F457506
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 512 | 357 | 443 | 301 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8019659431|8019667693 |
| Length | 360 |
| Sequence | PPLIELRAFEAAARHLSFKKAAAELGVTPTAISHQIVLLEQYCGRALFRRRPRPLSLTDAGARLFPAIRGGLEVFAAAIAAVRRDTDQQPLRVTTTNAFASRWLVPRLPAWRKLHPDVPLEVIGTDTVLDLHAGDGDVAIRYATSRVLPTDGIVNDLFSDTFWPVCNPRLLSTGRLKRPVDLANHVLIHSYWSPADREPPTWQRWFAVAQRRWREVPQFKDMQHLSFREELHAIEAVIAGQGVGIFSDVLVAHELAASTLVKAFKLSLSGYSFHVVSRPSHPRAKTIRTFSEMVAVKCLIRFFCAFEMFARRQNAKNSAWANLVRCARLSGLDKACADFASGFISSHCEFGSVFECTDPH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 2 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 3 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 4 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 5 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 6 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 7 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 8 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 9 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 10 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 11 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 12 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 13 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 14 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 15 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 16 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 17 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 18 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 19 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 20 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 21 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 22 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 23 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 24 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 25 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 26 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 27 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 28 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 29 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 30 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 31 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 32 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 33 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 34 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 35 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 36 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 37 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 38 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 39 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 40 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 41 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 42 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 43 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 44 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 45 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 46 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 47 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 48 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 49 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 50 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 51 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 52 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 53 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 54 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 55 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 56 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 57 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 58 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 59 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 60 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 61 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 62 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 66 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 68 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 111 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 124 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 125 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 153 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 154 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 155 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 156 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 207 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 208 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 209 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 210 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 233 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 234 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 307 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 308 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 309 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 310 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 311 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 312 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 321 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 323 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 335 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 338 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 339 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 340 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 341 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 342 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 343 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 344 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 345 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 347 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 348 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 349 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 350 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 351 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 352 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 353 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 354 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 355 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 356 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 357 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.52 |
| Metatranscriptomes | 0 |
| Isolates | 13.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.27 |
| Nodule | 9.77 |
| Rhizoplane | 4.3 |
| Rhizosphere | 70.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25157J39369_1001347 | 3300002741 | Bacteria | 9698 |
| 2 | rootL2_10037332 | 3300003322 | Bacteria | 3955 |
| 3 | rootH1_10050544 | 3300003323 | Bacteria | 3368 |
| 4 | Ga0070658_10096082 | 3300005327 | Bacteria | 2446 |
| 5 | Ga0070683_100021732 | 3300005329 | Bacteria | 5729 |
| 6 | Ga0070670_100184225 | 3300005331 | Bacteria | 1813 |
| 7 | Ga0068869_100244238 | 3300005334 | Bacteria | 1431 |
| 8 | Ga0070680_100166575 | 3300005336 | Bacteria | 1853 |
| 9 | Ga0070680_100272846 | 3300005336 | Unclassified | 1432 |
| 10 | Ga0068868_100026122 | 3300005338 | Bacteria | 4447 |
| 11 | Ga0070660_100025489 | 3300005339 | Bacteria | 4395 |
| 12 | Ga0070660_100035784 | 3300005339 | Bacteria | 3759 |
| 13 | Ga0070660_100265580 | 3300005339 | Bacteria | 1402 |
| 14 | Ga0070691_10061597 | 3300005341 | Bacteria | 1805 |
| 15 | Ga0070691_10113516 | 3300005341 | Bacteria | 1357 |
| 16 | Ga0070661_100410803 | 3300005344 | Bacteria | 1072 |
| 17 | Ga0070668_100230875 | 3300005347 | Bacteria | 1530 |
| 18 | Ga0070671_100097434 | 3300005355 | Bacteria | 2466 |
| 19 | Ga0070659_100058902 | 3300005366 | Bacteria | 3032 |
| 20 | Ga0070659_100470967 | 3300005366 | Bacteria | 1068 |
| 21 | Ga0070709_10005233 | 3300005434 | Bacteria | 7020 |
| 22 | Ga0070714_100199418 | 3300005435 | Bacteria | 1830 |
| 23 | Ga0070713_100441411 | 3300005436 | Bacteria | 1221 |
| 24 | Ga0070711_100009618 | 3300005439 | Bacteria | 5956 |
| 25 | Ga0070711_100183253 | 3300005439 | Bacteria | 1604 |
| 26 | Ga0070708_100222077 | 3300005445 | Bacteria | 1772 |
| 27 | Ga0070663_100054048 | 3300005455 | Bacteria | 2869 |
| 28 | Ga0070663_100236290 | 3300005455 | Bacteria | 1441 |
| 29 | Ga0070678_100104609 | 3300005456 | Bacteria | 2202 |
| 30 | Ga0070681_10094056 | 3300005458 | Bacteria | 2946 |
| 31 | Ga0070706_100194888 | 3300005467 | Unclassified | 1893 |
| 32 | Ga0070706_100553831 | 3300005467 | Bacteria | 1070 |
| 33 | Ga0070707_100054322 | 3300005468 | Bacteria | 3840 |
| 34 | Ga0070698_100034868 | 3300005471 | Bacteria | 5205 |
| 35 | Ga0070699_100233916 | 3300005518 | Bacteria | 1639 |
| 36 | Ga0070699_100427553 | 3300005518 | Bacteria | 1199 |
| 37 | Ga0070679_100107280 | 3300005530 | Bacteria | 2778 |
| 38 | Ga0070679_100359065 | 3300005530 | Unclassified | 1404 |
| 39 | Ga0070684_100037298 | 3300005535 | Bacteria | 4169 |
| 40 | Ga0070684_100063099 | 3300005535 | Bacteria | 3247 |
| 41 | Ga0070697_100456825 | 3300005536 | Bacteria | 1113 |
| 42 | Ga0068853_100107365 | 3300005539 | Bacteria | 2475 |
| 43 | Ga0070686_100226102 | 3300005544 | Bacteria | 1355 |
| 44 | Ga0070695_100020354 | 3300005545 | Bacteria | 4050 |
| 45 | Ga0070695_100077264 | 3300005545 | Bacteria | 2194 |
| 46 | Ga0070665_100043439 | 3300005548 | Bacteria | 4518 |
| 47 | Ga0070665_100153383 | 3300005548 | Bacteria | 2306 |
| 48 | Ga0068855_100149853 | 3300005563 | Bacteria | 2652 |
| 49 | Ga0068855_100501727 | 3300005563 | Bacteria | 1318 |
| 50 | Ga0070664_100097429 | 3300005564 | Bacteria | 2553 |
| 51 | Ga0068857_100026661 | 3300005577 | Bacteria | 5093 |
| 52 | Ga0068857_100564312 | 3300005577 | Bacteria | 1073 |
| 53 | Ga0068854_100172970 | 3300005578 | Bacteria | 1682 |
| 54 | Ga0068856_100050075 | 3300005614 | Bacteria | 4117 |
| 55 | Ga0068852_100014091 | 3300005616 | Bacteria | 6138 |
| 56 | Ga0068852_100136055 | 3300005616 | Bacteria | 2269 |
| 57 | Ga0068859_100069418 | 3300005617 | Bacteria | 3559 |
| 58 | Ga0068864_100009204 | 3300005618 | Bacteria | 8145 |
| 59 | Ga0068861_100063555 | 3300005719 | Bacteria | 2838 |
| 60 | Ga0068861_100218134 | 3300005719 | Bacteria | 1611 |
| 61 | Ga0068851_10136641 | 3300005834 | Bacteria | 1330 |
| 62 | Ga0068860_100019679 | 3300005843 | Bacteria | 6545 |
| 63 | Ga0081455_10014776 | 3300005937 | Bacteria | 7618 |
| 64 | Ga0081455_10036809 | 3300005937 | Bacteria | 4352 |
| 65 | Ga0081540_1003843 | 3300005983 | Bacteria | 11743 |
| 66 | Ga0081540_1053709 | 3300005983 | Bacteria | 1973 |
| 67 | Ga0075365_10003792 | 3300006038 | Bacteria | 7882 |
| 68 | Ga0075364_10015317 | 3300006051 | Bacteria | 4753 |
| 69 | Ga0070716_100226603 | 3300006173 | Bacteria | 1259 |
| 70 | Ga0070712_100315992 | 3300006175 | Unclassified | 1269 |
| 71 | Ga0075362_10084896 | 3300006177 | Bacteria | 1463 |
| 72 | Ga0075367_10214093 | 3300006178 | Bacteria | 1205 |
| 73 | Ga0097621_100254757 | 3300006237 | Bacteria | 1538 |
| 74 | Ga0075370_10022057 | 3300006353 | Bacteria | 3492 |
| 75 | Ga0075428_100001655 | 3300006844 | Bacteria | 23712 |
| 76 | Ga0075428_100011074 | 3300006844 | Bacteria | 10033 |
| 77 | Ga0075428_100049115 | 3300006844 | Bacteria | 4630 |
| 78 | Ga0075428_100132500 | 3300006844 | Bacteria | 2710 |
| 79 | Ga0075430_100243428 | 3300006846 | Unclassified | 1490 |
| 80 | Ga0075430_100318093 | 3300006846 | Bacteria | 1287 |
| 81 | Ga0075431_100000251 | 3300006847 | Bacteria | 40790 |
| 82 | Ga0075431_100002605 | 3300006847 | Bacteria | 17444 |
| 83 | Ga0075431_100069941 | 3300006847 | Unclassified | 3621 |
| 84 | Ga0075431_100131788 | 3300006847 | Bacteria | 2578 |
| 85 | Ga0075431_100210040 | 3300006847 | Bacteria | 1989 |
| 86 | Ga0075431_100321807 | 3300006847 | Bacteria | 1559 |
| 87 | Ga0075434_100248633 | 3300006871 | Bacteria | 1797 |
| 88 | Ga0075429_100001930 | 3300006880 | Bacteria | 17187 |
| 89 | Ga0075429_100113931 | 3300006880 | Bacteria | 2363 |
| 90 | Ga0075429_100262989 | 3300006880 | Bacteria | 1511 |
| 91 | Ga0075429_100300106 | 3300006880 | Unclassified | 1406 |
| 92 | Ga0075436_100217374 | 3300006914 | Bacteria | 1356 |
| 93 | Ga0097620_100069414 | 3300006931 | Bacteria | 3559 |
| 94 | Ga0099824_1005150 | 3300006942 | Bacteria | 18530 |
| 95 | Ga0075435_100043122 | 3300007076 | Bacteria | 3611 |
| 96 | Ga0075435_100376158 | 3300007076 | Bacteria | 1220 |
| 97 | Ga0099794_10004680 | 3300007265 | Bacteria | 5417 |
| 98 | Ga0099794_10010178 | 3300007265 | Bacteria | 3984 |
| 99 | Ga0099795_10001073 | 3300007788 | Bacteria | 5654 |
| 100 | Ga0099795_10050007 | 3300007788 | Bacteria | 1518 |
| 101 | Ga0105251_10101294 | 3300009011 | Bacteria | 1316 |
| 102 | Ga0105240_10031664 | 3300009093 | Bacteria | 6854 |
| 103 | Ga0111539_10001595 | 3300009094 | Bacteria | 30229 |
| 104 | Ga0111539_10152203 | 3300009094 | Bacteria | 2707 |
| 105 | Ga0111539_10563052 | 3300009094 | Bacteria | 1327 |
| 106 | Ga0111539_10636150 | 3300009094 | Bacteria | 1242 |
| 107 | Ga0105245_10042164 | 3300009098 | Bacteria | 4071 |
| 108 | Ga0105247_10077438 | 3300009101 | Bacteria | 2090 |
| 109 | Ga0114129_10000066 | 3300009147 | Bacteria | 93802 |
| 110 | Ga0114129_10012594 | 3300009147 | Bacteria | 12042 |
| 111 | Ga0114129_10240543 | 3300009147 | Bacteria | 2433 |
| 112 | Ga0114129_10249794 | 3300009147 | Bacteria | 2382 |
| 113 | Ga0114129_10256323 | 3300009147 | Bacteria | 2346 |
| 114 | Ga0114129_10935769 | 3300009147 | Bacteria | 1096 |
| 115 | Ga0105241_10265300 | 3300009174 | Bacteria | 1461 |
| 116 | Ga0105241_10327650 | 3300009174 | Bacteria | 1323 |
| 117 | Ga0105242_10364013 | 3300009176 | Unclassified | 1339 |
| 118 | Ga0105248_10318594 | 3300009177 | Bacteria | 1751 |
| 119 | Ga0105248_10328910 | 3300009177 | Bacteria | 1721 |
| 120 | Ga0105237_10027556 | 3300009545 | Bacteria | 5798 |
| 121 | Ga0105237_10144018 | 3300009545 | Bacteria | 2377 |
| 122 | Ga0105237_10176087 | 3300009545 | Bacteria | 2139 |
| 123 | Ga0105237_10404197 | 3300009545 | Bacteria | 1370 |
| 124 | Ga0105238_10153397 | 3300009551 | Bacteria | 2279 |
| 125 | Ga0105249_10085145 | 3300009553 | Bacteria | 2945 |
| 126 | Ga0105249_10118371 | 3300009553 | Bacteria | 2514 |
| 127 | Ga0099796_10001125 | 3300010159 | Bacteria | 5154 |
| 128 | Ga0105239_10050236 | 3300010375 | Bacteria | 4574 |
| 129 | Ga0105239_10079141 | 3300010375 | Bacteria | 3617 |
| 130 | Ga0105239_10215995 | 3300010375 | Bacteria | 2150 |
| 131 | Ga0105239_10485277 | 3300010375 | Bacteria | 1404 |
| 132 | Ga0105246_10154985 | 3300011119 | Bacteria | 1739 |
| 133 | Ga0157370_10011815 | 3300013104 | Bacteria | 9112 |
| 134 | Ga0157370_10063238 | 3300013104 | Bacteria | 3507 |
| 135 | Ga0157370_10225597 | 3300013104 | Bacteria | 1734 |
| 136 | Ga0157369_10020952 | 3300013105 | Bacteria | 7309 |
| 137 | Ga0157369_10033836 | 3300013105 | Bacteria | 5613 |
| 138 | Ga0157369_10369524 | 3300013105 | Bacteria | 1489 |
| 139 | Ga0157369_10518584 | 3300013105 | Bacteria | 1233 |
| 140 | Ga0157374_10010646 | 3300013296 | Bacteria | 7921 |
| 141 | Ga0157374_10407016 | 3300013296 | Bacteria | 1358 |
| 142 | Ga0157378_10299318 | 3300013297 | Bacteria | 1556 |
| 143 | Ga0163162_10317964 | 3300013306 | Bacteria | 1689 |
| 144 | Ga0163162_10668292 | 3300013306 | Bacteria | 1162 |
| 145 | Ga0157372_10067552 | 3300013307 | Bacteria | 4017 |
| 146 | Ga0157372_10157194 | 3300013307 | Bacteria | 2626 |
| 147 | Ga0157372_10564517 | 3300013307 | Bacteria | 1327 |
| 148 | Ga0157375_10077081 | 3300013308 | Bacteria | 3362 |
| 149 | Ga0157375_10179371 | 3300013308 | Bacteria | 2269 |
| 150 | Ga0157375_10273565 | 3300013308 | Bacteria | 1851 |
| 151 | Ga0157375_10487860 | 3300013308 | Bacteria | 1397 |
| 152 | Ga0163163_10212578 | 3300014325 | Bacteria | 1983 |
| 153 | Ga0163163_10266172 | 3300014325 | Bacteria | 1765 |
| 154 | Ga0182008_10035739 | 3300014497 | Bacteria | 2487 |
| 155 | Ga0157379_10220431 | 3300014968 | Bacteria | 1719 |
| 156 | Ga0157376_10132033 | 3300014969 | Bacteria | 2230 |
| 157 | Ga0182006_1040741 | 3300015261 | Bacteria | 1827 |
| 158 | Ga0214544_1000009 | 3300021320 | Bacteria | 285865 |
| 159 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 160 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 161 | Ga0214543_1000013 | 3300021327 | Bacteria | 329117 |
| 162 | Ga0209026_1000118 | 3300025250 | Bacteria | 130611 |
| 163 | Ga0209148_1014455 | 3300025254 | Bacteria | 1394 |
| 164 | Ga0209759_1000076 | 3300025256 | Bacteria | 175911 |
| 165 | Ga0209025_1016466 | 3300025294 | Bacteria | 4358 |
| 166 | Ga0209564_1036572 | 3300025295 | Bacteria | 1399 |
| 167 | Ga0209758_1000808 | 3300025297 | Bacteria | 44084 |
| 168 | Ga0207656_10031840 | 3300025321 | Bacteria | 2188 |
| 169 | Ga0207710_10063492 | 3300025900 | Bacteria | 1680 |
| 170 | Ga0207710_10110625 | 3300025900 | Bacteria | 1304 |
| 171 | Ga0207705_10035840 | 3300025909 | Bacteria | 3550 |
| 172 | Ga0207705_10175106 | 3300025909 | Bacteria | 1617 |
| 173 | Ga0207684_10105256 | 3300025910 | Unclassified | 2413 |
| 174 | Ga0207707_10004215 | 3300025912 | Bacteria | 12726 |
| 175 | Ga0207707_10074204 | 3300025912 | Bacteria | 2967 |
| 176 | Ga0207695_10108446 | 3300025913 | Bacteria | 2761 |
| 177 | Ga0207671_10038989 | 3300025914 | Bacteria | 3520 |
| 178 | Ga0207671_10051739 | 3300025914 | Bacteria | 3044 |
| 179 | Ga0207693_10020887 | 3300025915 | Bacteria | 5205 |
| 180 | Ga0207693_10026715 | 3300025915 | Bacteria | 4567 |
| 181 | Ga0207663_10020497 | 3300025916 | Bacteria | 3744 |
| 182 | Ga0207663_10069465 | 3300025916 | Bacteria | 2266 |
| 183 | Ga0207663_10161069 | 3300025916 | Bacteria | 1584 |
| 184 | Ga0207660_10233871 | 3300025917 | Unclassified | 1446 |
| 185 | Ga0207657_10006008 | 3300025919 | Bacteria | 12636 |
| 186 | Ga0207657_10018110 | 3300025919 | Bacteria | 6738 |
| 187 | Ga0207652_10181986 | 3300025921 | Unclassified | 1889 |
| 188 | Ga0207646_10219228 | 3300025922 | Bacteria | 1719 |
| 189 | Ga0207681_10136920 | 3300025923 | Bacteria | 1819 |
| 190 | Ga0207687_10069766 | 3300025927 | Bacteria | 2507 |
| 191 | Ga0207664_10119204 | 3300025929 | Bacteria | 2206 |
| 192 | Ga0207644_10065924 | 3300025931 | Bacteria | 2635 |
| 193 | Ga0207644_10269560 | 3300025931 | Bacteria | 1364 |
| 194 | Ga0207690_10036556 | 3300025932 | Bacteria | 3181 |
| 195 | Ga0207690_10119809 | 3300025932 | Bacteria | 1910 |
| 196 | Ga0207690_10192996 | 3300025932 | Bacteria | 1541 |
| 197 | Ga0207670_10391557 | 3300025936 | Bacteria | 1109 |
| 198 | Ga0207669_10098355 | 3300025937 | Bacteria | 1927 |
| 199 | Ga0207665_10164376 | 3300025939 | Bacteria | 1599 |
| 200 | Ga0207689_10026622 | 3300025942 | Bacteria | 4845 |
| 201 | Ga0207661_10018806 | 3300025944 | Bacteria | 5140 |
| 202 | Ga0207679_10201653 | 3300025945 | Bacteria | 1662 |
| 203 | Ga0207679_10253860 | 3300025945 | Bacteria | 1496 |
| 204 | Ga0207712_10360085 | 3300025961 | Bacteria | 1212 |
| 205 | Ga0207668_10300836 | 3300025972 | Bacteria | 1324 |
| 206 | Ga0207677_10233886 | 3300026023 | Bacteria | 1482 |
| 207 | Ga0207677_10258662 | 3300026023 | Bacteria | 1418 |
| 208 | Ga0207703_10194122 | 3300026035 | Bacteria | 1800 |
| 209 | Ga0207639_10228969 | 3300026041 | Bacteria | 1610 |
| 210 | Ga0207678_10071668 | 3300026067 | Bacteria | 2971 |
| 211 | Ga0207678_10117152 | 3300026067 | Bacteria | 2273 |
| 212 | Ga0207678_10351427 | 3300026067 | Bacteria | 1271 |
| 213 | Ga0207702_10037716 | 3300026078 | Bacteria | 4046 |
| 214 | Ga0207702_10572895 | 3300026078 | Bacteria | 1106 |
| 215 | Ga0207676_10027290 | 3300026095 | Bacteria | 4252 |
| 216 | Ga0207674_10154232 | 3300026116 | Bacteria | 2252 |
| 217 | Ga0207674_10586680 | 3300026116 | Bacteria | 1077 |
| 218 | Ga0207675_100100251 | 3300026118 | Bacteria | 2728 |
| 219 | Ga0207675_100215384 | 3300026118 | Bacteria | 1849 |
| 220 | Ga0207698_10431546 | 3300026142 | Bacteria | 1267 |
| 221 | Ga0209389_1000026 | 3300027296 | Bacteria | 147580 |
| 222 | Ga0209389_1000117 | 3300027296 | Bacteria | 71506 |
| 223 | Ga0209589_1000022 | 3300027357 | Bacteria | 180757 |
| 224 | Ga0209489_100058 | 3300027361 | Bacteria | 147117 |
| 225 | Ga0209489_102405 | 3300027361 | Bacteria | 38216 |
| 226 | Ga0209700_100021 | 3300027363 | Bacteria | 230859 |
| 227 | Ga0207428_10000891 | 3300027907 | Bacteria | 33501 |
| 228 | Ga0268266_10017370 | 3300028379 | Bacteria | 6139 |
| 229 | Ga0268265_10135323 | 3300028380 | Bacteria | 2055 |
| 230 | Ga0268264_10002781 | 3300028381 | Bacteria | 15267 |
| 231 | Ga0268264_10046387 | 3300028381 | Bacteria | 3609 |
| 232 | Ga0307515_10055973 | 3300028794 | Bacteria | 5745 |
| 233 | Ga0307511_10100627 | 3300030521 | Bacteria | 1900 |
| 234 | Ga0307509_10060170 | 3300031507 | Bacteria | 4015 |
| 235 | Ga0307516_10214287 | 3300031730 | Bacteria | 1638 |
| 236 | Ga0307507_10007804 | 3300033179 | Bacteria | 15233 |
| 237 | Ga0373934_0008273 | 3300035086 | Bacteria | 3874 |
| 238 | Ga0373934_0041096 | 3300035086 | Bacteria | 1825 |
| 239 | Ga0373923_0099078 | 3300035111 | Bacteria | 1283 |
| 240 | Ga0373936_0016796 | 3300035113 | Bacteria | 2817 |
| 241 | Ga0373941_0006720 | 3300035115 | Bacteria | 2782 |
| 242 | Ga0373954_0006543 | 3300035118 | Bacteria | 5078 |
| 243 | Ga0373954_0041691 | 3300035118 | Bacteria | 2141 |
| 244 | Ga0373956_0021579 | 3300035119 | Bacteria | 2747 |
| 245 | Ga0373957_0168131 | 3300035120 | Bacteria | 905 |
| 246 | Ga0373943_0010120 | 3300035170 | Bacteria | 4231 |
| 247 | Ga0373946_0003431 | 3300035171 | Bacteria | 5623 |
| 248 | Ga0373955_0005698 | 3300035172 | Bacteria | 5606 |
| 249 | Ga0373955_0038979 | 3300035172 | Bacteria | 2534 |
| 250 | Ga0373924_0020308 | 3300035410 | Bacteria | 2580 |
| 251 | Ga0373931_0002116 | 3300035691 | Bacteria | 8744 |
| 252 | Ga0373931_0304737 | 3300035691 | Bacteria | 985 |
| 253 | Ga0373935_0000128 | 3300035692 | Bacteria | 34347 |
| 254 | Ga0373935_0096496 | 3300035692 | Bacteria | 1943 |
| 255 | Ga0373927_0013611 | 3300035695 | Bacteria | 5402 |
| 256 | Ga0373927_0013957 | 3300035695 | Bacteria | 5328 |
| 257 | Ga0373927_0040008 | 3300035695 | Bacteria | 3042 |
| 258 | Ga0373947_0006253 | 3300035725 | Bacteria | 6924 |
| 259 | Ga0373937_0027072 | 3300036401 | Bacteria | 5182 |
| 260 | Ga0373925_0002522 | 3300037068 | Bacteria | 14617 |
| 261 | Ga0373925_0551638 | 3300037068 | Bacteria | 948 |
| 262 | Ga0395899_0003556 | 3300037312 | Bacteria | 12338 |
| 263 | Ga0395899_0023932 | 3300037312 | Bacteria | 4621 |
| 264 | Ga0395900_0005201 | 3300037418 | Bacteria | 13656 |
| 265 | Ga0395900_0194095 | 3300037418 | Bacteria | 2058 |
| 266 | Ga0395898_0011685 | 3300037466 | Bacteria | 9107 |
| 267 | Ga0395898_0051986 | 3300037466 | Bacteria | 4004 |
| 268 | Ga0395898_0086408 | 3300037466 | Bacteria | 3023 |
| 269 | Ga0395898_0238381 | 3300037466 | Bacteria | 1735 |
| 270 | Ga0395905_0009284 | 3300037471 | Bacteria | 9620 |
| 271 | Ga0395905_0011866 | 3300037471 | Bacteria | 8412 |
| 272 | Ga0395905_0149891 | 3300037471 | Bacteria | 2194 |
| 273 | Ga0395901_0010742 | 3300038443 | Bacteria | 9284 |
| 274 | Ga0395901_0123098 | 3300038443 | Bacteria | 2726 |
| 275 | Ga0395901_0127349 | 3300038443 | Bacteria | 2676 |
| 276 | Ga0395901_0242049 | 3300038443 | Bacteria | 1881 |
| 277 | Ga0439465_0031326 | 3300041413 | Bacteria | 1694 |
| 278 | Ga0439448_0113312 | 3300042005 | Bacteria | 927 |
| 279 | Ga0439459_0021043 | 3300042438 | Bacteria | 1249 |
| 280 | Ga0451576_0722280 | 3300045051 | Bacteria | 1047 |
| 281 | Ga0495592_0010943 | 3300046454 | Bacteria | 6847 |
| 282 | Ga0495603_0001212 | 3300046455 | Bacteria | 15064 |
| 283 | Ga0495603_0023141 | 3300046455 | Bacteria | 3761 |
| 284 | Ga0495590_0017386 | 3300046457 | Bacteria | 2589 |
| 285 | Ga0495629_0001713 | 3300046459 | Bacteria | 17220 |
| 286 | Ga0495641_0000402 | 3300046461 | Bacteria | 36037 |
| 287 | Ga0495651_0037082 | 3300046462 | Bacteria | 3795 |
| 288 | Ga0495653_0400446 | 3300046463 | Bacteria | 873 |
| 289 | Ga0495580_0001155 | 3300046472 | Bacteria | 23222 |
| 290 | Ga0495580_0179785 | 3300046472 | Bacteria | 1461 |
| 291 | Ga0495582_0000063 | 3300046473 | Bacteria | 54381 |
| 292 | Ga0495582_0167911 | 3300046473 | Bacteria | 1249 |
| 293 | Ga0495605_0139926 | 3300046474 | Bacteria | 1086 |
| 294 | Ga0495639_0001528 | 3300046475 | Bacteria | 10322 |
| 295 | Ga0495639_0089047 | 3300046475 | Bacteria | 1446 |
| 296 | Ga0495662_0004861 | 3300046476 | Bacteria | 6732 |
| 297 | Ga0495664_0004784 | 3300046477 | Bacteria | 7407 |
| 298 | Ga0495594_0000237 | 3300046499 | Bacteria | 26610 |
| 299 | Ga0495607_0014492 | 3300046501 | Bacteria | 5125 |
| 300 | Ga0495583_0002010 | 3300046506 | Bacteria | 18560 |
| 301 | Ga0495608_0019214 | 3300046511 | Bacteria | 4705 |
| 302 | Ga0495616_0013909 | 3300046513 | Bacteria | 4522 |
| 303 | Ga0495618_0030855 | 3300046514 | Bacteria | 3350 |
| 304 | Ga0495628_0026667 | 3300046516 | Bacteria | 4707 |
| 305 | Ga0495628_0065756 | 3300046516 | Bacteria | 2835 |
| 306 | Ga0495630_0010676 | 3300046517 | Bacteria | 6631 |
| 307 | Ga0495631_0124198 | 3300046518 | Bacteria | 1110 |
| 308 | Ga0495632_0111640 | 3300046519 | Bacteria | 1283 |
| 309 | Ga0495643_0004541 | 3300046522 | Bacteria | 9662 |
| 310 | Ga0495666_0013601 | 3300046526 | Bacteria | 4058 |
| 311 | Ga0495652_0018844 | 3300046529 | Bacteria | 6151 |
| 312 | Ga0495652_0031212 | 3300046529 | Bacteria | 4667 |
| 313 | Ga0495665_0001528 | 3300046531 | Bacteria | 12332 |
| 314 | Ga0495587_0013225 | 3300046536 | Bacteria | 5187 |
| 315 | Ga0495621_0099460 | 3300046539 | Bacteria | 1105 |
| 316 | Ga0495597_0128082 | 3300046542 | Bacteria | 1054 |
| 317 | Ga0495645_0022516 | 3300046543 | Bacteria | 4559 |
| 318 | Ga0495622_0001950 | 3300046557 | Bacteria | 10129 |
| 319 | Ga0495622_0021827 | 3300046557 | Bacteria | 2982 |
| 320 | Ga0495667_0048753 | 3300046559 | Bacteria | 2796 |
| 321 | Ga0495667_0057384 | 3300046559 | Bacteria | 2559 |
| 322 | Ga0495634_0000645 | 3300046642 | Bacteria | 33906 |
| 323 | Ga0495634_0021060 | 3300046642 | Bacteria | 4616 |
| 324 | Ga0495625_0023844 | 3300046660 | Bacteria | 4669 |
| 325 | Ga0495625_0223192 | 3300046660 | Bacteria | 1234 |
| 326 | Ga0495635_0000640 | 3300046663 | Bacteria | 22461 |
| 327 | Ga0495635_0005172 | 3300046663 | Bacteria | 9080 |
| 328 | Ga0495635_0127405 | 3300046663 | Bacteria | 1736 |
| 329 | Ga0495588_0015704 | 3300046674 | Bacteria | 3650 |
| 330 | Ga0495588_0050239 | 3300046674 | Bacteria | 2145 |
| 331 | Ga0495657_0024471 | 3300046675 | Bacteria | 4299 |
| 332 | Ga0495599_0045305 | 3300046678 | Bacteria | 2758 |
| 333 | Ga0495599_0118214 | 3300046678 | Bacteria | 1648 |
| 334 | Ga0495623_0029603 | 3300046679 | Bacteria | 3523 |
| 335 | Ga0495646_0059637 | 3300046680 | Bacteria | 2278 |
| 336 | Ga0495646_0063020 | 3300046680 | Bacteria | 2203 |
| 337 | Ga0495647_0000793 | 3300046681 | Bacteria | 9422 |
| 338 | Ga0495658_0001369 | 3300046683 | Bacteria | 12785 |
| 339 | Ga0495613_0134073 | 3300046689 | Bacteria | 1773 |
| 340 | Ga0495624_0000224 | 3300046690 | Bacteria | 44228 |
| 341 | Ga0495649_0012029 | 3300046694 | Bacteria | 5054 |
| 342 | Ga0495600_0180030 | 3300046809 | Bacteria | 1362 |
| 343 | Ga0495660_0010344 | 3300046810 | Bacteria | 5425 |
| 344 | Ga0495581_0000237 | 3300047315 | Bacteria | 26157 |
| 345 | Ga0495581_0211532 | 3300047315 | Bacteria | 1134 |
| 346 | Ga0495604_0018008 | 3300047317 | Bacteria | 5653 |
| 347 | Ga0495674_0001107 | 3300047319 | Bacteria | 25900 |
| 348 | Ga0495674_0046149 | 3300047319 | Bacteria | 3868 |
| 349 | Ga0495674_0150896 | 3300047319 | Bacteria | 1949 |
| 350 | Ga0495676_0006639 | 3300047321 | Bacteria | 10666 |
| 351 | Ga0495680_0069128 | 3300047322 | Bacteria | 2695 |
| 352 | Ga0495687_004544 | 3300047443 | Bacteria | 9306 |
| 353 | Ga0495687_004840 | 3300047443 | Bacteria | 8858 |
| 354 | Ga0495675_0013704 | 3300047444 | Bacteria | 5123 |
| 355 | Ga0495684_0011844 | 3300047471 | Bacteria | 6730 |
| 356 | Ga0495684_0016387 | 3300047471 | Bacteria | 5707 |
| 357 | Ga0495686_0165982 | 3300047472 | Bacteria | 1287 |
| 358 | Ga0495593_0000150 | 3300047673 | Bacteria | 34569 |
| 359 | Ga0495593_0172886 | 3300047673 | Bacteria | 1089 |
| 360 | Ga0495602_0032921 | 3300048088 | Bacteria | 4872 |
| 361 | Ga0495626_0054848 | 3300048091 | Bacteria | 1829 |
| 362 | Ga0496100_0244424 | 3300048903 | Bacteria | 1325 |
| 363 | Ga0496101_0106734 | 3300048904 | Bacteria | 2103 |
| 364 | Ga0496102_0052890 | 3300048905 | Bacteria | 3701 |
| 365 | Ga0496104_0012572 | 3300048907 | Bacteria | 7618 |
| 366 | Ga0496104_0220539 | 3300048907 | Bacteria | 1809 |
| 367 | Ga0496105_0029305 | 3300048908 | Bacteria | 4505 |
| 368 | Ga0496106_0000001 | 3300048909 | Bacteria | 497458 |
| 369 | Ga0496106_0016508 | 3300048909 | Bacteria | 5464 |
| 370 | Ga0496106_0065306 | 3300048909 | Bacteria | 2770 |
| 371 | Ga0496107_0045463 | 3300048910 | Bacteria | 3158 |
| 372 | Ga0496108_0008606 | 3300048911 | Bacteria | 8275 |
| 373 | Ga0496108_0158308 | 3300048911 | Bacteria | 1956 |
| 374 | Ga0496108_0179332 | 3300048911 | Bacteria | 1834 |
| 375 | Ga0496109_0031055 | 3300048912 | Bacteria | 4791 |
| 376 | Ga0496109_0097880 | 3300048912 | Bacteria | 2719 |
| 377 | Ga0496110_0048250 | 3300048913 | Bacteria | 3733 |
| 378 | Ga0496110_0112156 | 3300048913 | Bacteria | 2451 |
| 379 | Ga0496110_0120360 | 3300048913 | Bacteria | 2365 |
| 380 | Ga0496110_0364811 | 3300048913 | Bacteria | 1316 |
| 381 | Ga0496112_0146682 | 3300048915 | Bacteria | 2328 |
| 382 | Ga0496112_0414785 | 3300048915 | Bacteria | 1286 |
| 383 | Ga0496116_0118272 | 3300048919 | Bacteria | 1540 |
| 384 | Ga0496117_0060580 | 3300048920 | Bacteria | 2607 |
| 385 | Ga0496118_0003099 | 3300048921 | Bacteria | 21319 |
| 386 | Ga0496118_0069279 | 3300048921 | Bacteria | 2556 |
| 387 | Ga0496119_0091638 | 3300048922 | Bacteria | 1726 |
| 388 | Ga0496121_0001201 | 3300048924 | Bacteria | 45377 |
| 389 | Ga0496121_0015069 | 3300048924 | Bacteria | 8134 |
| 390 | Ga0496121_0203178 | 3300048924 | Bacteria | 1410 |
| 391 | Ga0496124_0090829 | 3300048927 | Bacteria | 2490 |
| 392 | Ga0496124_0154704 | 3300048927 | Bacteria | 1794 |
| 393 | Ga0496124_0395784 | 3300048927 | Bacteria | 960 |
| 394 | Ga0496125_0133030 | 3300048928 | Bacteria | 1746 |
| 395 | Ga0496126_0000900 | 3300048929 | Bacteria | 51728 |
| 396 | Ga0496126_0006861 | 3300048929 | Bacteria | 12621 |
| 397 | Ga0495678_039661 | 3300049459 | Bacteria | 1898 |
| 398 | Ga0501034_0001130 | 3300049571 | Bacteria | 37180 |
| 399 | Ga0501034_0002311 | 3300049571 | Bacteria | 23303 |
| 400 | Ga0501034_0317553 | 3300049571 | Bacteria | 1491 |
| 401 | Ga0501070_0338030 | 3300049586 | Bacteria | 1223 |
| 402 | Ga0501044_0081309 | 3300049823 | Bacteria | 3280 |
| 403 | nmdc:mga03683_34063_c1 | 3300050489 | Bacteria | 2059 |
| 404 | nmdc:mga00v17_39422_c1 | 3300050491 | Bacteria | 2829 |
| 405 | nmdc:mga0yw44_8823_c1 | 3300050492 | Bacteria | 5049 |
| 406 | nmdc:mga0k408_17540_c1 | 3300050493 | Bacteria | 3990 |
| 407 | nmdc:mga06z11_210258_c1 | 3300050494 | Bacteria | 1133 |
| 408 | nmdc:mga07m45_15399_c1 | 3300050496 | Bacteria | 4083 |
| 409 | nmdc:mga05p37_127000_c1 | 3300050507 | Bacteria | 3131 |
| 410 | nmdc:mga05p37_218308_c1 | 3300050507 | Bacteria | 2302 |
| 411 | nmdc:mga05p37_277578_c1 | 3300050507 | Bacteria | 2000 |
| 412 | nmdc:mga05p37_669026_c1 | 3300050507 | Bacteria | 1159 |
| 413 | nmdc:mga05p37_681_c1 | 3300050507 | Bacteria | 37660 |
| 414 | nmdc:mga09592_2798_c1 | 3300050508 | Bacteria | 14136 |
| 415 | nmdc:mga09592_44098_c1 | 3300050508 | Bacteria | 3753 |
| 416 | nmdc:mga0qj67_263893_c1 | 3300050509 | Bacteria | 1397 |
| 417 | nmdc:mga06r32_123580_c1 | 3300050510 | Bacteria | 2554 |
| 418 | nmdc:mga06r32_330395_c1 | 3300050510 | Unclassified | 1510 |
| 419 | nmdc:mga06r32_392979_c1 | 3300050510 | Bacteria | 1369 |
| 420 | nmdc:mga06r32_394_c1 | 3300050510 | Bacteria | 36886 |
| 421 | nmdc:mga06r32_5029_c1 | 3300050510 | Bacteria | 11903 |
| 422 | nmdc:mga08y16_218797_c1 | 3300050511 | Bacteria | 1972 |
| 423 | nmdc:mga08y16_218897_c1 | 3300050511 | Bacteria | 1971 |
| 424 | nmdc:mga08y16_4098_c1 | 3300050511 | Bacteria | 15215 |
| 425 | nmdc:mga0rr50_154642_c1 | 3300050513 | Bacteria | 1857 |
| 426 | nmdc:mga08x19_221675_c1 | 3300050514 | Bacteria | 1299 |
| 427 | Ga0495601_0022661 | 3300053077 | Bacteria | 3858 |
| 428 | Ga0495601_0197241 | 3300053077 | Bacteria | 1316 |
| 429 | Ga0495612_0057484 | 3300053078 | Bacteria | 1606 |
| 430 | Ga0500635_0004817 | 3300053080 | Bacteria | 3496 |
| 431 | Ga0495595_0004098 | 3300053084 | Bacteria | 5842 |
| 432 | Ga0495619_0334859 | 3300053085 | Bacteria | 1048 |
| 433 | Ga0500647_0029719 | 3300053091 | Bacteria | 2593 |
| 434 | Ga0500651_0195716 | 3300053093 | Bacteria | 1195 |
| 435 | Ga0500641_0003413 | 3300053096 | Bacteria | 5619 |
| 436 | Ga0500595_030913 | 3300053119 | Bacteria | 1800 |
| 437 | Ga0500577_0000415 | 3300053142 | Bacteria | 10941 |
| 438 | Ga0500577_0086257 | 3300053142 | Bacteria | 1261 |
| 439 | Ga0500589_004864 | 3300053147 | Bacteria | 5141 |
| 440 | Ga0500604_0010349 | 3300053151 | Bacteria | 2494 |
| 441 | Ga0500634_0082883 | 3300053161 | Bacteria | 1648 |
| 442 | Ga0500638_097942 | 3300053162 | Bacteria | 1372 |
| 443 | Ga0500636_0054710 | 3300053177 | Bacteria | 2339 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009176 | Ga0105242_10364013 | Ga0105242_103640132 | 241 |
| 2 | 3300053077 | Ga0495601_0197241 | Ga0495601_0197241_575_1306 | 241 |
| 3 | 3300035120 | Ga0373957_0168131 | Ga0373957_0168131_13_774 | 243 |
| 4 | 3300046463 | Ga0495653_0400446 | Ga0495653_0400446_95_856 | 243 |
| 5 | 3300014968 | Ga0157379_10220431 | Ga0157379_102204312 | 251 |
| 6 | 3300025900 | Ga0207710_10110625 | Ga0207710_101106251 | 252 |
| 7 | 3300006847 | Ga0075431_100002605 | Ga0075431_10000260513 | 273 |
| 8 | 3300005439 | Ga0070711_100183253 | Ga0070711_1001832532 | 279 |
| 9 | 3300025916 | Ga0207663_10161069 | Ga0207663_101610691 | 279 |
| 10 | 3300005616 | Ga0068852_100136055 | Ga0068852_1001360552 | 280 |
| 11 | 3300053162 | Ga0500638_097942 | Ga0500638_097942_86_958 | 280 |
| 12 | 3300005937 | Ga0081455_10014776 | Ga0081455_100147768 | 282 |
| 13 | 3300006038 | Ga0075365_10003792 | Ga0075365_100037927 | 282 |
| 14 | 3300006844 | Ga0075428_100011074 | Ga0075428_1000110747 | 282 |
| 15 | 3300005436 | Ga0070713_100441411 | Ga0070713_1004414112 | 285 |
| 16 | 3300009545 | Ga0105237_10404197 | Ga0105237_104041972 | 285 |
| 17 | 3300013105 | Ga0157369_10369524 | Ga0157369_103695242 | 285 |
| 18 | 3300035086 | Ga0373934_0041096 | Ga0373934_0041096_74_961 | 285 |
| 19 | 3300035113 | Ga0373936_0016796 | Ga0373936_0016796_687_1574 | 285 |
| 20 | 3300035118 | Ga0373954_0041691 | Ga0373954_0041691_1200_2087 | 285 |
| 21 | 3300035170 | Ga0373943_0010120 | Ga0373943_0010120_181_1068 | 285 |
| 22 | 3300035171 | Ga0373946_0003431 | Ga0373946_0003431_2267_3154 | 285 |
| 23 | 3300035692 | Ga0373935_0000128 | Ga0373935_0000128_28781_29668 | 285 |
| 24 | 3300035695 | Ga0373927_0013611 | Ga0373927_0013611_644_1531 | 285 |
| 25 | 3300035725 | Ga0373947_0006253 | Ga0373947_0006253_1000_1887 | 285 |
| 26 | 3300037068 | Ga0373925_0002522 | Ga0373925_0002522_3792_4679 | 285 |
| 27 | 3300046454 | Ga0495592_0010943 | Ga0495592_0010943_3931_4818 | 285 |
| 28 | 3300046455 | Ga0495603_0001212 | Ga0495603_0001212_7039_7926 | 285 |
| 29 | 3300046459 | Ga0495629_0001713 | Ga0495629_0001713_5836_6723 | 285 |
| 30 | 3300046461 | Ga0495641_0000402 | Ga0495641_0000402_5976_6863 | 285 |
| 31 | 3300046472 | Ga0495580_0001155 | Ga0495580_0001155_4594_5481 | 285 |
| 32 | 3300046473 | Ga0495582_0000063 | Ga0495582_0000063_46143_47030 | 285 |
| 33 | 3300046475 | Ga0495639_0001528 | Ga0495639_0001528_1528_2415 | 285 |
| 34 | 3300046476 | Ga0495662_0004861 | Ga0495662_0004861_2094_2981 | 285 |
| 35 | 3300046477 | Ga0495664_0004784 | Ga0495664_0004784_4172_5059 | 285 |
| 36 | 3300046499 | Ga0495594_0000237 | Ga0495594_0000237_7988_8875 | 285 |
| 37 | 3300046516 | Ga0495628_0065756 | Ga0495628_0065756_284_1171 | 285 |
| 38 | 3300046517 | Ga0495630_0010676 | Ga0495630_0010676_442_1329 | 285 |
| 39 | 3300046526 | Ga0495666_0013601 | Ga0495666_0013601_959_1846 | 285 |
| 40 | 3300046529 | Ga0495652_0018844 | Ga0495652_0018844_2752_3639 | 285 |
| 41 | 3300046531 | Ga0495665_0001528 | Ga0495665_0001528_1138_2025 | 285 |
| 42 | 3300046557 | Ga0495622_0001950 | Ga0495622_0001950_7442_8329 | 285 |
| 43 | 3300046559 | Ga0495667_0057384 | Ga0495667_0057384_521_1408 | 285 |
| 44 | 3300046642 | Ga0495634_0000645 | Ga0495634_0000645_25033_25920 | 285 |
| 45 | 3300046663 | Ga0495635_0000640 | Ga0495635_0000640_17371_18258 | 285 |
| 46 | 3300046674 | Ga0495588_0015704 | Ga0495588_0015704_644_1531 | 285 |
| 47 | 3300046678 | Ga0495599_0045305 | Ga0495599_0045305_773_1660 | 285 |
| 48 | 3300046680 | Ga0495646_0059637 | Ga0495646_0059637_75_962 | 285 |
| 49 | 3300046681 | Ga0495647_0000793 | Ga0495647_0000793_4575_5462 | 285 |
| 50 | 3300046683 | Ga0495658_0001369 | Ga0495658_0001369_4839_5726 | 285 |
| 51 | 3300046690 | Ga0495624_0000224 | Ga0495624_0000224_35589_36476 | 285 |
| 52 | 3300046809 | Ga0495600_0180030 | Ga0495600_0180030_306_1193 | 285 |
| 53 | 3300047315 | Ga0495581_0000237 | Ga0495581_0000237_25015_25902 | 285 |
| 54 | 3300047319 | Ga0495674_0001107 | Ga0495674_0001107_17471_18358 | 285 |
| 55 | 3300047321 | Ga0495676_0006639 | Ga0495676_0006639_3008_3895 | 285 |
| 56 | 3300047471 | Ga0495684_0016387 | Ga0495684_0016387_2705_3592 | 285 |
| 57 | 3300047673 | Ga0495593_0000150 | Ga0495593_0000150_7632_8519 | 285 |
| 58 | 3300048913 | Ga0496110_0120360 | Ga0496110_0120360_100_987 | 285 |
| 59 | 3300053085 | Ga0495619_0334859 | Ga0495619_0334859_140_1027 | 285 |
| 60 | 3300005563 | Ga0068855_100501727 | Ga0068855_1005017271 | 289 |
| 61 | 3300005471 | Ga0070698_100034868 | Ga0070698_1000348683 | 291 |
| 62 | 3300006175 | Ga0070712_100315992 | Ga0070712_1003159922 | 291 |
| 63 | 3300025910 | Ga0207684_10105256 | Ga0207684_101052562 | 291 |
| 64 | 3300050493 | nmdc:mga0k408_17540_c1 | nmdc:mga0k408_17540_c1_2684_3589 | 291 |
| 65 | 3300005467 | Ga0070706_100194888 | Ga0070706_1001948882 | 292 |
| 66 | iso_pu_bacteria | 2857524615 | 2857529729 | 293 |
| 67 | 3300005341 | Ga0070691_10113516 | Ga0070691_101135162 | 295 |
| 68 | 3300005545 | Ga0070695_100020354 | Ga0070695_1000203544 | 295 |
| 69 | 3300005719 | Ga0068861_100063555 | Ga0068861_1000635553 | 295 |
| 70 | 3300026116 | Ga0207674_10154232 | Ga0207674_101542322 | 295 |
| 71 | 3300026118 | Ga0207675_100100251 | Ga0207675_1001002514 | 295 |
| 72 | iso_pu_bacteria | 2515154122 | 2515685688 | 295 |
| 73 | iso_pu_bacteria | 2515154189 | 2516021835 | 295 |
| 74 | iso_pu_bacteria | 2883087390 | 2883089015 | 295 |
| 75 | iso_pu_bacteria | 2885270888 | 2885277113 | 295 |
| 76 | iso_pu_bacteria | 2902682994 | 2902688178 | 295 |
| 77 | iso_pu_bacteria | 2935608549 | 2935615192 | 295 |
| 78 | iso_pu_bacteria | 8019648815 | 8019654787 | 295 |
| 79 | iso_pu_bacteria | 2513237092 | 2513627196 | 296 |
| 80 | iso_pu_bacteria | 2513237094 | 2513637869 | 296 |
| 81 | iso_pu_bacteria | 2513237161 | 2514010840 | 296 |
| 82 | iso_pu_bacteria | 2599185301 | 2599941048 | 296 |
| 83 | iso_pu_bacteria | 2617270735 | 2617354074 | 296 |
| 84 | iso_pu_bacteria | 2617270741 | 2617376658 | 296 |
| 85 | iso_pu_bacteria | 2617270742 | 2617380961 | 296 |
| 86 | iso_pu_bacteria | 2824679649 | 2824682522 | 296 |
| 87 | iso_pu_bacteria | 2824732956 | 2824735734 | 296 |
| 88 | iso_pu_bacteria | 2824746037 | 2824751690 | 296 |
| 89 | iso_pu_bacteria | 2824773399 | 2824779102 | 296 |
| 90 | iso_pu_bacteria | 2838122688 | 2838126501 | 296 |
| 91 | iso_pu_bacteria | 2841941048 | 2841947158 | 296 |
| 92 | iso_pu_bacteria | 2841949485 | 2841950602 | 296 |
| 93 | iso_pu_bacteria | 2841966195 | 2841966916 | 296 |
| 94 | iso_pu_bacteria | 2841974524 | 2841975665 | 296 |
| 95 | iso_pu_bacteria | 2841983080 | 2841990028 | 296 |
| 96 | iso_pu_bacteria | 2842482326 | 2842487422 | 296 |
| 97 | iso_pu_bacteria | 2847930680 | 2847935306 | 296 |
| 98 | iso_pu_bacteria | 2847939898 | 2847945903 | 296 |
| 99 | iso_pu_bacteria | 2874620515 | 2874627926 | 296 |
| 100 | iso_pu_bacteria | 2879083081 | 2879088950 | 296 |
| 101 | iso_pu_bacteria | 2881665667 | 2881670862 | 296 |
| 102 | iso_pu_bacteria | 2885409591 | 2885416958 | 296 |
| 103 | iso_pu_bacteria | 2904449895 | 2904453903 | 296 |
| 104 | iso_pu_bacteria | 2904456579 | 2904462387 | 296 |
| 105 | iso_pu_bacteria | 2904666416 | 2904672754 | 296 |
| 106 | iso_pu_bacteria | 2906626472 | 2906627049 | 296 |
| 107 | iso_pu_bacteria | 2906643746 | 2906650081 | 296 |
| 108 | iso_pu_bacteria | 2908775508 | 2908779238 | 296 |
| 109 | iso_pu_bacteria | 2922393267 | 2922395449 | 296 |
| 110 | iso_pu_bacteria | 2977864932 | 2977868190 | 296 |
| 111 | iso_pu_bacteria | 3005483717 | 3005490042 | 296 |
| 112 | iso_pu_bacteria | 8016583857 | 8016587027 | 296 |
| 113 | iso_pu_bacteria | 8016603502 | 8016603867 | 296 |
| 114 | iso_pu_bacteria | 8016613128 | 8016613913 | 296 |
| 115 | iso_pu_bacteria | 8016622563 | 8016625103 | 296 |
| 116 | iso_pu_bacteria | 8019547302 | 8019552138 | 296 |
| 117 | iso_pu_bacteria | 8019619141 | 8019624669 | 296 |
| 118 | iso_pu_bacteria | 8019629233 | 8019630835 | 296 |
| 119 | iso_pu_bacteria | 8019659431 | 8019667693 | 296 |
| 120 | iso_pu_bacteria | 8056689827 | 8056695994 | 296 |
| 121 | 3300005329 | Ga0070683_100021732 | Ga0070683_1000217325 | 297 |
| 122 | 3300005336 | Ga0070680_100166575 | Ga0070680_1001665752 | 297 |
| 123 | 3300005344 | Ga0070661_100410803 | Ga0070661_1004108031 | 297 |
| 124 | 3300005455 | Ga0070663_100236290 | Ga0070663_1002362902 | 297 |
| 125 | 3300005564 | Ga0070664_100097429 | Ga0070664_1000974292 | 297 |
| 126 | 3300005614 | Ga0068856_100050075 | Ga0068856_1000500753 | 297 |
| 127 | 3300005616 | Ga0068852_100014091 | Ga0068852_1000140914 | 297 |
| 128 | 3300011119 | Ga0105246_10154985 | Ga0105246_101549851 | 297 |
| 129 | 3300025945 | Ga0207679_10201653 | Ga0207679_102016532 | 297 |
| 130 | 3300026078 | Ga0207702_10037716 | Ga0207702_100377162 | 297 |
| 131 | iso_pu_bacteria | 2582581867 | 2585404027 | 297 |
| 132 | iso_pu_bacteria | 2904690495 | 2904694866 | 297 |
| 133 | iso_pu_bacteria | 2908756301 | 2908759992 | 297 |
| 134 | iso_pu_bacteria | 2935908558 | 2935910577 | 297 |
| 135 | iso_pu_bacteria | 2935926038 | 2935927512 | 297 |
| 136 | iso_pu_bacteria | 2935934488 | 2935936617 | 297 |
| 137 | iso_pu_bacteria | 2935942939 | 2935943831 | 297 |
| 138 | iso_pu_bacteria | 2935951376 | 2935952268 | 297 |
| 139 | iso_pu_bacteria | 2935967501 | 2935969108 | 297 |
| 140 | iso_pu_bacteria | 2937848649 | 2937848881 | 297 |
| 141 | iso_pu_bacteria | 2977922695 | 2977925522 | 297 |
| 142 | iso_pu_bacteria | 3004211236 | 3004217057 | 297 |
| 143 | iso_pu_bacteria | 3004218560 | 3004225350 | 297 |
| 144 | iso_pu_bacteria | 3005594810 | 3005600420 | 297 |
| 145 | iso_pu_bacteria | 8019687851 | 8019696936 | 297 |
| 146 | 3300025937 | Ga0207669_10098355 | Ga0207669_100983552 | 298 |
| 147 | 3300046455 | Ga0495603_0023141 | Ga0495603_0023141_1429_2325 | 298 |
| 148 | 3300046475 | Ga0495639_0089047 | Ga0495639_0089047_274_1170 | 298 |
| 149 | 3300046539 | Ga0495621_0099460 | Ga0495621_0099460_111_1007 | 298 |
| 150 | 3300046660 | Ga0495625_0223192 | Ga0495625_0223192_16_912 | 298 |
| 151 | 3300046674 | Ga0495588_0050239 | Ga0495588_0050239_204_1100 | 298 |
| 152 | 3300049571 | Ga0501034_0317553 | Ga0501034_0317553_566_1465 | 298 |
| 153 | 3300003322 | rootL2_10037332 | rootL2_100373323 | 299 |
| 154 | 3300003323 | rootH1_10050544 | rootH1_100505442 | 299 |
| 155 | 3300005336 | Ga0070680_100272846 | Ga0070680_1002728462 | 299 |
| 156 | 3300005339 | Ga0070660_100035784 | Ga0070660_1000357842 | 299 |
| 157 | 3300005341 | Ga0070691_10061597 | Ga0070691_100615971 | 299 |
| 158 | 3300005366 | Ga0070659_100058902 | Ga0070659_1000589022 | 299 |
| 159 | 3300005434 | Ga0070709_10005233 | Ga0070709_100052339 | 299 |
| 160 | 3300005435 | Ga0070714_100199418 | Ga0070714_1001994182 | 299 |
| 161 | 3300005439 | Ga0070711_100009618 | Ga0070711_1000096182 | 299 |
| 162 | 3300005445 | Ga0070708_100222077 | Ga0070708_1002220772 | 299 |
| 163 | 3300005458 | Ga0070681_10094056 | Ga0070681_100940562 | 299 |
| 164 | 3300005467 | Ga0070706_100553831 | Ga0070706_1005538311 | 299 |
| 165 | 3300005468 | Ga0070707_100054322 | Ga0070707_1000543224 | 299 |
| 166 | 3300005530 | Ga0070679_100359065 | Ga0070679_1003590652 | 299 |
| 167 | 3300005535 | Ga0070684_100037298 | Ga0070684_1000372984 | 299 |
| 168 | 3300005535 | Ga0070684_100063099 | Ga0070684_1000630992 | 299 |
| 169 | 3300005536 | Ga0070697_100456825 | Ga0070697_1004568252 | 299 |
| 170 | 3300005539 | Ga0068853_100107365 | Ga0068853_1001073652 | 299 |
| 171 | 3300005577 | Ga0068857_100026661 | Ga0068857_1000266612 | 299 |
| 172 | 3300005577 | Ga0068857_100564312 | Ga0068857_1005643121 | 299 |
| 173 | 3300005834 | Ga0068851_10136641 | Ga0068851_101366411 | 299 |
| 174 | 3300006844 | Ga0075428_100049115 | Ga0075428_1000491154 | 299 |
| 175 | 3300006847 | Ga0075431_100210040 | Ga0075431_1002100402 | 299 |
| 176 | 3300006914 | Ga0075436_100217374 | Ga0075436_1002173742 | 299 |
| 177 | 3300007265 | Ga0099794_10010178 | Ga0099794_100101784 | 299 |
| 178 | 3300007788 | Ga0099795_10001073 | Ga0099795_100010733 | 299 |
| 179 | 3300009093 | Ga0105240_10031664 | Ga0105240_100316646 | 299 |
| 180 | 3300009147 | Ga0114129_10935769 | Ga0114129_109357691 | 299 |
| 181 | 3300010159 | Ga0099796_10001125 | Ga0099796_100011254 | 299 |
| 182 | 3300013104 | Ga0157370_10011815 | Ga0157370_1001181513 | 299 |
| 183 | 3300013104 | Ga0157370_10225597 | Ga0157370_102255972 | 299 |
| 184 | 3300013105 | Ga0157369_10020952 | Ga0157369_100209527 | 299 |
| 185 | 3300013105 | Ga0157369_10033836 | Ga0157369_100338367 | 299 |
| 186 | 3300025321 | Ga0207656_10031840 | Ga0207656_100318402 | 299 |
| 187 | 3300025909 | Ga0207705_10175106 | Ga0207705_101751062 | 299 |
| 188 | 3300025912 | Ga0207707_10004215 | Ga0207707_100042155 | 299 |
| 189 | 3300025912 | Ga0207707_10074204 | Ga0207707_100742045 | 299 |
| 190 | 3300025913 | Ga0207695_10108446 | Ga0207695_101084464 | 299 |
| 191 | 3300025914 | Ga0207671_10051739 | Ga0207671_100517392 | 299 |
| 192 | 3300025915 | Ga0207693_10020887 | Ga0207693_100208873 | 299 |
| 193 | 3300025916 | Ga0207663_10020497 | Ga0207663_100204973 | 299 |
| 194 | 3300025917 | Ga0207660_10233871 | Ga0207660_102338711 | 299 |
| 195 | 3300025919 | Ga0207657_10006008 | Ga0207657_1000600812 | 299 |
| 196 | 3300025921 | Ga0207652_10181986 | Ga0207652_101819862 | 299 |
| 197 | 3300025922 | Ga0207646_10219228 | Ga0207646_102192281 | 299 |
| 198 | 3300025929 | Ga0207664_10119204 | Ga0207664_101192041 | 299 |
| 199 | 3300025932 | Ga0207690_10119809 | Ga0207690_101198092 | 299 |
| 200 | 3300025939 | Ga0207665_10164376 | Ga0207665_101643761 | 299 |
| 201 | 3300025944 | Ga0207661_10018806 | Ga0207661_100188063 | 299 |
| 202 | 3300026116 | Ga0207674_10586680 | Ga0207674_105866802 | 299 |
| 203 | 3300028794 | Ga0307515_10055973 | Ga0307515_100559733 | 299 |
| 204 | 3300050507 | nmdc:mga05p37_669026_c1 | nmdc:mga05p37_669026_c1_82_987 | 299 |
| 205 | 3300050508 | nmdc:mga09592_44098_c1 | nmdc:mga09592_44098_c1_2815_3714 | 299 |
| 206 | 3300050510 | nmdc:mga06r32_5029_c1 | nmdc:mga06r32_5029_c1_3569_4474 | 299 |
| 207 | 3300050514 | nmdc:mga08x19_221675_c1 | nmdc:mga08x19_221675_c1_44_943 | 299 |
| 208 | 3300053078 | Ga0495612_0057484 | Ga0495612_0057484_667_1566 | 299 |
| 209 | 3300005327 | Ga0070658_10096082 | Ga0070658_100960823 | 300 |
| 210 | 3300005331 | Ga0070670_100184225 | Ga0070670_1001842252 | 300 |
| 211 | 3300005339 | Ga0070660_100025489 | Ga0070660_1000254892 | 300 |
| 212 | 3300005355 | Ga0070671_100097434 | Ga0070671_1000974342 | 300 |
| 213 | 3300005366 | Ga0070659_100470967 | Ga0070659_1004709671 | 300 |
| 214 | 3300005456 | Ga0070678_100104609 | Ga0070678_1001046092 | 300 |
| 215 | 3300005518 | Ga0070699_100427553 | Ga0070699_1004275531 | 300 |
| 216 | 3300005530 | Ga0070679_100107280 | Ga0070679_1001072804 | 300 |
| 217 | 3300005563 | Ga0068855_100149853 | Ga0068855_1001498533 | 300 |
| 218 | 3300005578 | Ga0068854_100172970 | Ga0068854_1001729701 | 300 |
| 219 | 3300005617 | Ga0068859_100069418 | Ga0068859_1000694182 | 300 |
| 220 | 3300005618 | Ga0068864_100009204 | Ga0068864_1000092046 | 300 |
| 221 | 3300006237 | Ga0097621_100254757 | Ga0097621_1002547572 | 300 |
| 222 | 3300006844 | Ga0075428_100001655 | Ga0075428_1000016556 | 300 |
| 223 | 3300006844 | Ga0075428_100132500 | Ga0075428_1001325002 | 300 |
| 224 | 3300006847 | Ga0075431_100000251 | Ga0075431_10000025145 | 300 |
| 225 | 3300006847 | Ga0075431_100131788 | Ga0075431_1001317882 | 300 |
| 226 | 3300006880 | Ga0075429_100001930 | Ga0075429_1000019308 | 300 |
| 227 | 3300006931 | Ga0097620_100069414 | Ga0097620_1000694143 | 300 |
| 228 | 3300006942 | Ga0099824_1005150 | Ga0099824_10051507 | 300 |
| 229 | 3300007076 | Ga0075435_100043122 | Ga0075435_1000431222 | 300 |
| 230 | 3300009094 | Ga0111539_10001595 | Ga0111539_1000159513 | 300 |
| 231 | 3300009094 | Ga0111539_10636150 | Ga0111539_106361502 | 300 |
| 232 | 3300009098 | Ga0105245_10042164 | Ga0105245_100421644 | 300 |
| 233 | 3300009101 | Ga0105247_10077438 | Ga0105247_100774382 | 300 |
| 234 | 3300009147 | Ga0114129_10000066 | Ga0114129_100000664 | 300 |
| 235 | 3300009147 | Ga0114129_10249794 | Ga0114129_102497942 | 300 |
| 236 | 3300009147 | Ga0114129_10256323 | Ga0114129_102563231 | 300 |
| 237 | 3300009545 | Ga0105237_10176087 | Ga0105237_101760872 | 300 |
| 238 | 3300009551 | Ga0105238_10153397 | Ga0105238_101533972 | 300 |
| 239 | 3300010375 | Ga0105239_10215995 | Ga0105239_102159952 | 300 |
| 240 | 3300010375 | Ga0105239_10485277 | Ga0105239_104852772 | 300 |
| 241 | 3300013104 | Ga0157370_10063238 | Ga0157370_100632382 | 300 |
| 242 | 3300013105 | Ga0157369_10518584 | Ga0157369_105185841 | 300 |
| 243 | 3300013296 | Ga0157374_10010646 | Ga0157374_100106468 | 300 |
| 244 | 3300013297 | Ga0157378_10299318 | Ga0157378_102993182 | 300 |
| 245 | 3300013306 | Ga0163162_10317964 | Ga0163162_103179641 | 300 |
| 246 | 3300013307 | Ga0157372_10067552 | Ga0157372_100675526 | 300 |
| 247 | 3300013307 | Ga0157372_10157194 | Ga0157372_101571944 | 300 |
| 248 | 3300013308 | Ga0157375_10077081 | Ga0157375_100770813 | 300 |
| 249 | 3300013308 | Ga0157375_10179371 | Ga0157375_101793712 | 300 |
| 250 | 3300013308 | Ga0157375_10273565 | Ga0157375_102735652 | 300 |
| 251 | 3300014325 | Ga0163163_10212578 | Ga0163163_102125781 | 300 |
| 252 | 3300014325 | Ga0163163_10266172 | Ga0163163_102661722 | 300 |
| 253 | 3300014497 | Ga0182008_10035739 | Ga0182008_100357392 | 300 |
| 254 | 3300014969 | Ga0157376_10132033 | Ga0157376_101320331 | 300 |
| 255 | 3300015261 | Ga0182006_1040741 | Ga0182006_10407412 | 300 |
| 256 | 3300021320 | Ga0214544_1000009 | Ga0214544_100000912 | 300 |
| 257 | 3300021321 | Ga0214542_1000002 | Ga0214542_1000002453 | 300 |
| 258 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002267 | 300 |
| 259 | 3300021327 | Ga0214543_1000013 | Ga0214543_100001355 | 300 |
| 260 | 3300025254 | Ga0209148_1014455 | Ga0209148_10144552 | 300 |
| 261 | 3300025297 | Ga0209758_1000808 | Ga0209758_100080835 | 300 |
| 262 | 3300025919 | Ga0207657_10018110 | Ga0207657_100181107 | 300 |
| 263 | 3300025927 | Ga0207687_10069766 | Ga0207687_100697662 | 300 |
| 264 | 3300025931 | Ga0207644_10269560 | Ga0207644_102695602 | 300 |
| 265 | 3300025932 | Ga0207690_10192996 | Ga0207690_101929962 | 300 |
| 266 | 3300025936 | Ga0207670_10391557 | Ga0207670_103915571 | 300 |
| 267 | 3300025945 | Ga0207679_10253860 | Ga0207679_102538601 | 300 |
| 268 | 3300025972 | Ga0207668_10300836 | Ga0207668_103008362 | 300 |
| 269 | 3300026023 | Ga0207677_10258662 | Ga0207677_102586622 | 300 |
| 270 | 3300026041 | Ga0207639_10228969 | Ga0207639_102289691 | 300 |
| 271 | 3300026067 | Ga0207678_10071668 | Ga0207678_100716682 | 300 |
| 272 | 3300026067 | Ga0207678_10351427 | Ga0207678_103514272 | 300 |
| 273 | 3300026078 | Ga0207702_10572895 | Ga0207702_105728951 | 300 |
| 274 | 3300026095 | Ga0207676_10027290 | Ga0207676_100272903 | 300 |
| 275 | 3300026118 | Ga0207675_100215384 | Ga0207675_1002153842 | 300 |
| 276 | 3300026142 | Ga0207698_10431546 | Ga0207698_104315461 | 300 |
| 277 | 3300027296 | Ga0209389_1000026 | Ga0209389_1000026105 | 300 |
| 278 | 3300027296 | Ga0209389_1000117 | Ga0209389_100011735 | 300 |
| 279 | 3300027357 | Ga0209589_1000022 | Ga0209589_1000022105 | 300 |
| 280 | 3300027361 | Ga0209489_100058 | Ga0209489_100058106 | 300 |
| 281 | 3300027361 | Ga0209489_102405 | Ga0209489_10240514 | 300 |
| 282 | 3300027363 | Ga0209700_100021 | Ga0209700_10002135 | 300 |
| 283 | 3300027907 | Ga0207428_10000891 | Ga0207428_100008918 | 300 |
| 284 | 3300028380 | Ga0268265_10135323 | Ga0268265_101353232 | 300 |
| 285 | 3300035115 | Ga0373941_0006720 | Ga0373941_0006720_834_1742 | 300 |
| 286 | 3300035691 | Ga0373931_0002116 | Ga0373931_0002116_3167_4075 | 300 |
| 287 | 3300037312 | Ga0395899_0003556 | Ga0395899_0003556_8713_9618 | 300 |
| 288 | 3300037312 | Ga0395899_0023932 | Ga0395899_0023932_2906_3808 | 300 |
| 289 | 3300037418 | Ga0395900_0005201 | Ga0395900_0005201_363_1265 | 300 |
| 290 | 3300037418 | Ga0395900_0194095 | Ga0395900_0194095_550_1458 | 300 |
| 291 | 3300037466 | Ga0395898_0011685 | Ga0395898_0011685_41_946 | 300 |
| 292 | 3300037466 | Ga0395898_0086408 | Ga0395898_0086408_1156_2064 | 300 |
| 293 | 3300037466 | Ga0395898_0238381 | Ga0395898_0238381_155_1063 | 300 |
| 294 | 3300037471 | Ga0395905_0009284 | Ga0395905_0009284_8586_9491 | 300 |
| 295 | 3300037471 | Ga0395905_0011866 | Ga0395905_0011866_1906_2814 | 300 |
| 296 | 3300037471 | Ga0395905_0149891 | Ga0395905_0149891_238_1146 | 300 |
| 297 | 3300038443 | Ga0395901_0010742 | Ga0395901_0010742_5315_6217 | 300 |
| 298 | 3300038443 | Ga0395901_0123098 | Ga0395901_0123098_714_1622 | 300 |
| 299 | 3300038443 | Ga0395901_0242049 | Ga0395901_0242049_753_1658 | 300 |
| 300 | 3300041413 | Ga0439465_0031326 | Ga0439465_0031326_608_1528 | 300 |
| 301 | 3300042005 | Ga0439448_0113312 | Ga0439448_0113312_13_915 | 300 |
| 302 | 3300042438 | Ga0439459_0021043 | Ga0439459_0021043_56_958 | 300 |
| 303 | 3300046518 | Ga0495631_0124198 | Ga0495631_0124198_159_1091 | 300 |
| 304 | 3300047443 | Ga0495687_004544 | Ga0495687_004544_2920_3825 | 300 |
| 305 | 3300047472 | Ga0495686_0165982 | Ga0495686_0165982_314_1246 | 300 |
| 306 | 3300047673 | Ga0495593_0172886 | Ga0495593_0172886_121_1029 | 300 |
| 307 | 3300048907 | Ga0496104_0012572 | Ga0496104_0012572_167_1075 | 300 |
| 308 | 3300048907 | Ga0496104_0220539 | Ga0496104_0220539_61_990 | 300 |
| 309 | 3300048908 | Ga0496105_0029305 | Ga0496105_0029305_1336_2244 | 300 |
| 310 | 3300048911 | Ga0496108_0158308 | Ga0496108_0158308_48_956 | 300 |
| 311 | 3300048911 | Ga0496108_0179332 | Ga0496108_0179332_797_1729 | 300 |
| 312 | 3300048912 | Ga0496109_0031055 | Ga0496109_0031055_2198_3106 | 300 |
| 313 | 3300048913 | Ga0496110_0048250 | Ga0496110_0048250_1554_2462 | 300 |
| 314 | 3300048913 | Ga0496110_0364811 | Ga0496110_0364811_116_1024 | 300 |
| 315 | 3300048915 | Ga0496112_0146682 | Ga0496112_0146682_1386_2294 | 300 |
| 316 | 3300048915 | Ga0496112_0414785 | Ga0496112_0414785_94_1026 | 300 |
| 317 | 3300049571 | Ga0501034_0002311 | Ga0501034_0002311_9037_9945 | 300 |
| 318 | 3300049586 | Ga0501070_0338030 | Ga0501070_0338030_99_1007 | 300 |
| 319 | 3300050507 | nmdc:mga05p37_127000_c1 | nmdc:mga05p37_127000_c1_113_1021 | 300 |
| 320 | 3300050507 | nmdc:mga05p37_218308_c1 | nmdc:mga05p37_218308_c1_686_1591 | 300 |
| 321 | 3300050507 | nmdc:mga05p37_681_c1 | nmdc:mga05p37_681_c1_11376_12407 | 300 |
| 322 | 3300050508 | nmdc:mga09592_2798_c1 | nmdc:mga09592_2798_c1_4746_5777 | 300 |
| 323 | 3300050510 | nmdc:mga06r32_123580_c1 | nmdc:mga06r32_123580_c1_491_1399 | 300 |
| 324 | 3300050510 | nmdc:mga06r32_394_c1 | nmdc:mga06r32_394_c1_30440_31471 | 300 |
| 325 | 3300050511 | nmdc:mga08y16_218897_c1 | nmdc:mga08y16_218897_c1_551_1459 | 300 |
| 326 | 3300050511 | nmdc:mga08y16_4098_c1 | nmdc:mga08y16_4098_c1_5497_6528 | 300 |
| 327 | 3300050513 | nmdc:mga0rr50_154642_c1 | nmdc:mga0rr50_154642_c1_221_1201 | 300 |
| 328 | 3300053142 | Ga0500577_0086257 | Ga0500577_0086257_26_997 | 300 |
| 329 | iso_pu_bacteria | 2513237139 | 2513876499 | 300 |
| 330 | iso_pu_bacteria | 2802429603 | 2805919778 | 300 |
| 331 | iso_pu_bacteria | 2824687955 | 2824691871 | 300 |
| 332 | iso_pu_bacteria | 2824696289 | 2824699164 | 300 |
| 333 | 3300002741 | JGI25157J39369_1001347 | JGI25157J39369_10013477 | 301 |
| 334 | 3300005334 | Ga0068869_100244238 | Ga0068869_1002442382 | 301 |
| 335 | 3300005338 | Ga0068868_100026122 | Ga0068868_1000261223 | 301 |
| 336 | 3300005339 | Ga0070660_100265580 | Ga0070660_1002655802 | 301 |
| 337 | 3300005347 | Ga0070668_100230875 | Ga0070668_1002308751 | 301 |
| 338 | 3300005455 | Ga0070663_100054048 | Ga0070663_1000540482 | 301 |
| 339 | 3300005518 | Ga0070699_100233916 | Ga0070699_1002339162 | 301 |
| 340 | 3300005544 | Ga0070686_100226102 | Ga0070686_1002261021 | 301 |
| 341 | 3300005545 | Ga0070695_100077264 | Ga0070695_1000772642 | 301 |
| 342 | 3300005548 | Ga0070665_100043439 | Ga0070665_1000434393 | 301 |
| 343 | 3300005548 | Ga0070665_100153383 | Ga0070665_1001533834 | 301 |
| 344 | 3300005719 | Ga0068861_100218134 | Ga0068861_1002181342 | 301 |
| 345 | 3300005843 | Ga0068860_100019679 | Ga0068860_1000196797 | 301 |
| 346 | 3300005937 | Ga0081455_10036809 | Ga0081455_100368093 | 301 |
| 347 | 3300005983 | Ga0081540_1003843 | Ga0081540_10038437 | 301 |
| 348 | 3300005983 | Ga0081540_1053709 | Ga0081540_10537094 | 301 |
| 349 | 3300006051 | Ga0075364_10015317 | Ga0075364_100153172 | 301 |
| 350 | 3300006173 | Ga0070716_100226603 | Ga0070716_1002266033 | 301 |
| 351 | 3300006177 | Ga0075362_10084896 | Ga0075362_100848962 | 301 |
| 352 | 3300006178 | Ga0075367_10214093 | Ga0075367_102140932 | 301 |
| 353 | 3300006353 | Ga0075370_10022057 | Ga0075370_100220573 | 301 |
| 354 | 3300006846 | Ga0075430_100243428 | Ga0075430_1002434282 | 301 |
| 355 | 3300006846 | Ga0075430_100318093 | Ga0075430_1003180932 | 301 |
| 356 | 3300006847 | Ga0075431_100069941 | Ga0075431_1000699416 | 301 |
| 357 | 3300006847 | Ga0075431_100321807 | Ga0075431_1003218072 | 301 |
| 358 | 3300006871 | Ga0075434_100248633 | Ga0075434_1002486333 | 301 |
| 359 | 3300006880 | Ga0075429_100113931 | Ga0075429_1001139312 | 301 |
| 360 | 3300006880 | Ga0075429_100262989 | Ga0075429_1002629891 | 301 |
| 361 | 3300006880 | Ga0075429_100300106 | Ga0075429_1003001061 | 301 |
| 362 | 3300007076 | Ga0075435_100376158 | Ga0075435_1003761581 | 301 |
| 363 | 3300007265 | Ga0099794_10004680 | Ga0099794_100046802 | 301 |
| 364 | 3300007788 | Ga0099795_10050007 | Ga0099795_100500071 | 301 |
| 365 | 3300009011 | Ga0105251_10101294 | Ga0105251_101012941 | 301 |
| 366 | 3300009094 | Ga0111539_10152203 | Ga0111539_101522032 | 301 |
| 367 | 3300009094 | Ga0111539_10563052 | Ga0111539_105630522 | 301 |
| 368 | 3300009147 | Ga0114129_10012594 | Ga0114129_100125942 | 301 |
| 369 | 3300009147 | Ga0114129_10240543 | Ga0114129_102405432 | 301 |
| 370 | 3300009174 | Ga0105241_10265300 | Ga0105241_102653001 | 301 |
| 371 | 3300009174 | Ga0105241_10327650 | Ga0105241_103276502 | 301 |
| 372 | 3300009177 | Ga0105248_10318594 | Ga0105248_103185942 | 301 |
| 373 | 3300009177 | Ga0105248_10328910 | Ga0105248_103289102 | 301 |
| 374 | 3300009545 | Ga0105237_10027556 | Ga0105237_100275563 | 301 |
| 375 | 3300009545 | Ga0105237_10144018 | Ga0105237_101440183 | 301 |
| 376 | 3300009553 | Ga0105249_10085145 | Ga0105249_100851452 | 301 |
| 377 | 3300009553 | Ga0105249_10118371 | Ga0105249_101183712 | 301 |
| 378 | 3300010375 | Ga0105239_10050236 | Ga0105239_100502361 | 301 |
| 379 | 3300010375 | Ga0105239_10079141 | Ga0105239_100791414 | 301 |
| 380 | 3300013296 | Ga0157374_10407016 | Ga0157374_104070162 | 301 |
| 381 | 3300013306 | Ga0163162_10668292 | Ga0163162_106682922 | 301 |
| 382 | 3300013307 | Ga0157372_10564517 | Ga0157372_105645171 | 301 |
| 383 | 3300013308 | Ga0157375_10487860 | Ga0157375_104878601 | 301 |
| 384 | 3300025250 | Ga0209026_1000118 | Ga0209026_100011843 | 301 |
| 385 | 3300025256 | Ga0209759_1000076 | Ga0209759_100007686 | 301 |
| 386 | 3300025294 | Ga0209025_1016466 | Ga0209025_10164662 | 301 |
| 387 | 3300025295 | Ga0209564_1036572 | Ga0209564_10365722 | 301 |
| 388 | 3300025900 | Ga0207710_10063492 | Ga0207710_100634923 | 301 |
| 389 | 3300025909 | Ga0207705_10035840 | Ga0207705_100358403 | 301 |
| 390 | 3300025914 | Ga0207671_10038989 | Ga0207671_100389893 | 301 |
| 391 | 3300025915 | Ga0207693_10026715 | Ga0207693_100267154 | 301 |
| 392 | 3300025916 | Ga0207663_10069465 | Ga0207663_100694652 | 301 |
| 393 | 3300025923 | Ga0207681_10136920 | Ga0207681_101369202 | 301 |
| 394 | 3300025931 | Ga0207644_10065924 | Ga0207644_100659241 | 301 |
| 395 | 3300025932 | Ga0207690_10036556 | Ga0207690_100365561 | 301 |
| 396 | 3300025942 | Ga0207689_10026622 | Ga0207689_100266223 | 301 |
| 397 | 3300025961 | Ga0207712_10360085 | Ga0207712_103600851 | 301 |
| 398 | 3300026023 | Ga0207677_10233886 | Ga0207677_102338862 | 301 |
| 399 | 3300026035 | Ga0207703_10194122 | Ga0207703_101941223 | 301 |
| 400 | 3300026067 | Ga0207678_10117152 | Ga0207678_101171521 | 301 |
| 401 | 3300028379 | Ga0268266_10017370 | Ga0268266_100173703 | 301 |
| 402 | 3300028381 | Ga0268264_10002781 | Ga0268264_100027816 | 301 |
| 403 | 3300028381 | Ga0268264_10046387 | Ga0268264_100463872 | 301 |
| 404 | 3300030521 | Ga0307511_10100627 | Ga0307511_101006272 | 301 |
| 405 | 3300031507 | Ga0307509_10060170 | Ga0307509_100601703 | 301 |
| 406 | 3300031730 | Ga0307516_10214287 | Ga0307516_102142871 | 301 |
| 407 | 3300033179 | Ga0307507_10007804 | Ga0307507_1000780412 | 301 |
| 408 | 3300035086 | Ga0373934_0008273 | Ga0373934_0008273_685_1590 | 301 |
| 409 | 3300035111 | Ga0373923_0099078 | Ga0373923_0099078_167_1072 | 301 |
| 410 | 3300035118 | Ga0373954_0006543 | Ga0373954_0006543_2398_3303 | 301 |
| 411 | 3300035119 | Ga0373956_0021579 | Ga0373956_0021579_14_919 | 301 |
| 412 | 3300035172 | Ga0373955_0005698 | Ga0373955_0005698_2386_3291 | 301 |
| 413 | 3300035172 | Ga0373955_0038979 | Ga0373955_0038979_416_1321 | 301 |
| 414 | 3300035410 | Ga0373924_0020308 | Ga0373924_0020308_1328_2233 | 301 |
| 415 | 3300035691 | Ga0373931_0304737 | Ga0373931_0304737_38_949 | 301 |
| 416 | 3300035692 | Ga0373935_0096496 | Ga0373935_0096496_291_1196 | 301 |
| 417 | 3300035695 | Ga0373927_0013957 | Ga0373927_0013957_396_1301 | 301 |
| 418 | 3300035695 | Ga0373927_0040008 | Ga0373927_0040008_1284_2195 | 301 |
| 419 | 3300036401 | Ga0373937_0027072 | Ga0373937_0027072_2231_3136 | 301 |
| 420 | 3300037068 | Ga0373925_0551638 | Ga0373925_0551638_10_921 | 301 |
| 421 | 3300037466 | Ga0395898_0051986 | Ga0395898_0051986_2899_3804 | 301 |
| 422 | 3300038443 | Ga0395901_0127349 | Ga0395901_0127349_1059_1964 | 301 |
| 423 | 3300045051 | Ga0451576_0722280 | Ga0451576_0722280_63_974 | 301 |
| 424 | 3300046457 | Ga0495590_0017386 | Ga0495590_0017386_1650_2555 | 301 |
| 425 | 3300046462 | Ga0495651_0037082 | Ga0495651_0037082_685_1590 | 301 |
| 426 | 3300046472 | Ga0495580_0179785 | Ga0495580_0179785_239_1147 | 301 |
| 427 | 3300046473 | Ga0495582_0167911 | Ga0495582_0167911_160_1068 | 301 |
| 428 | 3300046474 | Ga0495605_0139926 | Ga0495605_0139926_123_1028 | 301 |
| 429 | 3300046501 | Ga0495607_0014492 | Ga0495607_0014492_1038_1943 | 301 |
| 430 | 3300046506 | Ga0495583_0002010 | Ga0495583_0002010_15946_16851 | 301 |
| 431 | 3300046511 | Ga0495608_0019214 | Ga0495608_0019214_74_979 | 301 |
| 432 | 3300046513 | Ga0495616_0013909 | Ga0495616_0013909_684_1589 | 301 |
| 433 | 3300046514 | Ga0495618_0030855 | Ga0495618_0030855_1676_2581 | 301 |
| 434 | 3300046516 | Ga0495628_0026667 | Ga0495628_0026667_1565_2470 | 301 |
| 435 | 3300046519 | Ga0495632_0111640 | Ga0495632_0111640_107_1012 | 301 |
| 436 | 3300046522 | Ga0495643_0004541 | Ga0495643_0004541_7328_8233 | 301 |
| 437 | 3300046529 | Ga0495652_0031212 | Ga0495652_0031212_2237_3142 | 301 |
| 438 | 3300046536 | Ga0495587_0013225 | Ga0495587_0013225_1781_2686 | 301 |
| 439 | 3300046542 | Ga0495597_0128082 | Ga0495597_0128082_84_989 | 301 |
| 440 | 3300046543 | Ga0495645_0022516 | Ga0495645_0022516_2550_3455 | 301 |
| 441 | 3300046557 | Ga0495622_0021827 | Ga0495622_0021827_472_1377 | 301 |
| 442 | 3300046559 | Ga0495667_0048753 | Ga0495667_0048753_57_962 | 301 |
| 443 | 3300046642 | Ga0495634_0021060 | Ga0495634_0021060_2258_3163 | 301 |
| 444 | 3300046660 | Ga0495625_0023844 | Ga0495625_0023844_3246_4151 | 301 |
| 445 | 3300046663 | Ga0495635_0005172 | Ga0495635_0005172_6372_7277 | 301 |
| 446 | 3300046663 | Ga0495635_0127405 | Ga0495635_0127405_372_1277 | 301 |
| 447 | 3300046675 | Ga0495657_0024471 | Ga0495657_0024471_1583_2488 | 301 |
| 448 | 3300046678 | Ga0495599_0118214 | Ga0495599_0118214_375_1280 | 301 |
| 449 | 3300046679 | Ga0495623_0029603 | Ga0495623_0029603_1975_2880 | 301 |
| 450 | 3300046680 | Ga0495646_0063020 | Ga0495646_0063020_200_1105 | 301 |
| 451 | 3300046689 | Ga0495613_0134073 | Ga0495613_0134073_628_1533 | 301 |
| 452 | 3300046694 | Ga0495649_0012029 | Ga0495649_0012029_3850_4755 | 301 |
| 453 | 3300046810 | Ga0495660_0010344 | Ga0495660_0010344_3078_3983 | 301 |
| 454 | 3300047315 | Ga0495581_0211532 | Ga0495581_0211532_10_918 | 301 |
| 455 | 3300047317 | Ga0495604_0018008 | Ga0495604_0018008_2165_3070 | 301 |
| 456 | 3300047319 | Ga0495674_0046149 | Ga0495674_0046149_1419_2324 | 301 |
| 457 | 3300047319 | Ga0495674_0150896 | Ga0495674_0150896_628_1539 | 301 |
| 458 | 3300047322 | Ga0495680_0069128 | Ga0495680_0069128_1556_2461 | 301 |
| 459 | 3300047443 | Ga0495687_004840 | Ga0495687_004840_5177_6082 | 301 |
| 460 | 3300047444 | Ga0495675_0013704 | Ga0495675_0013704_1938_2843 | 301 |
| 461 | 3300047471 | Ga0495684_0011844 | Ga0495684_0011844_2747_3652 | 301 |
| 462 | 3300048088 | Ga0495602_0032921 | Ga0495602_0032921_2190_3095 | 301 |
| 463 | 3300048091 | Ga0495626_0054848 | Ga0495626_0054848_161_1066 | 301 |
| 464 | 3300048903 | Ga0496100_0244424 | Ga0496100_0244424_30_941 | 301 |
| 465 | 3300048904 | Ga0496101_0106734 | Ga0496101_0106734_855_1766 | 301 |
| 466 | 3300048905 | Ga0496102_0052890 | Ga0496102_0052890_1947_2858 | 301 |
| 467 | 3300048909 | Ga0496106_0000001 | Ga0496106_0000001_297638_298594 | 301 |
| 468 | 3300048909 | Ga0496106_0016508 | Ga0496106_0016508_1224_2129 | 301 |
| 469 | 3300048909 | Ga0496106_0065306 | Ga0496106_0065306_522_1433 | 301 |
| 470 | 3300048910 | Ga0496107_0045463 | Ga0496107_0045463_1030_1941 | 301 |
| 471 | 3300048911 | Ga0496108_0008606 | Ga0496108_0008606_1661_2572 | 301 |
| 472 | 3300048912 | Ga0496109_0097880 | Ga0496109_0097880_935_1846 | 301 |
| 473 | 3300048913 | Ga0496110_0112156 | Ga0496110_0112156_1302_2213 | 301 |
| 474 | 3300048919 | Ga0496116_0118272 | Ga0496116_0118272_352_1257 | 301 |
| 475 | 3300048920 | Ga0496117_0060580 | Ga0496117_0060580_1668_2573 | 301 |
| 476 | 3300048921 | Ga0496118_0003099 | Ga0496118_0003099_10492_11397 | 301 |
| 477 | 3300048921 | Ga0496118_0069279 | Ga0496118_0069279_1144_2115 | 301 |
| 478 | 3300048922 | Ga0496119_0091638 | Ga0496119_0091638_465_1370 | 301 |
| 479 | 3300048924 | Ga0496121_0001201 | Ga0496121_0001201_28462_29367 | 301 |
| 480 | 3300048924 | Ga0496121_0015069 | Ga0496121_0015069_6767_7723 | 301 |
| 481 | 3300048924 | Ga0496121_0203178 | Ga0496121_0203178_166_1086 | 301 |
| 482 | 3300048927 | Ga0496124_0090829 | Ga0496124_0090829_1316_2221 | 301 |
| 483 | 3300048927 | Ga0496124_0154704 | Ga0496124_0154704_532_1488 | 301 |
| 484 | 3300048927 | Ga0496124_0395784 | Ga0496124_0395784_27_950 | 301 |
| 485 | 3300048928 | Ga0496125_0133030 | Ga0496125_0133030_379_1314 | 301 |
| 486 | 3300048929 | Ga0496126_0000900 | Ga0496126_0000900_7899_8870 | 301 |
| 487 | 3300048929 | Ga0496126_0006861 | Ga0496126_0006861_814_1719 | 301 |
| 488 | 3300049459 | Ga0495678_039661 | Ga0495678_039661_118_1023 | 301 |
| 489 | 3300049571 | Ga0501034_0001130 | Ga0501034_0001130_22510_23421 | 301 |
| 490 | 3300049823 | Ga0501044_0081309 | Ga0501044_0081309_1293_2204 | 301 |
| 491 | 3300050489 | nmdc:mga03683_34063_c1 | nmdc:mga03683_34063_c1_893_1804 | 301 |
| 492 | 3300050491 | nmdc:mga00v17_39422_c1 | nmdc:mga00v17_39422_c1_560_1471 | 301 |
| 493 | 3300050492 | nmdc:mga0yw44_8823_c1 | nmdc:mga0yw44_8823_c1_2457_3368 | 301 |
| 494 | 3300050494 | nmdc:mga06z11_210258_c1 | nmdc:mga06z11_210258_c1_52_987 | 301 |
| 495 | 3300050496 | nmdc:mga07m45_15399_c1 | nmdc:mga07m45_15399_c1_1950_2870 | 301 |
| 496 | 3300050507 | nmdc:mga05p37_277578_c1 | nmdc:mga05p37_277578_c1_160_1071 | 301 |
| 497 | 3300050509 | nmdc:mga0qj67_263893_c1 | nmdc:mga0qj67_263893_c1_113_1042 | 301 |
| 498 | 3300050510 | nmdc:mga06r32_330395_c1 | nmdc:mga06r32_330395_c1_487_1416 | 301 |
| 499 | 3300050510 | nmdc:mga06r32_392979_c1 | nmdc:mga06r32_392979_c1_186_1115 | 301 |
| 500 | 3300050511 | nmdc:mga08y16_218797_c1 | nmdc:mga08y16_218797_c1_661_1572 | 301 |
| 501 | 3300053077 | Ga0495601_0022661 | Ga0495601_0022661_557_1462 | 301 |
| 502 | 3300053080 | Ga0500635_0004817 | Ga0500635_0004817_1953_2858 | 301 |
| 503 | 3300053084 | Ga0495595_0004098 | Ga0495595_0004098_3014_3919 | 301 |
| 504 | 3300053091 | Ga0500647_0029719 | Ga0500647_0029719_536_1441 | 301 |
| 505 | 3300053093 | Ga0500651_0195716 | Ga0500651_0195716_140_1045 | 301 |
| 506 | 3300053096 | Ga0500641_0003413 | Ga0500641_0003413_4312_5217 | 301 |
| 507 | 3300053119 | Ga0500595_030913 | Ga0500595_030913_255_1160 | 301 |
| 508 | 3300053142 | Ga0500577_0000415 | Ga0500577_0000415_4560_5465 | 301 |
| 509 | 3300053147 | Ga0500589_004864 | Ga0500589_004864_1376_2281 | 301 |
| 510 | 3300053151 | Ga0500604_0010349 | Ga0500604_0010349_287_1192 | 301 |
| 511 | 3300053161 | Ga0500634_0082883 | Ga0500634_0082883_281_1186 | 301 |
| 512 | 3300053177 | Ga0500636_0054710 | Ga0500636_0054710_546_1451 | 301 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ihs-assembly3.cif.gz_C | crystal structure of benm_dbd/catb site 1 dna complex | 0.9302 | 6 | 88 |
| 4ihs-assembly1.cif.gz_A | crystal structure of benm_dbd/catb site 1 dna complex | 0.9283 | 6 | 88 |
| 7trv-assembly1.cif.gz_B | crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis | 0.9276 | 3 | 87 |
| 7trv-assembly1.cif.gz_A | crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis | 0.9218 | 6 | 89 |
| 4iht-assembly1.cif.gz_A | crystal structure of benm_dbd/bena site 1 dna complex | 0.9189 | 6 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57083_1_88_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.978 | 6 | 85 | 1.10.10.10 |
| af_P0A9F6_3_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9728 | 3 | 87 | 1.10.10.10 |
| af_P75836_3_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9534 | 7 | 88 | 1.10.10.10 |
| af_P67662_3_85_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9527 | 6 | 86 | 1.10.10.10 |
| af_P0A9G2_1_86_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9511 | 1 | 83 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0K2RCL1-F1-model_v4 | HTH-type transcriptional regulator GltR | 0.9029 | 5 | 82 |
GO:0003700
|
| AF-A0A258CPL3-F1-model_v4 | LysR family transcriptional regulator | 0.8993 | 3 | 86 |
GO:0003700
GO:0006351 GO:0043565 |
| AF-A0A258CPL3-F1-model_v4 | LysR family transcriptional regulator | 0.8798 | 3 | 86 |
GO:0003700
GO:0006351 GO:0043565 |
| AF-A0A1Q5IPR2-F1-model_v4 | Transcriptional regulator | 0.879 | 6 | 87 |
GO:0000976
GO:0003700 |
| AF-A0A840A4H8-F1-model_v4 | DNA-binding transcriptional LysR family regulator | 0.8745 | 3 | 93 |
GO:0000976
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar