 |
| 193 | 3300026095 | Ga0207676_10003634 | Ga0207676_100036346 | 630 |
| 194 | 3300026142 | Ga0207698_10010804 | Ga0207698_100108042 | 630 |
| 195 | 3300028379 | Ga0268266_10003931 | Ga0268266_100039317 | 630 |
| 196 | 3300028381 | Ga0268264_10004873 | Ga0268264_100048737 | 630 |
| 197 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012088 | 630 |
| 198 | 3300031251 | Ga0265327_10000013 | Ga0265327_1000001318 | 630 |
| 199 | 3300046558 | Ga0495633_0000025 | Ga0495633_0000025_214965_216890 | 630 |
| 200 | 3300048904 | Ga0496101_0024430 | Ga0496101_0024430_385_2310 | 630 |
| 201 | 3300048929 | Ga0496126_0022154 | Ga0496126_0022154_3903_5828 | 630 |
| 202 | 3300049568 | Ga0501031_0009981 | Ga0501031_0009981_1964_3907 | 630 |
| 203 | 3300049569 | Ga0501032_0030466 | Ga0501032_0030466_714_2657 | 630 |
| 204 | 3300049571 | Ga0501034_0000308 | Ga0501034_0000308_56163_58106 | 630 |
| 205 | 3300049573 | Ga0501037_0000824 | Ga0501037_0000824_18176_20119 | 630 |
| 206 | 3300049574 | Ga0501038_0001133 | Ga0501038_0001133_8697_10640 | 630 |
| 207 | 3300049575 | Ga0501039_0010696 | Ga0501039_0010696_1964_3907 | 630 |
| 208 | 3300049579 | Ga0501043_0014571 | Ga0501043_0014571_1046_2989 | 630 |
| 209 | 3300049744 | Ga0501083_0021960 | Ga0501083_0021960_695_2623 | 630 |
| 210 | 3300049822 | Ga0501035_0005656 | Ga0501035_0005656_2546_4489 | 630 |
| 211 | 3300049823 | Ga0501044_0000180 | Ga0501044_0000180_28468_30411 | 630 |
| 212 | 3300049824 | Ga0501045_0005140 | Ga0501045_0005140_4706_6649 | 630 |
| 213 | 3300053088 | Ga0500644_0000094 | Ga0500644_0000094_27071_28996 | 630 |
| 214 | 3300053109 | Ga0500569_000197 | Ga0500569_000197_1675_3600 | 630 |
| 215 | 3300053134 | Ga0500658_0001922 | Ga0500658_0001922_5054_6979 | 630 |
| 216 | 3300053136 | Ga0500559_0003519 | Ga0500559_0003519_1296_3221 | 630 |
| 217 | 3300053156 | Ga0500622_0000161 | Ga0500622_0000161_37488_39413 | 630 |
| 218 | 3300053160 | Ga0500633_0001095 | Ga0500633_0001095_337_2262 | 630 |
| 219 | 3300001989 | JGI24739J22299_10000408 | JGI24739J22299_100004085 | 631 |
| 220 | 3300003354 | JGI25160J50197_1001309 | JGI25160J50197_10013096 | 631 |
| 221 | 3300003781 | Ga0055536_1005887 | Ga0055536_10058874 | 631 |
| 222 | 3300003791 | Ga0055530_10003528 | Ga0055530_100035285 | 631 |
| 223 | 3300005262 | Ga0065165_1000042 | Ga0065165_100004217 | 631 |
| 224 | 3300005262 | Ga0065165_1000302 | Ga0065165_100030275 | 631 |
| 225 | 3300005289 | Ga0065704_10074597 | Ga0065704_100745975 | 631 |
| 226 | 3300005353 | Ga0070669_100013473 | Ga0070669_1000134731 | 631 |
| 227 | 3300005356 | Ga0070674_100004573 | Ga0070674_1000045733 | 631 |
| 228 | 3300005458 | Ga0070681_10028230 | Ga0070681_100282302 | 631 |
| 229 | 3300005617 | Ga0068859_100014669 | Ga0068859_1000146694 | 631 |
| 230 | 3300005843 | Ga0068860_100007018 | Ga0068860_1000070184 | 631 |
| 231 | 3300006931 | Ga0097620_100014669 | Ga0097620_1000146694 | 631 |
| 232 | 3300013102 | Ga0157371_10024734 | Ga0157371_100247342 | 631 |
| 233 | 3300013306 | Ga0163162_10212902 | Ga0163162_102129021 | 631 |
| 234 | 3300014968 | Ga0157379_10074646 | Ga0157379_100746461 | 631 |
| 235 | 3300015265 | Ga0182005_1000017 | Ga0182005_1000017198 | 631 |
| 236 | 3300025273 | Ga0209673_1000113 | Ga0209673_1000113104 | 631 |
| 237 | 3300025292 | Ga0209676_1004327 | Ga0209676_10043274 | 631 |
| 238 | 3300025297 | Ga0209758_1004657 | Ga0209758_10046578 | 631 |
| 239 | 3300025298 | Ga0209050_1000185 | Ga0209050_1000185111 | 631 |
| 240 | 3300025302 | Ga0207426_1001392 | Ga0207426_10013927 | 631 |
| 241 | 3300025304 | Ga0209257_1000257 | Ga0209257_100025747 | 631 |
| 242 | 3300025900 | Ga0207710_10000417 | Ga0207710_1000041719 | 631 |
| 243 | 3300025912 | Ga0207707_10079021 | Ga0207707_100790212 | 631 |
| 244 | 3300025923 | Ga0207681_10010625 | Ga0207681_100106251 | 631 |
| 245 | 3300026089 | Ga0207648_10074293 | Ga0207648_100742932 | 631 |
| 246 | 3300026116 | Ga0207674_10040174 | Ga0207674_100401743 | 631 |
| 247 | 3300028381 | Ga0268264_10019816 | Ga0268264_100198162 | 631 |
| 248 | 3300035172 | Ga0373955_0018193 | Ga0373955_0018193_1100_3040 | 631 |
| 249 | 3300037418 | Ga0395900_0034792 | Ga0395900_0034792_2738_4666 | 631 |
| 250 | 3300037471 | Ga0395905_0000227 | Ga0395905_0000227_32907_34835 | 631 |
| 251 | 3300046459 | Ga0495629_0053928 | Ga0495629_0053928_535_2475 | 631 |
| 252 | 3300046683 | Ga0495658_0001473 | Ga0495658_0001473_485_2425 | 631 |
| 253 | 3300046691 | Ga0495670_0043141 | Ga0495670_0043141_20_1951 | 631 |
| 254 | 3300048924 | Ga0496121_0000008 | Ga0496121_0000008_30954_32978 | 631 |
| 255 | 3300049570 | Ga0501033_0000085 | Ga0501033_0000085_58150_60096 | 631 |
| 256 | 3300005262 | Ga0065165_1005428 | Ga0065165_10054283 | 632 |
| 257 | 3300005328 | Ga0070676_10019525 | Ga0070676_100195252 | 632 |
| 258 | 3300005329 | Ga0070683_100001831 | Ga0070683_10000183110 | 632 |
| 259 | 3300005329 | Ga0070683_100015612 | Ga0070683_1000156122 | 632 |
| 260 | 3300005333 | Ga0070677_10004350 | Ga0070677_100043503 | 632 |
| 261 | 3300005334 | Ga0068869_100011207 | Ga0068869_1000112075 | 632 |
| 262 | 3300005335 | Ga0070666_10000301 | Ga0070666_1000030129 | 632 |
| 263 | 3300005335 | Ga0070666_10018149 | Ga0070666_100181491 | 632 |
| 264 | 3300005338 | Ga0068868_100007141 | Ga0068868_1000071414 | 632 |
| 265 | 3300005340 | Ga0070689_100045900 | Ga0070689_1000459002 | 632 |
| 266 | 3300005344 | Ga0070661_100000522 | Ga0070661_10000052226 | 632 |
| 267 | 3300005344 | Ga0070661_100009090 | Ga0070661_1000090908 | 632 |
| 268 | 3300005355 | Ga0070671_100008404 | Ga0070671_1000084045 | 632 |
| 269 | 3300005355 | Ga0070671_100015305 | Ga0070671_1000153052 | 632 |
| 270 | 3300005364 | Ga0070673_100012277 | Ga0070673_1000122771 | 632 |
| 271 | 3300005366 | Ga0070659_100008285 | Ga0070659_1000082856 | 632 |
| 272 | 3300005367 | Ga0070667_100003932 | Ga0070667_10000393214 | 632 |
| 273 | 3300005367 | Ga0070667_100057985 | Ga0070667_1000579852 | 632 |
| 274 | 3300005457 | Ga0070662_100052922 | Ga0070662_1000529222 | 632 |
| 275 | 3300005535 | Ga0070684_100001645 | Ga0070684_10000164511 | 632 |
| 276 | 3300005539 | Ga0068853_100004671 | Ga0068853_1000046711 | 632 |
| 277 | 3300005564 | Ga0070664_100000325 | Ga0070664_10000032532 | 632 |
| 278 | 3300005577 | Ga0068857_100004404 | Ga0068857_1000044047 | 632 |
| 279 | 3300005617 | Ga0068859_100000006 | Ga0068859_100000006414 | 632 |
| 280 | 3300005617 | Ga0068859_100014449 | Ga0068859_1000144492 | 632 |
| 281 | 3300005617 | Ga0068859_100056937 | Ga0068859_1000569374 | 632 |
| 282 | 3300005618 | Ga0068864_100014270 | Ga0068864_1000142702 | 632 |
| 283 | 3300005618 | Ga0068864_100025401 | Ga0068864_1000254014 | 632 |
| 284 | 3300005841 | Ga0068863_100052504 | Ga0068863_1000525041 | 632 |
| 285 | 3300005842 | Ga0068858_100004200 | Ga0068858_1000042003 | 632 |
| 286 | 3300005843 | Ga0068860_100001345 | Ga0068860_1000013454 | 632 |
| 287 | 3300006237 | Ga0097621_100000531 | Ga0097621_1000005319 | 632 |
| 288 | 3300006237 | Ga0097621_100004954 | Ga0097621_1000049548 | 632 |
| 289 | 3300006358 | Ga0068871_100000042 | Ga0068871_1000000426 | 632 |
| 290 | 3300006931 | Ga0097620_100000006 | Ga0097620_100000006414 | 632 |
| 291 | 3300006931 | Ga0097620_100014449 | Ga0097620_1000144492 | 632 |
| 292 | 3300006931 | Ga0097620_100056934 | Ga0097620_1000569341 | 632 |
| 293 | 3300009093 | Ga0105240_10000367 | Ga0105240_1000036736 | 632 |
| 294 | 3300009174 | Ga0105241_10000213 | Ga0105241_100002137 | 632 |
| 295 | 3300009174 | Ga0105241_10037679 | Ga0105241_100376792 | 632 |
| 296 | 3300009177 | Ga0105248_10014203 | Ga0105248_100142034 | 632 |
| 297 | 3300009545 | Ga0105237_10013195 | Ga0105237_100131952 | 632 |
| 298 | 3300009545 | Ga0105237_10014498 | Ga0105237_100144985 | 632 |
| 299 | 3300009551 | Ga0105238_10001981 | Ga0105238_1000198117 | 632 |
| 300 | 3300009553 | Ga0105249_10005776 | Ga0105249_100057768 | 632 |
| 301 | 3300009553 | Ga0105249_10058817 | Ga0105249_100588172 | 632 |
| 302 | 3300010375 | Ga0105239_10093265 | Ga0105239_100932651 | 632 |
| 303 | 3300013100 | Ga0157373_10016557 | Ga0157373_100165571 | 632 |
| 304 | 3300013102 | Ga0157371_10013997 | Ga0157371_100139972 | 632 |
| 305 | 3300013296 | Ga0157374_10000013 | Ga0157374_10000013161 | 632 |
| 306 | 3300013296 | Ga0157374_10009778 | Ga0157374_100097789 | 632 |
| 307 | 3300013296 | Ga0157374_10011557 | Ga0157374_100115575 | 632 |
| 308 | 3300013296 | Ga0157374_10022337 | Ga0157374_100223372 | 632 |
| 309 | 3300013297 | Ga0157378_10000859 | Ga0157378_100008594 | 632 |
| 310 | 3300013297 | Ga0157378_10006615 | Ga0157378_100066154 | 632 |
| 311 | 3300013306 | Ga0163162_10001071 | Ga0163162_1000107111 | 632 |
| 312 | 3300013306 | Ga0163162_10001214 | Ga0163162_1000121424 | 632 |
| 313 | 3300013306 | Ga0163162_10001265 | Ga0163162_1000126517 | 632 |
| 314 | 3300013306 | Ga0163162_10003537 | Ga0163162_1000353715 | 632 |
| 315 | 3300013307 | Ga0157372_10035531 | Ga0157372_100355314 | 632 |
| 316 | 3300013308 | Ga0157375_10001055 | Ga0157375_1000105511 | 632 |
| 317 | 3300013308 | Ga0157375_10028440 | Ga0157375_100284402 | 632 |
| 318 | 3300013308 | Ga0157375_10051617 | Ga0157375_100516172 | 632 |
| 319 | 3300014325 | Ga0163163_10000888 | Ga0163163_1000088812 | 632 |
| 320 | 3300014325 | Ga0163163_10001753 | Ga0163163_1000175313 | 632 |
| 321 | 3300014326 | Ga0157380_10058138 | Ga0157380_100581382 | 632 |
| 322 | 3300014968 | Ga0157379_10115632 | Ga0157379_101156321 | 632 |
| 323 | 3300014969 | Ga0157376_10010045 | Ga0157376_100100454 | 632 |
| 324 | 3300014969 | Ga0157376_10017770 | Ga0157376_100177702 | 632 |
| 325 | 3300014969 | Ga0157376_10020364 | Ga0157376_100203643 | 632 |
| 326 | 3300014969 | Ga0157376_10066099 | Ga0157376_100660992 | 632 |
| 327 | 3300017792 | Ga0163161_10003083 | Ga0163161_100030833 | 632 |
| 328 | 3300017792 | Ga0163161_10032349 | Ga0163161_100323492 | 632 |
| 329 | 3300025302 | Ga0207426_1017373 | Ga0207426_10173732 | 632 |
| 330 | 3300025893 | Ga0207682_10009478 | Ga0207682_100094782 | 632 |
| 331 | 3300025903 | Ga0207680_10000748 | Ga0207680_1000074812 | 632 |
| 332 | 3300025907 | Ga0207645_10007581 | Ga0207645_100075817 | 632 |
| 333 | 3300025909 | Ga0207705_10035485 | Ga0207705_100354853 | 632 |
| 334 | 3300025911 | Ga0207654_10008792 | Ga0207654_100087922 | 632 |
| 335 | 3300025913 | Ga0207695_10000550 | Ga0207695_1000055035 | 632 |
| 336 | 3300025914 | Ga0207671_10001002 | Ga0207671_100010025 | 632 |
| 337 | 3300025914 | Ga0207671_10003071 | Ga0207671_1000307113 | 632 |
| 338 | 3300025924 | Ga0207694_10008991 | Ga0207694_100089914 | 632 |
| 339 | 3300025931 | Ga0207644_10008218 | Ga0207644_100082184 | 632 |
| 340 | 3300025932 | Ga0207690_10005330 | Ga0207690_100053303 | 632 |
| 341 | 3300025933 | Ga0207706_10024337 | Ga0207706_100243372 | 632 |
| 342 | 3300025933 | Ga0207706_10036288 | Ga0207706_100362882 | 632 |
| 343 | 3300025934 | Ga0207686_10000626 | Ga0207686_100006265 | 632 |
| 344 | 3300025938 | Ga0207704_10051892 | Ga0207704_100518922 | 632 |
| 345 | 3300025940 | Ga0207691_10011687 | Ga0207691_100116876 | 632 |
| 346 | 3300025942 | Ga0207689_10017807 | Ga0207689_100178075 | 632 |
| 347 | 3300025944 | Ga0207661_10000680 | Ga0207661_100006809 | 632 |
| 348 | 3300025945 | Ga0207679_10000152 | Ga0207679_1000015236 | 632 |
| 349 | 3300025960 | Ga0207651_10037823 | Ga0207651_100378232 | 632 |
| 350 | 3300025961 | Ga0207712_10002022 | Ga0207712_100020226 | 632 |
| 351 | 3300025961 | Ga0207712_10032837 | Ga0207712_100328372 | 632 |
| 352 | 3300025986 | Ga0207658_10018309 | Ga0207658_100183094 | 632 |
| 353 | 3300026023 | Ga0207677_10072504 | Ga0207677_100725041 | 632 |
| 354 | 3300026041 | Ga0207639_10015986 | Ga0207639_100159863 | 632 |
| 355 | 3300026088 | Ga0207641_10000159 | Ga0207641_1000015979 | 632 |
| 356 | 3300026088 | Ga0207641_10020159 | Ga0207641_100201593 | 632 |
| 357 | 3300026088 | Ga0207641_10024328 | Ga0207641_100243282 | 632 |
| 358 | 3300026088 | Ga0207641_10061387 | Ga0207641_100613872 | 632 |
| 359 | 3300026089 | Ga0207648_10056701 | Ga0207648_100567011 | 632 |
| 360 | 3300026116 | Ga0207674_10004065 | Ga0207674_100040656 | 632 |
| 361 | 3300026118 | Ga0207675_100023999 | Ga0207675_1000239992 | 632 |
| 362 | 3300026142 | Ga0207698_10073167 | Ga0207698_100731671 | 632 |
| 363 | 3300028794 | Ga0307515_10000021 | Ga0307515_10000021264 | 632 |
| 364 | 3300036401 | Ga0373937_0000626 | Ga0373937_0000626_14761_16692 | 632 |
| 365 | 3300037312 | Ga0395899_0000006 | Ga0395899_0000006_124798_126747 | 632 |
| 366 | 3300037418 | Ga0395900_0094830 | Ga0395900_0094830_694_2643 | 632 |
| 367 | 3300037471 | Ga0395905_0002345 | Ga0395905_0002345_14121_16070 | 632 |
| 368 | 3300038443 | Ga0395901_0000598 | Ga0395901_0000598_18046_20001 | 632 |
| 369 | 3300044658 | Ga0466972_0002481 | Ga0466972_0002481_4916_6847 | 632 |
| 370 | 3300044901 | Ga0466960_0034244 | Ga0466960_0034244_234_2165 | 632 |
| 371 | 3300046511 | Ga0495608_0011961 | Ga0495608_0011961_3214_5145 | 632 |
| 372 | 3300046517 | Ga0495630_0031080 | Ga0495630_0031080_1782_3713 | 632 |
| 373 | 3300046536 | Ga0495587_0024372 | Ga0495587_0024372_1314_3245 | 632 |
| 374 | 3300046616 | Ga0495668_0000114 | Ga0495668_0000114_62726_64657 | 632 |
| 375 | 3300046616 | Ga0495668_0003434 | Ga0495668_0003434_204_2135 | 632 |
| 376 | 3300046642 | Ga0495634_0047864 | Ga0495634_0047864_696_2627 | 632 |
| 377 | 3300046663 | Ga0495635_0027872 | Ga0495635_0027872_1984_3915 | 632 |
| 378 | 3300046809 | Ga0495600_0054098 | Ga0495600_0054098_123_2054 | 632 |
| 379 | 3300047317 | Ga0495604_0046806 | Ga0495604_0046806_1102_3033 | 632 |
| 380 | 3300048903 | Ga0496100_0074591 | Ga0496100_0074591_331_2262 | 632 |
| 381 | 3300048913 | Ga0496110_0032160 | Ga0496110_0032160_1975_3906 | 632 |
| 382 | 3300049515 | Ga0501292_002171 | Ga0501292_002171_553_2484 | 632 |
| 383 | 3300049521 | Ga0501298_000863 | Ga0501298_000863_1021_2952 | 632 |
| 384 | 3300049649 | Ga0501198_000680 | Ga0501198_000680_1321_3252 | 632 |
| 385 | 3300049651 | Ga0501201_000009 | Ga0501201_000009_7075_9006 | 632 |
| 386 | 3300049652 | Ga0501202_000340 | Ga0501202_000340_2044_3975 | 632 |
| 387 | 3300049653 | Ga0501206_000111 | Ga0501206_000111_5206_7137 | 632 |
| 388 | 3300049654 | Ga0501207_000455 | Ga0501207_000455_1333_3264 | 632 |
| 389 | 3300049663 | Ga0501223_001079 | Ga0501223_001079_2239_4170 | 632 |
| 390 | 3300049664 | Ga0501224_000138 | Ga0501224_000138_3984_5915 | 632 |
| 391 | 3300049682 | Ga0501252_000040 | Ga0501252_000040_2582_4513 | 632 |
| 392 | 3300049688 | Ga0501259_000120 | Ga0501259_000120_2329_4260 | 632 |
| 393 | 3300049690 | Ga0501261_000469 | Ga0501261_000469_2040_3971 | 632 |
| 394 | 3300049704 | Ga0501221_000038 | Ga0501221_000038_2034_3965 | 632 |
| 395 | 3300049705 | Ga0501225_0003204 | Ga0501225_0003204_1445_3376 | 632 |
| 396 | 3300049707 | Ga0501234_001449 | Ga0501234_001449_863_2794 | 632 |
| 397 | 3300049708 | Ga0501245_000227 | Ga0501245_000227_2308_4239 | 632 |
| 398 | 3300050493 | nmdc:mga0k408_896_c1 | nmdc:mga0k408_896_c1_4368_6299 | 632 |
| 399 | 3300060353 | Ga0501082_0030413 | Ga0501082_0030413_551_2506 | 632 |
| 400 | 2162886007 | SwRhRL2b_contig_1482467 | SwRhRL2b_0599.00006320 | 633 |
| 401 | 3300005288 | Ga0065714_10009714 | Ga0065714_100097146 | 633 |
| 402 | 3300005289 | Ga0065704_10000425 | Ga0065704_1000042557 | 633 |
| 403 | 3300005328 | Ga0070676_10027075 | Ga0070676_100270751 | 633 |
| 404 | 3300005335 | Ga0070666_10016404 | Ga0070666_100164042 | 633 |
| 405 | 3300005355 | Ga0070671_100097828 | Ga0070671_1000978282 | 633 |
| 406 | 3300005366 | Ga0070659_100003003 | Ga0070659_1000030037 | 633 |
| 407 | 3300005457 | Ga0070662_100049363 | Ga0070662_1000493632 | 633 |
| 408 | 3300005471 | Ga0070698_100004398 | Ga0070698_1000043988 | 633 |
| 409 | 3300005535 | Ga0070684_100036540 | Ga0070684_1000365403 | 633 |
| 410 | 3300005548 | Ga0070665_100000002 | Ga0070665_100000002418 | 633 |
| 411 | 3300005563 | Ga0068855_100045651 | Ga0068855_1000456512 | 633 |
| 412 | 3300005564 | Ga0070664_100009965 | Ga0070664_1000099657 | 633 |
| 413 | 3300005577 | Ga0068857_100023055 | Ga0068857_1000230552 | 633 |
| 414 | 3300005616 | Ga0068852_100000787 | Ga0068852_10000078718 | 633 |
| 415 | 3300005617 | Ga0068859_100018620 | Ga0068859_1000186204 | 633 |
| 416 | 3300005618 | Ga0068864_100030131 | Ga0068864_1000301314 | 633 |
| 417 | 3300005843 | Ga0068860_100000003 | Ga0068860_10000000336 | 633 |
| 418 | 3300005843 | Ga0068860_100009699 | Ga0068860_1000096992 | 633 |
| 419 | 3300005843 | Ga0068860_100028647 | Ga0068860_1000286472 | 633 |
| 420 | 3300006358 | Ga0068871_100048895 | Ga0068871_1000488955 | 633 |
| 421 | 3300006844 | Ga0075428_100062058 | Ga0075428_1000620582 | 633 |
| 422 | 3300006931 | Ga0097620_100018620 | Ga0097620_1000186205 | 633 |
| 423 | 3300009093 | Ga0105240_10050390 | Ga0105240_100503904 | 633 |
| 424 | 3300009176 | Ga0105242_10071688 | Ga0105242_100716881 | 633 |
| 425 | 3300009545 | Ga0105237_10002608 | Ga0105237_100026084 | 633 |
| 426 | 3300009553 | Ga0105249_10001363 | Ga0105249_100013633 | 633 |
| 427 | 3300013100 | Ga0157373_10000916 | Ga0157373_1000091613 | 633 |
| 428 | 3300013102 | Ga0157371_10007402 | Ga0157371_100074025 | 633 |
| 429 | 3300013102 | Ga0157371_10009469 | Ga0157371_100094691 | 633 |
| 430 | 3300013306 | Ga0163162_10000952 | Ga0163162_1000095210 | 633 |
| 431 | 3300013307 | Ga0157372_10127472 | Ga0157372_101274722 | 633 |
| 432 | 3300014325 | Ga0163163_10013960 | Ga0163163_100139606 | 633 |
| 433 | 3300014497 | Ga0182008_10000022 | Ga0182008_1000002265 | 633 |
| 434 | 3300014497 | Ga0182008_10008974 | Ga0182008_100089743 | 633 |
| 435 | 3300014497 | Ga0182008_10046774 | Ga0182008_100467741 | 633 |
| 436 | 3300014497 | Ga0182008_10047019 | Ga0182008_100470191 | 633 |
| 437 | 3300015261 | Ga0182006_1005184 | Ga0182006_10051842 | 633 |
| 438 | 3300017792 | Ga0163161_10003213 | Ga0163161_100032134 | 633 |
| 439 | 3300025893 | Ga0207682_10005836 | Ga0207682_100058364 | 633 |
| 440 | 3300025904 | Ga0207647_10000050 | Ga0207647_1000005024 | 633 |
| 441 | 3300025913 | Ga0207695_10039740 | Ga0207695_100397403 | 633 |
| 442 | 3300025914 | Ga0207671_10000761 | Ga0207671_1000076127 | 633 |
| 443 | 3300025914 | Ga0207671_10015636 | Ga0207671_100156361 | 633 |
| 444 | 3300025914 | Ga0207671_10033866 | Ga0207671_100338662 | 633 |
| 445 | 3300025925 | Ga0207650_10064512 | Ga0207650_100645122 | 633 |
| 446 | 3300025931 | Ga0207644_10074528 | Ga0207644_100745282 | 633 |
| 447 | 3300025932 | Ga0207690_10009623 | Ga0207690_100096234 | 633 |
| 448 | 3300025940 | Ga0207691_10013466 | Ga0207691_100134665 | 633 |
| 449 | 3300025942 | Ga0207689_10001148 | Ga0207689_100011481 | 633 |
| 450 | 3300025945 | Ga0207679_10008672 | Ga0207679_100086724 | 633 |
| 451 | 3300025949 | Ga0207667_10007145 | Ga0207667_100071452 | 633 |
| 452 | 3300025961 | Ga0207712_10001184 | Ga0207712_100011847 | 633 |
| 453 | 3300026035 | Ga0207703_10031664 | Ga0207703_100316643 | 633 |
| 454 | 3300026088 | Ga0207641_10000467 | Ga0207641_1000046736 | 633 |
| 455 | 3300026089 | Ga0207648_10007945 | Ga0207648_100079452 | 633 |
| 456 | 3300026089 | Ga0207648_10012083 | Ga0207648_100120835 | 633 |
| 457 | 3300026095 | Ga0207676_10001829 | Ga0207676_100018293 | 633 |
| 458 | 3300026116 | Ga0207674_10012180 | Ga0207674_100121805 | 633 |
| 459 | 3300026116 | Ga0207674_10090457 | Ga0207674_100904572 | 633 |
| 460 | 3300026118 | Ga0207675_100005907 | Ga0207675_1000059071 | 633 |
| 461 | 3300026118 | Ga0207675_100019140 | Ga0207675_1000191404 | 633 |
| 462 | 3300026121 | Ga0207683_10011591 | Ga0207683_100115915 | 633 |
| 463 | 3300026142 | Ga0207698_10007436 | Ga0207698_100074364 | 633 |
| 464 | 3300026142 | Ga0207698_10066546 | Ga0207698_100665461 | 633 |
| 465 | 3300028379 | Ga0268266_10000022 | Ga0268266_1000002220 | 633 |
| 466 | 3300028381 | Ga0268264_10000082 | Ga0268264_10000082193 | 633 |
| 467 | 3300028381 | Ga0268264_10004522 | Ga0268264_100045223 | 633 |
| 468 | 3300028381 | Ga0268264_10021296 | Ga0268264_100212963 | 633 |
| 469 | 3300028786 | Ga0307517_10005192 | Ga0307517_1000519211 | 633 |
| 470 | 3300028794 | Ga0307515_10011199 | Ga0307515_100111992 | 633 |
| 471 | 3300030521 | Ga0307511_10000027 | Ga0307511_1000002754 | 633 |
| 472 | 3300030732 | Ga0316176_1063677 | Ga0316176_10636775 | 633 |
| 473 | 3300030732 | Ga0316176_1065190 | Ga0316176_10651902 | 633 |
| 474 | 3300030742 | Ga0316183_1041279 | Ga0316183_104127931 | 633 |
| 475 | 3300030742 | Ga0316183_1201626 | Ga0316183_120162612 | 633 |
| 476 | 3300030744 | Ga0316181_1239604 | Ga0316181_12396042 | 633 |
| 477 | 3300030744 | Ga0316181_1276674 | Ga0316181_12766742 | 633 |
| 478 | 3300031730 | Ga0307516_10000869 | Ga0307516_1000086918 | 633 |
| 479 | 3300031903 | Ga0307407_10000007 | Ga0307407_10000007144 | 633 |
| 480 | 3300031911 | Ga0307412_10000001 | Ga0307412_1000000193 | 633 |
| 481 | 3300032002 | Ga0307416_100000015 | Ga0307416_10000001543 | 633 |
| 482 | 3300032004 | Ga0307414_10009961 | Ga0307414_100099613 | 633 |
| 483 | 3300042014 | Ga0439457_005713 | Ga0439457_005713_1046_2980 | 633 |
| 484 | 3300042134 | Ga0450898_001793 | Ga0450898_001793_194_2128 | 633 |
| 485 | 3300044712 | Ga0453684_0028623 | Ga0453684_0028623_576_2510 | 633 |
| 486 | 3300044712 | Ga0453684_0030869 | Ga0453684_0030869_3549_5486 | 633 |
| 487 | 3300046524 | Ga0495648_0000879 | Ga0495648_0000879_18476_20410 | 633 |
| 488 | 3300047443 | Ga0495687_000179 | Ga0495687_000179_43490_45424 | 633 |
| 489 | 3300048925 | Ga0496122_0006031 | Ga0496122_0006031_2841_4769 | 633 |
| 490 | 3300048926 | Ga0496123_0001642 | Ga0496123_0001642_14405_16333 | 633 |
| 491 | 3300049568 | Ga0501031_0013524 | Ga0501031_0013524_288_2222 | 633 |
| 492 | 3300049569 | Ga0501032_0027679 | Ga0501032_0027679_857_2791 | 633 |
| 493 | 3300049571 | Ga0501034_0010456 | Ga0501034_0010456_4674_6611 | 633 |
| 494 | 3300049571 | Ga0501034_0029202 | Ga0501034_0029202_2663_4597 | 633 |
| 495 | 3300049572 | Ga0501036_0014936 | Ga0501036_0014936_2646_4583 | 633 |
| 496 | 3300049574 | Ga0501038_0010673 | Ga0501038_0010673_421_2355 | 633 |
| 497 | 3300049574 | Ga0501038_0052433 | Ga0501038_0052433_372_2309 | 633 |
| 498 | 3300049575 | Ga0501039_0023254 | Ga0501039_0023254_338_2272 | 633 |
| 499 | 3300049575 | Ga0501039_0027566 | Ga0501039_0027566_775_2712 | 633 |
| 500 | 3300049579 | Ga0501043_0033508 | Ga0501043_0033508_1743_3680 | 633 |
| 501 | 3300049580 | Ga0501046_0032390 | Ga0501046_0032390_2062_3999 | 633 |
| 502 | 3300049580 | Ga0501046_0036206 | Ga0501046_0036206_551_2485 | 633 |
| 503 | 3300049582 | Ga0501048_0033057 | Ga0501048_0033057_954_2891 | 633 |
| 504 | 3300049742 | Ga0501080_0115354 | Ga0501080_0115354_234_2171 | 633 |
| 505 | 3300049744 | Ga0501083_0001228 | Ga0501083_0001228_1893_3830 | 633 |
| 506 | 3300049822 | Ga0501035_0001789 | Ga0501035_0001789_4057_5994 | 633 |
| 507 | 3300049823 | Ga0501044_0006371 | Ga0501044_0006371_9565_11502 | 633 |
| 508 | 3300049823 | Ga0501044_0008422 | Ga0501044_0008422_2346_4280 | 633 |
| 509 | 3300053093 | Ga0500651_0000128 | Ga0500651_0000128_25250_27178 | 633 |
| 510 | 3300053139 | Ga0500568_0002133 | Ga0500568_0002133_2047_3984 | 633 |
| 511 | 3300053139 | Ga0500568_0011709 | Ga0500568_0011709_1449_3383 | 633 |
| 512 | 3300053156 | Ga0500622_0002778 | Ga0500622_0002778_1625_3559 | 633 |
| 513 | 3300053727 | Ga0500611_000061 | Ga0500611_000061_37468_39405 | 633 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ouv-assembly1.cif.gz_B | 1-deoxy-d-xylulose 5-phosphate synthase (dxps) from deinococcus radiodurans with methylacetylphosphonate (map) bound | 0.9341 | 7 | 622 |
| 8a29-assembly3.cif.gz_F | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9333 | 7 | 626 |
| 2o1x-assembly1.cif.gz_B | 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from deinococcus radiodurans | 0.9287 | 7 | 622 |
| 8a29-assembly2.cif.gz_D | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9278 | 7 | 626 |
| 2o1s-assembly1.cif.gz_B | 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from escherichia coli | 0.9252 | 6 | 624 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2o1sD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9598 | 7 | 284 | 3.40.50.970 |
| 2o1xD03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9596 | 494 | 622 | 3.40.50.920 |
| af_A0A1D6M458_593_733_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9478 | 494 | 622 | 3.40.50.920 |
| af_Q58092_187_315_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9445 | 494 | 621 | 3.40.50.920 |
| 2o1sD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9441 | 7 | 284 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J9FQV9-F1-model_v4 | 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) | 0.9798 | 383 | 597 |
GO:0005829
GO:0008661 GO:0009228 GO:0016114 GO:0019288 GO:0046872 GO:0052865 |
| AF-A0A7V6ALR3-F1-model_v4 | 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) | 0.9775 | 383 | 621 |
GO:0005829
GO:0008661 GO:0009228 GO:0016114 GO:0019288 GO:0046872 GO:0052865 |
| AF-A0A3B8YP93-F1-model_v4 | 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) | 0.976 | 441 | 618 |
GO:0005829
GO:0008661 GO:0016114 GO:0019288 |
| AF-J9FQV9-F1-model_v4 | 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) | 0.9753 | 383 | 597 |
GO:0005829
GO:0008661 GO:0009228 GO:0016114 GO:0019288 GO:0046872 GO:0052865 |
| AF-A0A3D0J5U4-F1-model_v4 | 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7) | 0.9697 | 394 | 621 |
GO:0005829
GO:0008661 GO:0009228 GO:0016114 GO:0019288 GO:0046872 GO:0052865 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar