F457555

General Info

Members Datasets Scaffolds Average Seq Length
513 269 1026 118

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_11619807|Ga0105245_116198071
Length 125
Sequence MDNHASLTNLPDSAEAHAHAPGGEEHSHPTWSTYWKVAVILTLITVGEVWAYYVPSFVAGRGFVPTLLFLSALKFAIVVMFYMHLKYDHRLFRVLFTGPLLIAGLTLLALMFLFGQLAIRTGALQ

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
220 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
221 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
222 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
223 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
224 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
225 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
226 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
227 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
228 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
229 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
230 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
231 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
232 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
233 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
234 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
235 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
236 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
237 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
238 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
239 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
240 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
241 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
242 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
243 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
244 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
245 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
246 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
247 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
248 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
249 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
250 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
251 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
252 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
253 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
254 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
255 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
256 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
257 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
258 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
259 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
260 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
261 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
262 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
263 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.78
Rhizosphere 98.83
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_11619807 3300009098 Bacteria 699
2 Ga0058863_11545018 3300004799 Bacteria 840
3 Ga0058861_11813017 3300004800 Bacteria 799
4 Ga0058862_12414308 3300004803 Bacteria 1117
5 Ga0065712_10076910 3300005290 Bacteria 3581
6 Ga0065712_10090354 3300005290 Bacteria 2425
7 Ga0065715_10092208 3300005293 Bacteria 5253
8 Ga0065715_10094987 3300005293 Bacteria 4194
9 Ga0065715_10245213 3300005293 Bacteria 1185
10 Ga0065707_10113316 3300005295 Bacteria 2332
11 Ga0070658_10080382 3300005327 Bacteria 2677
12 Ga0070658_10928226 3300005327 Bacteria 757
13 Ga0070676_10739475 3300005328 Bacteria 721
14 Ga0070676_11209013 3300005328 Bacteria 575
15 Ga0070683_100095479 3300005329 Bacteria 2795
16 Ga0070683_100441694 3300005329 Bacteria 1241
17 Ga0070683_100811543 3300005329 Bacteria 897
18 Ga0070683_101510768 3300005329 Bacteria 646
19 Ga0070683_101835256 3300005329 Bacteria 583
20 Ga0070690_100024257 3300005330 Bacteria 3728
21 Ga0070690_100214157 3300005330 Bacteria 1347
22 Ga0070670_100087290 3300005331 Bacteria 2681
23 Ga0070670_100243723 3300005331 Bacteria 1565
24 Ga0070677_10336469 3300005333 Unclassified 778
25 Ga0068869_100404083 3300005334 Bacteria 1124
26 Ga0070680_100001063 3300005336 Bacteria 19682
27 Ga0070680_100090596 3300005336 Bacteria 2532
28 Ga0070680_100121403 3300005336 Bacteria 2182
29 Ga0070680_100154314 3300005336 Bacteria 1928
30 Ga0070680_100427801 3300005336 Bacteria 1130
31 Ga0070680_100527890 3300005336 Bacteria 1011
32 Ga0070680_101094899 3300005336 Bacteria 689
33 Ga0070682_100001744 3300005337 Bacteria 12093
34 Ga0070682_100006788 3300005337 Bacteria 6423
35 Ga0070682_100011430 3300005337 Bacteria 5072
36 Ga0070682_100772093 3300005337 Bacteria 778
37 Ga0070682_101214645 3300005337 Bacteria 637
38 Ga0070682_101931832 3300005337 Bacteria 518
39 Ga0068868_100013626 3300005338 Bacteria 5969
40 Ga0068868_100041434 3300005338 Bacteria 3587
41 Ga0068868_100056570 3300005338 Bacteria 3097
42 Ga0068868_100741143 3300005338 Bacteria 882
43 Ga0070660_100108210 3300005339 Bacteria 2209
44 Ga0070660_100813723 3300005339 Bacteria 786
45 Ga0070660_100991516 3300005339 Bacteria 710
46 Ga0070660_101667692 3300005339 Archaea 543
47 Ga0070689_100138818 3300005340 Unclassified 1953
48 Ga0070691_10358355 3300005341 Bacteria 812
49 Ga0070687_100004752 3300005343 Bacteria 5436
50 Ga0070661_100116272 3300005344 Bacteria 2000
51 Ga0070661_100176090 3300005344 Bacteria 1626
52 Ga0070661_100268691 3300005344 Bacteria 1320
53 Ga0070661_101283743 3300005344 Bacteria 614
54 Ga0070692_10001242 3300005345 Bacteria 9102
55 Ga0070692_10018843 3300005345 Bacteria 3325
56 Ga0070692_10290819 3300005345 Bacteria 994
57 Ga0070669_100050059 3300005353 Bacteria 3051
58 Ga0070669_100340319 3300005353 Bacteria 1215
59 Ga0070675_102016541 3300005354 Bacteria 532
60 Ga0070671_100117177 3300005355 Bacteria 2239
61 Ga0070671_100244645 3300005355 Bacteria 1523
62 Ga0070671_101369488 3300005355 Bacteria 625
63 Ga0070674_100305094 3300005356 Bacteria 1270
64 Ga0070674_100999694 3300005356 Bacteria 734
65 Ga0070673_100047116 3300005364 Bacteria 3352
66 Ga0070673_100190601 3300005364 Bacteria 1761
67 Ga0070673_101295568 3300005364 Bacteria 684
68 Ga0070688_100764516 3300005365 Bacteria 753
69 Ga0070659_100022037 3300005366 Bacteria 4862
70 Ga0070659_100224704 3300005366 Bacteria 1551
71 Ga0070659_101123115 3300005366 Bacteria 693
72 Ga0070667_100016113 3300005367 Bacteria 6183
73 Ga0070667_101128477 3300005367 Bacteria 733
74 Ga0070709_10028035 3300005434 Bacteria 3355
75 Ga0070709_10367906 3300005434 Bacteria 1066
76 Ga0070714_100052682 3300005435 Bacteria 3471
77 Ga0070710_10074781 3300005437 Bacteria 1961
78 Ga0070701_10048396 3300005438 Bacteria 2194
79 Ga0070701_10833230 3300005438 Bacteria 632
80 Ga0070711_100116162 3300005439 Bacteria 1971
81 Ga0070705_100325661 3300005440 Bacteria 1111
82 Ga0070700_100083923 3300005441 Bacteria 2063
83 Ga0070700_100222507 3300005441 Bacteria 1338
84 Ga0070700_100228881 3300005441 Unclassified 1322
85 Ga0070694_100022377 3300005444 Bacteria 4050
86 Ga0070694_100048195 3300005444 Bacteria 2866
87 Ga0070694_101145715 3300005444 Bacteria 650
88 Ga0070708_100000016 3300005445 Bacteria 124870
89 Ga0070708_100112417 3300005445 Unclassified 2505
90 Ga0070708_100268124 3300005445 Bacteria 1605
91 Ga0070663_100128989 3300005455 Bacteria 1918
92 Ga0070678_100058100 3300005456 Bacteria 2838
93 Ga0070678_100179886 3300005456 Bacteria 1730
94 Ga0070662_100015437 3300005457 Bacteria 5116
95 Ga0070662_100052909 3300005457 Bacteria 2938
96 Ga0070662_100098445 3300005457 Bacteria 2209
97 Ga0070662_100285234 3300005457 Bacteria 1337
98 Ga0070681_10031189 3300005458 Bacteria 5349
99 Ga0070681_10175889 3300005458 Bacteria 2062
100 Ga0070681_10283066 3300005458 Bacteria 1569
101 Ga0070681_10328517 3300005458 Bacteria 1439
102 Ga0070681_10482824 3300005458 Bacteria 1152
103 Ga0070681_10593583 3300005458 Bacteria 1022
104 Ga0068867_100198573 3300005459 Bacteria 1604
105 Ga0068867_100502602 3300005459 Bacteria 1042
106 Ga0068867_101185833 3300005459 Bacteria 701
107 Ga0068867_101674789 3300005459 Bacteria 596
108 Ga0070706_100013997 3300005467 Bacteria 7412
109 Ga0070706_100292578 3300005467 Bacteria 1520
110 Ga0070706_100845167 3300005467 Bacteria 846
111 Ga0070707_100000189 3300005468 Bacteria 61252
112 Ga0070707_100322234 3300005468 Bacteria 1502
113 Ga0070707_100512986 3300005468 Bacteria 1161
114 Ga0070707_100787356 3300005468 Bacteria 915
115 Ga0070707_101356642 3300005468 Bacteria 677
116 Ga0070698_100023703 3300005471 Bacteria 6412
117 Ga0070698_100059067 3300005471 Bacteria 3874
118 Ga0070698_100323473 3300005471 Bacteria 1473
119 Ga0070698_101713275 3300005471 Bacteria 581
120 Ga0070699_100030067 3300005518 Bacteria 4687
121 Ga0070699_100043877 3300005518 Bacteria 3870
122 Ga0070699_100055866 3300005518 Bacteria 3418
123 Ga0070699_100080203 3300005518 Unclassified 2844
124 Ga0070699_100489228 3300005518 Bacteria 1117
125 Ga0070679_100018653 3300005530 Bacteria 6735
126 Ga0070679_100022426 3300005530 Bacteria 6170
127 Ga0070679_100069166 3300005530 Bacteria 3522
128 Ga0070679_100070330 3300005530 Bacteria 3492
129 Ga0070679_100167551 3300005530 Bacteria 2170
130 Ga0070679_100677887 3300005530 Bacteria 973
131 Ga0070679_100826680 3300005530 Bacteria 869
132 Ga0070679_100902806 3300005530 Bacteria 827
133 Ga0070679_101940623 3300005530 Bacteria 538
134 Ga0070684_100091395 3300005535 Bacteria 2708
135 Ga0070684_100142213 3300005535 Bacteria 2170
136 Ga0070684_100199244 3300005535 Bacteria 1823
137 Ga0070684_101010164 3300005535 Bacteria 781
138 Ga0070697_100077010 3300005536 Bacteria 2743
139 Ga0070697_100205803 3300005536 Bacteria 1674
140 Ga0070697_100355684 3300005536 Unclassified 1265
141 Ga0070697_100793861 3300005536 Unclassified 837
142 Ga0070697_101974793 3300005536 Bacteria 522
143 Ga0068853_101168237 3300005539 Bacteria 743
144 Ga0068853_101237988 3300005539 Unclassified 721
145 Ga0068853_101732227 3300005539 Bacteria 606
146 Ga0070672_100143921 3300005543 Bacteria 1969
147 Ga0070686_100064711 3300005544 Bacteria 2373
148 Ga0070695_100023288 3300005545 Bacteria 3804
149 Ga0070695_100122584 3300005545 Bacteria 1780
150 Ga0070695_100149687 3300005545 Bacteria 1628
151 Ga0070696_100077508 3300005546 Bacteria 2349
152 Ga0070696_100347540 3300005546 Bacteria 1148
153 Ga0070696_100565922 3300005546 Bacteria 912
154 Ga0070696_100875899 3300005546 Bacteria 743
155 Ga0070693_100000720 3300005547 Bacteria 14571
156 Ga0070693_100098986 3300005547 Bacteria 1773
157 Ga0070693_100111280 3300005547 Bacteria 1685
158 Ga0070704_100577914 3300005549 Bacteria 985
159 Ga0068855_100004418 3300005563 Bacteria 17181
160 Ga0068855_100300321 3300005563 Bacteria 1778
161 Ga0068855_100365976 3300005563 Bacteria 1586
162 Ga0068855_100893761 3300005563 Bacteria 939
163 Ga0068855_100980907 3300005563 Bacteria 889
164 Ga0068855_101778622 3300005563 Bacteria 627
165 Ga0068855_101868560 3300005563 Unclassified 609
166 Ga0070664_100036841 3300005564 Bacteria 4110
167 Ga0070664_100273157 3300005564 Bacteria 1523
168 Ga0070664_100343728 3300005564 Bacteria 1356
169 Ga0068857_100011024 3300005577 Bacteria 7869
170 Ga0068857_100155867 3300005577 Bacteria 2071
171 Ga0068854_100295567 3300005578 Unclassified 1308
172 Ga0068854_101118396 3300005578 Bacteria 702
173 Ga0068856_100222475 3300005614 Unclassified 1903
174 Ga0070702_100007743 3300005615 Bacteria 5159
175 Ga0070702_100074886 3300005615 Bacteria 2010
176 Ga0070702_100455809 3300005615 Bacteria 929
177 Ga0068852_100024887 3300005616 Bacteria 4844
178 Ga0068852_100325387 3300005616 Bacteria 1494
179 Ga0068852_100391366 3300005616 Bacteria 1365
180 Ga0068852_101114602 3300005616 Bacteria 809
181 Ga0068859_100117474 3300005617 Bacteria 2725
182 Ga0068864_100475393 3300005618 Bacteria 1199
183 Ga0068866_10041598 3300005718 Bacteria 2281
184 Ga0068866_10671537 3300005718 Bacteria 708
185 Ga0068861_100708811 3300005719 Bacteria 936
186 Ga0068863_100381018 3300005841 Bacteria 1377
187 Ga0068858_100436939 3300005842 Bacteria 1260
188 Ga0068860_101820185 3300005843 Bacteria 631
189 Ga0068862_100961010 3300005844 Bacteria 843
190 Ga0081455_10404325 3300005937 Bacteria 946
191 Ga0075432_10193947 3300006058 Bacteria 801
192 Ga0070715_10708948 3300006163 Bacteria 602
193 Ga0070716_100003880 3300006173 Bacteria 7097
194 Ga0070716_100610642 3300006173 Bacteria 822
195 Ga0070712_100110305 3300006175 Bacteria 2052
196 Ga0070712_100118310 3300006175 Bacteria 1990
197 Ga0097621_100299795 3300006237 Bacteria 1419
198 Ga0097621_101888693 3300006237 Unclassified 570
199 Ga0068871_100850879 3300006358 Bacteria 843
200 Ga0075433_10636311 3300006852 Bacteria 935
201 Ga0075434_100301631 3300006871 Unclassified 1622
202 Ga0075429_101845161 3300006880 Bacteria 524
203 Ga0068865_100262112 3300006881 Bacteria 1369
204 Ga0068865_100285443 3300006881 Bacteria 1315
205 Ga0068865_101396735 3300006881 Bacteria 625
206 Ga0075436_100001657 3300006914 Bacteria 15212
207 Ga0097620_100117470 3300006931 Bacteria 2725
208 Ga0075435_100167338 3300007076 Unclassified 1854
209 Ga0075435_101006179 3300007076 Unclassified 728
210 Ga0099795_10141057 3300007788 Bacteria 980
211 Ga0105240_10031903 3300009093 Bacteria 6826
212 Ga0105240_10060055 3300009093 Bacteria 4741
213 Ga0105245_10025920 3300009098 Bacteria 5157
214 Ga0105245_10723954 3300009098 Bacteria 1029
215 Ga0105245_12222347 3300009098 Bacteria 602
216 Ga0114129_10230459 3300009147 Bacteria 2495
217 Ga0105241_10213713 3300009174 Bacteria 1617
218 Ga0105241_10275506 3300009174 Bacteria 1435
219 Ga0105241_10428689 3300009174 Bacteria 1165
220 Ga0105241_10522651 3300009174 Bacteria 1061
221 Ga0105242_10980449 3300009176 Bacteria 851
222 Ga0105248_10236182 3300009177 Bacteria 2058
223 Ga0105248_11379025 3300009177 Bacteria 797
224 Ga0105238_10008881 3300009551 Bacteria 10058
225 Ga0099796_10007401 3300010159 Bacteria 2868
226 Ga0105239_10624554 3300010375 Bacteria 1230
227 Ga0105246_12280844 3300011119 Bacteria 528
228 Ga0157373_10173231 3300013100 Bacteria 1518
229 Ga0157373_10234924 3300013100 Bacteria 1295
230 Ga0157373_10263230 3300013100 Bacteria 1220
231 Ga0157373_10771143 3300013100 Bacteria 708
232 Ga0157371_10057187 3300013102 Bacteria 2766
233 Ga0157371_10198591 3300013102 Bacteria 1437
234 Ga0157370_10365494 3300013104 Bacteria 1330
235 Ga0157370_10433324 3300013104 Bacteria 1209
236 Ga0157369_10429962 3300013105 Bacteria 1368
237 Ga0157369_10476915 3300013105 Bacteria 1291
238 Ga0157369_11392083 3300013105 Bacteria 714
239 Ga0157374_10251562 3300013296 Bacteria 1739
240 Ga0157374_10497914 3300013296 Bacteria 1223
241 Ga0157378_10014816 3300013297 Bacteria 6824
242 Ga0157378_10026973 3300013297 Bacteria 5067
243 Ga0157378_10168152 3300013297 Bacteria 2055
244 Ga0157378_10196544 3300013297 Bacteria 1905
245 Ga0157378_11460099 3300013297 Bacteria 728
246 Ga0157378_11568979 3300013297 Bacteria 704
247 Ga0163162_11177102 3300013306 Bacteria 870
248 Ga0157372_10001133 3300013307 Bacteria 28943
249 Ga0157372_10032606 3300013307 Bacteria 5712
250 Ga0157372_10046539 3300013307 Bacteria 4816
251 Ga0157372_10103592 3300013307 Bacteria 3252
252 Ga0157372_10249721 3300013307 Bacteria 2059
253 Ga0157372_10389926 3300013307 Bacteria 1623
254 Ga0157372_13204091 3300013307 Bacteria 522
255 Ga0157375_10042979 3300013308 Bacteria 4379
256 Ga0157375_10301350 3300013308 Bacteria 1766
257 Ga0157375_12242971 3300013308 Bacteria 651
258 Ga0157380_11613173 3300014326 Bacteria 704
259 Ga0182008_10068287 3300014497 Unclassified 1749
260 Ga0207692_10076311 3300025898 Bacteria 1780
261 Ga0207642_10311227 3300025899 Bacteria 916
262 Ga0207642_10397734 3300025899 Bacteria 824
263 Ga0207699_10213836 3300025906 Bacteria 1313
264 Ga0207645_10002896 3300025907 Bacteria 13268
265 Ga0207645_10443822 3300025907 Bacteria 875
266 Ga0207645_10713650 3300025907 Bacteria 682
267 Ga0207705_10002292 3300025909 Bacteria 14810
268 Ga0207705_10342982 3300025909 Bacteria 1150
269 Ga0207684_10068274 3300025910 Bacteria 3021
270 Ga0207684_10348236 3300025910 Bacteria 1275
271 Ga0207654_11438284 3300025911 Unclassified 503
272 Ga0207707_10003918 3300025912 Bacteria 13212
273 Ga0207707_10056601 3300025912 Bacteria 3412
274 Ga0207707_10108280 3300025912 Bacteria 2429
275 Ga0207707_10277534 3300025912 Bacteria 1452
276 Ga0207707_10325481 3300025912 Bacteria 1327
277 Ga0207707_10387649 3300025912 Bacteria 1200
278 Ga0207707_10584441 3300025912 Bacteria 946
279 Ga0207707_10807780 3300025912 Bacteria 781
280 Ga0207695_10014103 3300025913 Bacteria 9488
281 Ga0207695_10736713 3300025913 Bacteria 866
282 Ga0207663_10048172 3300025916 Bacteria 2636
283 Ga0207660_10023605 3300025917 Bacteria 4156
284 Ga0207660_10182642 3300025917 Bacteria 1630
285 Ga0207660_10231961 3300025917 Bacteria 1451
286 Ga0207660_10273370 3300025917 Bacteria 1339
287 Ga0207660_10383160 3300025917 Bacteria 1130
288 Ga0207660_10619541 3300025917 Bacteria 882
289 Ga0207662_10156179 3300025918 Bacteria 1454
290 Ga0207662_10855845 3300025918 Bacteria 642
291 Ga0207657_10000713 3300025919 Bacteria 35357
292 Ga0207657_10544266 3300025919 Bacteria 908
293 Ga0207649_10043501 3300025920 Bacteria 2746
294 Ga0207649_10078276 3300025920 Bacteria 2133
295 Ga0207649_10422365 3300025920 Bacteria 1001
296 Ga0207649_10537236 3300025920 Bacteria 893
297 Ga0207649_10980127 3300025920 Bacteria 665
298 Ga0207652_10012839 3300025921 Bacteria 6774
299 Ga0207652_10029628 3300025921 Unclassified 4579
300 Ga0207652_10077867 3300025921 Bacteria 2894
301 Ga0207652_10182295 3300025921 Bacteria 1887
302 Ga0207652_10334944 3300025921 Bacteria 1366
303 Ga0207652_11029413 3300025921 Bacteria 723
304 Ga0207646_10002475 3300025922 Bacteria 21819
305 Ga0207646_10137019 3300025922 Bacteria 2204
306 Ga0207681_10018645 3300025923 Bacteria 4375
307 Ga0207694_10509590 3300025924 Bacteria 1008
308 Ga0207650_10210346 3300025925 Bacteria 1562
309 Ga0207650_10689864 3300025925 Bacteria 862
310 Ga0207659_10720103 3300025926 Bacteria 855
311 Ga0207687_10059024 3300025927 Bacteria 2701
312 Ga0207687_10209301 3300025927 Bacteria 1529
313 Ga0207687_10356319 3300025927 Bacteria 1193
314 Ga0207664_10067845 3300025929 Bacteria 2863
315 Ga0207644_10198659 3300025931 Bacteria 1581
316 Ga0207644_11073827 3300025931 Bacteria 676
317 Ga0207690_10255495 3300025932 Bacteria 1355
318 Ga0207690_10585726 3300025932 Bacteria 909
319 Ga0207690_11058753 3300025932 Bacteria 676
320 Ga0207706_10000985 3300025933 Bacteria 29004
321 Ga0207706_10068456 3300025933 Bacteria 3123
322 Ga0207706_10146764 3300025933 Bacteria 2075
323 Ga0207686_10068117 3300025934 Bacteria 2279
324 Ga0207669_10195877 3300025937 Bacteria 1462
325 Ga0207704_10036739 3300025938 Bacteria 2821
326 Ga0207704_10042141 3300025938 Bacteria 2684
327 Ga0207704_11057021 3300025938 Bacteria 689
328 Ga0207665_10000515 3300025939 Bacteria 26165
329 Ga0207691_10119476 3300025940 Bacteria 2337
330 Ga0207711_10380574 3300025941 Bacteria 1309
331 Ga0207711_10395759 3300025941 Bacteria 1283
332 Ga0207689_10367170 3300025942 Bacteria 1197
333 Ga0207661_10035399 3300025944 Bacteria 3890
334 Ga0207661_10166941 3300025944 Bacteria 1913
335 Ga0207661_10364645 3300025944 Bacteria 1305
336 Ga0207661_10385317 3300025944 Bacteria 1269
337 Ga0207661_10547572 3300025944 Bacteria 1060
338 Ga0207679_10392106 3300025945 Bacteria 1220
339 Ga0207679_10425849 3300025945 Bacteria 1172
340 Ga0207667_10014828 3300025949 Bacteria 8866
341 Ga0207667_10015877 3300025949 Bacteria 8528
342 Ga0207667_10437716 3300025949 Bacteria 1329
343 Ga0207667_10768852 3300025949 Bacteria 961
344 Ga0207667_11747064 3300025949 Bacteria 587
345 Ga0207651_10168797 3300025960 Bacteria 1723
346 Ga0207712_10852674 3300025961 Bacteria 803
347 Ga0207640_10006098 3300025981 Bacteria 6589
348 Ga0207640_11342835 3300025981 Bacteria 639
349 Ga0207658_10999335 3300025986 Bacteria 763
350 Ga0207677_10017278 3300026023 Bacteria 4296
351 Ga0207677_10754609 3300026023 Bacteria 867
352 Ga0207677_10954996 3300026023 Bacteria 775
353 Ga0207703_10641100 3300026035 Bacteria 1007
354 Ga0207639_10440915 3300026041 Bacteria 1181
355 Ga0207639_10619205 3300026041 Bacteria 999
356 Ga0207678_10002110 3300026067 Bacteria 18003
357 Ga0207708_10172147 3300026075 Bacteria 1715
358 Ga0207708_10273678 3300026075 Bacteria 1366
359 Ga0207708_11154193 3300026075 Bacteria 676
360 Ga0207702_10532440 3300026078 Bacteria 1148
361 Ga0207702_11885506 3300026078 Bacteria 589
362 Ga0207648_10012572 3300026089 Bacteria 7920
363 Ga0207648_10105365 3300026089 Bacteria 2474
364 Ga0207648_10898394 3300026089 Unclassified 827
365 Ga0207648_11341598 3300026089 Bacteria 672
366 Ga0207676_10475257 3300026095 Bacteria 1183
367 Ga0207674_10011376 3300026116 Bacteria 9999
368 Ga0207674_10143171 3300026116 Bacteria 2350
369 Ga0207674_10862655 3300026116 Bacteria 873
370 Ga0207675_100426293 3300026118 Bacteria 1311
371 Ga0207683_10058553 3300026121 Bacteria 3383
372 Ga0207683_10729520 3300026121 Bacteria 919
373 Ga0207698_10009193 3300026142 Bacteria 6286
374 Ga0207698_10024681 3300026142 Bacteria 4224
375 Ga0207698_10407634 3300026142 Bacteria 1301
376 Ga0209967_1002530 3300027364 Bacteria 2370
377 Ga0209981_1013156 3300027378 Bacteria 1150
378 Ga0209996_1016897 3300027395 Bacteria 1005
379 Ga0209984_1026942 3300027424 Bacteria 804
380 Ga0210000_1005065 3300027462 Bacteria 1912
381 Ga0209999_1011374 3300027543 Bacteria 1610
382 Ga0209970_1014070 3300027614 Bacteria 1328
383 Ga0307405_10023308 3300031731 Bacteria 3516
384 Ga0307413_11656968 3300031824 Unclassified 569
385 Ga0307410_10011425 3300031852 Bacteria 5078
386 Ga0307410_10263802 3300031852 Bacteria 1344
387 Ga0307410_10266339 3300031852 Bacteria 1338
388 Ga0307410_11520271 3300031852 Bacteria 590
389 Ga0307406_10073344 3300031901 Unclassified 2250
390 Ga0307406_10368152 3300031901 Bacteria 1129
391 Ga0307406_11781475 3300031901 Bacteria 547
392 Ga0307407_10131638 3300031903 Bacteria 1601
393 Ga0307407_10372208 3300031903 Bacteria 1017
394 Ga0307412_10041120 3300031911 Bacteria 2994
395 Ga0307412_10630994 3300031911 Bacteria 911
396 Ga0307409_100038117 3300031995 Bacteria 3551
397 Ga0307409_102712966 3300031995 Bacteria 523
398 Ga0307416_100559791 3300032002 Bacteria 1218
399 Ga0307416_102924512 3300032002 Bacteria 571
400 Ga0307414_10023203 3300032004 Bacteria 3930
401 Ga0307414_11063334 3300032004 Bacteria 746
402 Ga0307414_11275359 3300032004 Bacteria 681
403 Ga0307411_10206701 3300032005 Bacteria 1512
404 Ga0307411_10480784 3300032005 Bacteria 1046
405 Ga0307415_100108146 3300032126 Bacteria 2056
406 Ga0307415_100141836 3300032126 Bacteria 1836
407 Ga0307415_101588679 3300032126 Unclassified 628
408 Ga0373958_0119312 3300034819 Bacteria 636
409 Ga0373959_0016573 3300034820 Unclassified 1367
410 Ga0373959_0041935 3300034820 Bacteria 963
411 Ga0373929_0033896 3300035085 Unclassified 1105
412 Ga0373940_0113114 3300035088 Unclassified 835
413 Ga0373941_0030136 3300035115 Bacteria 1606
414 Ga0373941_0065173 3300035115 Bacteria 1195
415 Ga0373960_0072760 3300035121 Unclassified 1067
416 Ga0373960_0305197 3300035121 Unclassified 593
417 Ga0373943_0105911 3300035170 Bacteria 1477
418 Ga0373946_0060041 3300035171 Bacteria 1615
419 Ga0373942_0135139 3300035207 Bacteria 781
420 Ga0373961_0071523 3300035241 Bacteria 1074
421 Ga0373935_0041973 3300035692 Bacteria 2875
422 Ga0436365_0495229 3300039437 Bacteria 1341
423 Ga0451839_1622833 3300041496 Unclassified 803
424 Ga0466966_0040190 3300044684 Bacteria 3010
425 Ga0466966_0924552 3300044684 Bacteria 526
426 Ga0466961_0027061 3300044693 Bacteria 3687
427 Ga0466971_0061147 3300044719 Bacteria 1703
428 Ga0466959_0008435 3300045049 Bacteria 7287
429 Ga0466959_0063261 3300045049 Bacteria 2687
430 Ga0451576_1472432 3300045051 Bacteria 708
431 Ga0466958_0333186 3300045836 Bacteria 976
432 Ga0495639_0294164 3300046475 Bacteria 809
433 Ga0495662_0045196 3300046476 Bacteria 2126
434 Ga0495664_0067681 3300046477 Bacteria 2131
435 Ga0495594_0144847 3300046499 Bacteria 1348
436 Ga0495586_0371406 3300046535 Bacteria 822
437 Ga0495586_0802959 3300046535 Bacteria 543
438 Ga0495587_0018943 3300046536 Bacteria 4265
439 Ga0495659_0178051 3300046664 Bacteria 865
440 Ga0495588_0192156 3300046674 Bacteria 1078
441 Ga0495669_0172718 3300046684 Bacteria 1028
442 Ga0495600_0119973 3300046809 Bacteria 1710
443 Ga0495581_0148342 3300047315 Bacteria 1369
444 Ga0495614_0259889 3300048089 Bacteria 796
445 Ga0496112_0005796 3300048915 Bacteria 10745
446 Ga0496112_0110637 3300048915 Bacteria 2717
447 Ga0496113_0257679 3300048916 Unclassified 1393
448 Ga0496115_0187596 3300048918 Bacteria 1709
449 Ga0501292_005688 3300049515 Bacteria 1746
450 Ga0501032_0355316 3300049569 Bacteria 944
451 Ga0501037_0214598 3300049573 Bacteria 1356
452 Ga0501046_0195282 3300049580 Bacteria 1508
453 Ga0501047_0060364 3300049581 Bacteria 3660
454 Ga0501069_0574102 3300049585 Bacteria 676
455 Ga0501201_003498 3300049651 Bacteria 1442
456 Ga0501202_000890 3300049652 Bacteria 4560
457 Ga0501209_003108 3300049656 Bacteria 2683
458 Ga0501210_001787 3300049657 Bacteria 1268
459 Ga0501216_000165 3300049660 Bacteria 7036
460 Ga0501217_000864 3300049661 Bacteria 5378
461 Ga0501222_001589 3300049662 Bacteria 3159
462 Ga0501223_002577 3300049663 Bacteria 4002
463 Ga0501224_003096 3300049664 Bacteria 2303
464 Ga0501228_001134 3300049666 Bacteria 1881
465 Ga0501233_003981 3300049668 Unclassified 2682
466 Ga0501233_175973 3300049668 Bacteria 610
467 Ga0501235_001296 3300049669 Bacteria 5293
468 Ga0501240_005255 3300049673 Bacteria 1543
469 Ga0501242_000289 3300049674 Bacteria 4103
470 Ga0501248_005790 3300049678 Bacteria 985
471 Ga0501248_023011 3300049678 Bacteria 660
472 Ga0501249_001854 3300049679 Bacteria 4309
473 Ga0501251_005211 3300049681 Bacteria 1370
474 Ga0501252_002877 3300049682 Bacteria 1739
475 Ga0501253_002066 3300049683 Bacteria 2200
476 Ga0501253_152823 3300049683 Bacteria 583
477 Ga0501257_000806 3300049686 Bacteria 6269
478 Ga0501258_000284 3300049687 Unclassified 3179
479 Ga0501259_005291 3300049688 Bacteria 2043
480 Ga0501260_000451 3300049689 Bacteria 3206
481 Ga0501261_002200 3300049690 Bacteria 2393
482 Ga0501221_003091 3300049704 Bacteria 2738
483 Ga0501225_0004539 3300049705 Bacteria 4128
484 Ga0501245_005888 3300049708 Bacteria 1705
485 Ga0501232_005462 3300049757 Bacteria 1265
486 Ga0501241_006309 3300049758 Bacteria 2182
487 Ga0501262_002612 3300049759 Bacteria 2041
488 Ga0501263_000502 3300049760 Bacteria 2962
489 Ga0501264_016320 3300049761 Bacteria 756
490 Ga0501266_001028 3300049763 Bacteria 3597
491 Ga0501267_013367 3300049764 Bacteria 853
492 Ga0501268_000021 3300049765 Bacteria 13607
493 Ga0501270_002431 3300049767 Bacteria 1906
494 Ga0501270_013913 3300049767 Bacteria 1124
495 Ga0501271_012346 3300049768 Bacteria 924
496 Ga0501272_005074 3300049769 Bacteria 1379
497 Ga0501274_002048 3300049771 Bacteria 1565
498 Ga0501274_007919 3300049771 Bacteria 944
499 Ga0501275_024599 3300049772 Bacteria 762
500 Ga0501276_044489 3300049773 Bacteria 504
501 Ga0501279_004264 3300049775 Unclassified 1875
502 Ga0501280_133957 3300049776 Unclassified 500
503 Ga0501204_004850 3300049850 Bacteria 1459
504 Ga0501212_000492 3300049851 Bacteria 3857
505 nmdc:mga05p37_807021_c1 3300050507 Bacteria 1026
506 nmdc:mga0n895_77639_c1 3300050512 Bacteria 3304
507 nmdc:mga0rr50_217030_c1 3300050513 Unclassified 1578
508 nmdc:mga0rr50_41795_c1 3300050513 Unclassified 3343
509 nmdc:mga08x19_326230_c1 3300050514 Unclassified 1069
510 nmdc:mga08x19_6184_c1 3300050514 Bacteria 7081
511 nmdc:mga08x19_621422_c1 3300050514 Bacteria 766
512 nmdc:mga0a205_165969_c1 3300050515 Unclassified 2104
513 Ga0466962_0238118 3300061719 Unclassified 893
514 Ga0105245_11619807
515 Ga0058863_11545018
516 Ga0058861_11813017
517 Ga0058862_12414308
518 Ga0065712_10076910
519 Ga0065712_10090354
520 Ga0065715_10092208
521 Ga0065715_10094987
522 Ga0065715_10245213
523 Ga0065707_10113316
524 Ga0070658_10080382
525 Ga0070658_10928226
526 Ga0070676_10739475
527 Ga0070676_11209013
528 Ga0070683_100095479
529 Ga0070683_100441694
530 Ga0070683_100811543
531 Ga0070683_101510768
532 Ga0070683_101835256
533 Ga0070690_100024257
534 Ga0070690_100214157
535 Ga0070670_100087290
536 Ga0070670_100243723
537 Ga0070677_10336469
538 Ga0068869_100404083
539 Ga0070680_100001063
540 Ga0070680_100090596
541 Ga0070680_100121403
542 Ga0070680_100154314
543 Ga0070680_100427801
544 Ga0070680_100527890
545 Ga0070680_101094899
546 Ga0070682_100001744
547 Ga0070682_100006788
548 Ga0070682_100011430
549 Ga0070682_100772093
550 Ga0070682_101214645
551 Ga0070682_101931832
552 Ga0068868_100013626
553 Ga0068868_100041434
554 Ga0068868_100056570
555 Ga0068868_100741143
556 Ga0070660_100108210
557 Ga0070660_100813723
558 Ga0070660_100991516
559 Ga0070660_101667692
560 Ga0070689_100138818
561 Ga0070691_10358355
562 Ga0070687_100004752
563 Ga0070661_100116272
564 Ga0070661_100176090
565 Ga0070661_100268691
566 Ga0070661_101283743
567 Ga0070692_10001242
568 Ga0070692_10018843
569 Ga0070692_10290819
570 Ga0070669_100050059
571 Ga0070669_100340319
572 Ga0070675_102016541
573 Ga0070671_100117177
574 Ga0070671_100244645
575 Ga0070671_101369488
576 Ga0070674_100305094
577 Ga0070674_100999694
578 Ga0070673_100047116
579 Ga0070673_100190601
580 Ga0070673_101295568
581 Ga0070688_100764516
582 Ga0070659_100022037
583 Ga0070659_100224704
584 Ga0070659_101123115
585 Ga0070667_100016113
586 Ga0070667_101128477
587 Ga0070709_10028035
588 Ga0070709_10367906
589 Ga0070714_100052682
590 Ga0070710_10074781
591 Ga0070701_10048396
592 Ga0070701_10833230
593 Ga0070711_100116162
594 Ga0070705_100325661
595 Ga0070700_100083923
596 Ga0070700_100222507
597 Ga0070700_100228881
598 Ga0070694_100022377
599 Ga0070694_100048195
600 Ga0070694_101145715
601 Ga0070708_100000016
602 Ga0070708_100112417
603 Ga0070708_100268124
604 Ga0070663_100128989
605 Ga0070678_100058100
606 Ga0070678_100179886
607 Ga0070662_100015437
608 Ga0070662_100052909
609 Ga0070662_100098445
610 Ga0070662_100285234
611 Ga0070681_10031189
612 Ga0070681_10175889
613 Ga0070681_10283066
614 Ga0070681_10328517
615 Ga0070681_10482824
616 Ga0070681_10593583
617 Ga0068867_100198573
618 Ga0068867_100502602
619 Ga0068867_101185833
620 Ga0068867_101674789
621 Ga0070706_100013997
622 Ga0070706_100292578
623 Ga0070706_100845167
624 Ga0070707_100000189
625 Ga0070707_100322234
626 Ga0070707_100512986
627 Ga0070707_100787356
628 Ga0070707_101356642
629 Ga0070698_100023703
630 Ga0070698_100059067
631 Ga0070698_100323473
632 Ga0070698_101713275
633 Ga0070699_100030067
634 Ga0070699_100043877
635 Ga0070699_100055866
636 Ga0070699_100080203
637 Ga0070699_100489228
638 Ga0070679_100018653
639 Ga0070679_100022426
640 Ga0070679_100069166
641 Ga0070679_100070330
642 Ga0070679_100167551
643 Ga0070679_100677887
644 Ga0070679_100826680
645 Ga0070679_100902806
646 Ga0070679_101940623
647 Ga0070684_100091395
648 Ga0070684_100142213
649 Ga0070684_100199244
650 Ga0070684_101010164
651 Ga0070697_100077010
652 Ga0070697_100205803
653 Ga0070697_100355684
654 Ga0070697_100793861
655 Ga0070697_101974793
656 Ga0068853_101168237
657 Ga0068853_101237988
658 Ga0068853_101732227
659 Ga0070672_100143921
660 Ga0070686_100064711
661 Ga0070695_100023288
662 Ga0070695_100122584
663 Ga0070695_100149687
664 Ga0070696_100077508
665 Ga0070696_100347540
666 Ga0070696_100565922
667 Ga0070696_100875899
668 Ga0070693_100000720
669 Ga0070693_100098986
670 Ga0070693_100111280
671 Ga0070704_100577914
672 Ga0068855_100004418
673 Ga0068855_100300321
674 Ga0068855_100365976
675 Ga0068855_100893761
676 Ga0068855_100980907
677 Ga0068855_101778622
678 Ga0068855_101868560
679 Ga0070664_100036841
680 Ga0070664_100273157
681 Ga0070664_100343728
682 Ga0068857_100011024
683 Ga0068857_100155867
684 Ga0068854_100295567
685 Ga0068854_101118396
686 Ga0068856_100222475
687 Ga0070702_100007743
688 Ga0070702_100074886
689 Ga0070702_100455809
690 Ga0068852_100024887
691 Ga0068852_100325387
692 Ga0068852_100391366
693 Ga0068852_101114602
694 Ga0068859_100117474
695 Ga0068864_100475393
696 Ga0068866_10041598
697 Ga0068866_10671537
698 Ga0068861_100708811
699 Ga0068863_100381018
700 Ga0068858_100436939
701 Ga0068860_101820185
702 Ga0068862_100961010
703 Ga0081455_10404325
704 Ga0075432_10193947
705 Ga0070715_10708948
706 Ga0070716_100003880
707 Ga0070716_100610642
708 Ga0070712_100110305
709 Ga0070712_100118310
710 Ga0097621_100299795
711 Ga0097621_101888693
712 Ga0068871_100850879
713 Ga0075433_10636311
714 Ga0075434_100301631
715 Ga0075429_101845161
716 Ga0068865_100262112
717 Ga0068865_100285443
718 Ga0068865_101396735
719 Ga0075436_100001657
720 Ga0097620_100117470
721 Ga0075435_100167338
722 Ga0075435_101006179
723 Ga0099795_10141057
724 Ga0105240_10031903
725 Ga0105240_10060055
726 Ga0105245_10025920
727 Ga0105245_10723954
728 Ga0105245_12222347
729 Ga0114129_10230459
730 Ga0105241_10213713
731 Ga0105241_10275506
732 Ga0105241_10428689
733 Ga0105241_10522651
734 Ga0105242_10980449
735 Ga0105248_10236182
736 Ga0105248_11379025
737 Ga0105238_10008881
738 Ga0099796_10007401
739 Ga0105239_10624554
740 Ga0105246_12280844
741 Ga0157373_10173231
742 Ga0157373_10234924
743 Ga0157373_10263230
744 Ga0157373_10771143
745 Ga0157371_10057187
746 Ga0157371_10198591
747 Ga0157370_10365494
748 Ga0157370_10433324
749 Ga0157369_10429962
750 Ga0157369_10476915
751 Ga0157369_11392083
752 Ga0157374_10251562
753 Ga0157374_10497914
754 Ga0157378_10014816
755 Ga0157378_10026973
756 Ga0157378_10168152
757 Ga0157378_10196544
758 Ga0157378_11460099
759 Ga0157378_11568979
760 Ga0163162_11177102
761 Ga0157372_10001133
762 Ga0157372_10032606
763 Ga0157372_10046539
764 Ga0157372_10103592
765 Ga0157372_10249721
766 Ga0157372_10389926
767 Ga0157372_13204091
768 Ga0157375_10042979
769 Ga0157375_10301350
770 Ga0157375_12242971
771 Ga0157380_11613173
772 Ga0182008_10068287
773 Ga0207692_10076311
774 Ga0207642_10311227
775 Ga0207642_10397734
776 Ga0207699_10213836
777 Ga0207645_10002896
778 Ga0207645_10443822
779 Ga0207645_10713650
780 Ga0207705_10002292
781 Ga0207705_10342982
782 Ga0207684_10068274
783 Ga0207684_10348236
784 Ga0207654_11438284
785 Ga0207707_10003918
786 Ga0207707_10056601
787 Ga0207707_10108280
788 Ga0207707_10277534
789 Ga0207707_10325481
790 Ga0207707_10387649
791 Ga0207707_10584441
792 Ga0207707_10807780
793 Ga0207695_10014103
794 Ga0207695_10736713
795 Ga0207663_10048172
796 Ga0207660_10023605
797 Ga0207660_10182642
798 Ga0207660_10231961
799 Ga0207660_10273370
800 Ga0207660_10383160
801 Ga0207660_10619541
802 Ga0207662_10156179
803 Ga0207662_10855845
804 Ga0207657_10000713
805 Ga0207657_10544266
806 Ga0207649_10043501
807 Ga0207649_10078276
808 Ga0207649_10422365
809 Ga0207649_10537236
810 Ga0207649_10980127
811 Ga0207652_10012839
812 Ga0207652_10029628
813 Ga0207652_10077867
814 Ga0207652_10182295
815 Ga0207652_10334944
816 Ga0207652_11029413
817 Ga0207646_10002475
818 Ga0207646_10137019
819 Ga0207681_10018645
820 Ga0207694_10509590
821 Ga0207650_10210346
822 Ga0207650_10689864
823 Ga0207659_10720103
824 Ga0207687_10059024
825 Ga0207687_10209301
826 Ga0207687_10356319
827 Ga0207664_10067845
828 Ga0207644_10198659
829 Ga0207644_11073827
830 Ga0207690_10255495
831 Ga0207690_10585726
832 Ga0207690_11058753
833 Ga0207706_10000985
834 Ga0207706_10068456
835 Ga0207706_10146764
836 Ga0207686_10068117
837 Ga0207669_10195877
838 Ga0207704_10036739
839 Ga0207704_10042141
840 Ga0207704_11057021
841 Ga0207665_10000515
842 Ga0207691_10119476
843 Ga0207711_10380574
844 Ga0207711_10395759
845 Ga0207689_10367170
846 Ga0207661_10035399
847 Ga0207661_10166941
848 Ga0207661_10364645
849 Ga0207661_10385317
850 Ga0207661_10547572
851 Ga0207679_10392106
852 Ga0207679_10425849
853 Ga0207667_10014828
854 Ga0207667_10015877
855 Ga0207667_10437716
856 Ga0207667_10768852
857 Ga0207667_11747064
858 Ga0207651_10168797
859 Ga0207712_10852674
860 Ga0207640_10006098
861 Ga0207640_11342835
862 Ga0207658_10999335
863 Ga0207677_10017278
864 Ga0207677_10754609
865 Ga0207677_10954996
866 Ga0207703_10641100
867 Ga0207639_10440915
868 Ga0207639_10619205
869 Ga0207678_10002110
870 Ga0207708_10172147
871 Ga0207708_10273678
872 Ga0207708_11154193
873 Ga0207702_10532440
874 Ga0207702_11885506
875 Ga0207648_10012572
876 Ga0207648_10105365
877 Ga0207648_10898394
878 Ga0207648_11341598
879 Ga0207676_10475257
880 Ga0207674_10011376
881 Ga0207674_10143171
882 Ga0207674_10862655
883 Ga0207675_100426293
884 Ga0207683_10058553
885 Ga0207683_10729520
886 Ga0207698_10009193
887 Ga0207698_10024681
888 Ga0207698_10407634
889 Ga0209967_1002530
890 Ga0209981_1013156
891 Ga0209996_1016897
892 Ga0209984_1026942
893 Ga0210000_1005065
894 Ga0209999_1011374
895 Ga0209970_1014070
896 Ga0307405_10023308
897 Ga0307413_11656968
898 Ga0307410_10011425
899 Ga0307410_10263802
900 Ga0307410_10266339
901 Ga0307410_11520271
902 Ga0307406_10073344
903 Ga0307406_10368152
904 Ga0307406_11781475
905 Ga0307407_10131638
906 Ga0307407_10372208
907 Ga0307412_10041120
908 Ga0307412_10630994
909 Ga0307409_100038117
910 Ga0307409_102712966
911 Ga0307416_100559791
912 Ga0307416_102924512
913 Ga0307414_10023203
914 Ga0307414_11063334
915 Ga0307414_11275359
916 Ga0307411_10206701
917 Ga0307411_10480784
918 Ga0307415_100108146
919 Ga0307415_100141836
920 Ga0307415_101588679
921 Ga0373958_0119312
922 Ga0373959_0016573
923 Ga0373959_0041935
924 Ga0373929_0033896
925 Ga0373940_0113114
926 Ga0373941_0030136
927 Ga0373941_0065173
928 Ga0373960_0072760
929 Ga0373960_0305197
930 Ga0373943_0105911
931 Ga0373946_0060041
932 Ga0373942_0135139
933 Ga0373961_0071523
934 Ga0373935_0041973
935 Ga0436365_0495229
936 Ga0451839_1622833
937 Ga0466966_0040190
938 Ga0466966_0924552
939 Ga0466961_0027061
940 Ga0466971_0061147
941 Ga0466959_0008435
942 Ga0466959_0063261
943 Ga0451576_1472432
944 Ga0466958_0333186
945 Ga0495639_0294164
946 Ga0495662_0045196
947 Ga0495664_0067681
948 Ga0495594_0144847
949 Ga0495586_0371406
950 Ga0495586_0802959
951 Ga0495587_0018943
952 Ga0495659_0178051
953 Ga0495588_0192156
954 Ga0495669_0172718
955 Ga0495600_0119973
956 Ga0495581_0148342
957 Ga0495614_0259889
958 Ga0496112_0005796
959 Ga0496112_0110637
960 Ga0496113_0257679
961 Ga0496115_0187596
962 Ga0501292_005688
963 Ga0501032_0355316
964 Ga0501037_0214598
965 Ga0501046_0195282
966 Ga0501047_0060364
967 Ga0501069_0574102
968 Ga0501201_003498
969 Ga0501202_000890
970 Ga0501209_003108
971 Ga0501210_001787
972 Ga0501216_000165
973 Ga0501217_000864
974 Ga0501222_001589
975 Ga0501223_002577
976 Ga0501224_003096
977 Ga0501228_001134
978 Ga0501233_003981
979 Ga0501233_175973
980 Ga0501235_001296
981 Ga0501240_005255
982 Ga0501242_000289
983 Ga0501248_005790
984 Ga0501248_023011
985 Ga0501249_001854
986 Ga0501251_005211
987 Ga0501252_002877
988 Ga0501253_002066
989 Ga0501253_152823
990 Ga0501257_000806
991 Ga0501258_000284
992 Ga0501259_005291
993 Ga0501260_000451
994 Ga0501261_002200
995 Ga0501221_003091
996 Ga0501225_0004539
997 Ga0501245_005888
998 Ga0501232_005462
999 Ga0501241_006309
1000 Ga0501262_002612
1001 Ga0501263_000502
1002 Ga0501264_016320
1003 Ga0501266_001028
1004 Ga0501267_013367
1005 Ga0501268_000021
1006 Ga0501270_002431
1007 Ga0501270_013913
1008 Ga0501271_012346
1009 Ga0501272_005074
1010 Ga0501274_002048
1011 Ga0501274_007919
1012 Ga0501275_024599
1013 Ga0501276_044489
1014 Ga0501279_004264
1015 Ga0501280_133957
1016 Ga0501204_004850
1017 Ga0501212_000492
1018 nmdc:mga05p37_807021_c1
1019 nmdc:mga0n895_77639_c1
1020 nmdc:mga0rr50_217030_c1
1021 nmdc:mga0rr50_41795_c1
1022 nmdc:mga08x19_326230_c1
1023 nmdc:mga08x19_6184_c1
1024 nmdc:mga08x19_621422_c1
1025 nmdc:mga0a205_165969_c1
1026 Ga0466962_0238118

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03626

COX4_pro

Prokaryotic Cytochrome C oxidase subunit IV

35

108

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wti-assembly1.cif.gz_D the cryo-em structure of the ubiquinol oxidase from escherichia coli 0.6885 20 110
7agx-assembly1.cif.gz_1N apo-state type 3 secretion system export apparatus complex from salmonella enterica typhimurium 0.6688 24 89
7agx-assembly1.cif.gz_1O apo-state type 3 secretion system export apparatus complex from salmonella enterica typhimurium 0.6621 24 89
7ah9-assembly1.cif.gz_1L substrate-engaged type 3 secretion system needle complex from salmonella enterica typhimurium - spar state 1 0.653 24 101
7ahi-assembly1.cif.gz_1N substrate-engaged type 3 secretion system needle complex from salmonella enterica typhimurium - spar state 2 0.65 24 101
ID Description Score Start End Superfamily
af_D6VTK4_31_110_1.10.287.920 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Pheromone alpha factor receptor. 0.5677 1 81 1.10.287.920
af_D6VTK4_31_110_1.10.287.920 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Pheromone alpha factor receptor. 0.5279 1 81 1.10.287.920
af_A0A1D8PKC6_573_706_1.20.58.1520 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5182 7 69 1.20.58.1520
af_Q9XVD7_18_285_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4817 6 74 1.20.1070.10
af_I1N1W5_186_378_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4365 21 113 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A143BHN9-F1-model_v4 Cytochrome C oxidase subunit IV 0.755 1 109 GO:0005886
AF-A0A143BHN9-F1-model_v4 Cytochrome C oxidase subunit IV 0.6999 1 109 GO:0005886
AF-A0A523PKF7-F1-model_v4 Cytochrome C oxidase subunit IV 0.6994 18 103 GO:0005886
AF-A0A2V7JMW0-F1-model_v4 Cytochrome C oxidase subunit IV 0.6653 1 112 GO:0005886
AF-A0A1Q7V9V6-F1-model_v4 Cytochrome C oxidase subunit IV 0.6579 1 112 GO:0005886

Map