F457506

General Info

Members Datasets Scaffolds Average Seq Length
512 357 443 301

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8019659431|8019667693
Length 360
Sequence PPLIELRAFEAAARHLSFKKAAAELGVTPTAISHQIVLLEQYCGRALFRRRPRPLSLTDAGARLFPAIRGGLEVFAAAIAAVRRDTDQQPLRVTTTNAFASRWLVPRLPAWRKLHPDVPLEVIGTDTVLDLHAGDGDVAIRYATSRVLPTDGIVNDLFSDTFWPVCNPRLLSTGRLKRPVDLANHVLIHSYWSPADREPPTWQRWFAVAQRRWREVPQFKDMQHLSFREELHAIEAVIAGQGVGIFSDVLVAHELAASTLVKAFKLSLSGYSFHVVSRPSHPRAKTIRTFSEMVAVKCLIRFFCAFEMFARRQNAKNSAWANLVRCARLSGLDKACADFASGFISSHCEFGSVFECTDPH

Samples

Sample ID Description Type Environment
1 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
4 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
5 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
6 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
7 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
8 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
9 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
10 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
11 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
12 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
13 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
14 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
15 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
16 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
17 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
18 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
19 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
20 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
21 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
22 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
23 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
24 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
25 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
26 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
27 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
28 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
29 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
30 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
31 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
32 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
33 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
34 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
35 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
36 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
37 2904456579 Variovorax sp. 2002 Isolate Unclassified
38 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
39 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
40 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
41 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
42 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
43 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
44 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
45 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
46 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
47 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
48 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
49 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
50 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
51 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
52 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
53 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
54 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
55 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
56 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
57 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
58 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
59 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
60 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
61 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
62 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
63 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
64 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
65 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
66 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
67 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
70 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
71 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
72 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
75 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
76 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
77 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
78 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
91 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
105 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
109 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
110 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
124 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
153 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
154 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
155 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
156 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
157 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
159 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
198 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
199 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
200 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
233 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
234 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
265 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
277 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
284 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
288 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
289 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
290 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
291 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
292 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
293 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
294 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
295 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
296 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
297 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
308 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
309 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
310 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
320 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
323 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
324 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
335 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
338 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
339 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
340 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
341 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
342 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
343 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
344 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
345 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
346 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
347 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
348 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
349 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
350 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
351 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
352 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
353 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
354 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
355 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
356 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
357 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.52
Metatranscriptomes 0
Isolates 13.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.27
Nodule 9.77
Rhizoplane 4.3
Rhizosphere 70.7
Stem 0
Stem Tuber 0
Unclassified 9.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1001347 3300002741 Bacteria 9698
2 rootL2_10037332 3300003322 Bacteria 3955
3 rootH1_10050544 3300003323 Bacteria 3368
4 Ga0070658_10096082 3300005327 Bacteria 2446
5 Ga0070683_100021732 3300005329 Bacteria 5729
6 Ga0070670_100184225 3300005331 Bacteria 1813
7 Ga0068869_100244238 3300005334 Bacteria 1431
8 Ga0070680_100166575 3300005336 Bacteria 1853
9 Ga0070680_100272846 3300005336 Unclassified 1432
10 Ga0068868_100026122 3300005338 Bacteria 4447
11 Ga0070660_100025489 3300005339 Bacteria 4395
12 Ga0070660_100035784 3300005339 Bacteria 3759
13 Ga0070660_100265580 3300005339 Bacteria 1402
14 Ga0070691_10061597 3300005341 Bacteria 1805
15 Ga0070691_10113516 3300005341 Bacteria 1357
16 Ga0070661_100410803 3300005344 Bacteria 1072
17 Ga0070668_100230875 3300005347 Bacteria 1530
18 Ga0070671_100097434 3300005355 Bacteria 2466
19 Ga0070659_100058902 3300005366 Bacteria 3032
20 Ga0070659_100470967 3300005366 Bacteria 1068
21 Ga0070709_10005233 3300005434 Bacteria 7020
22 Ga0070714_100199418 3300005435 Bacteria 1830
23 Ga0070713_100441411 3300005436 Bacteria 1221
24 Ga0070711_100009618 3300005439 Bacteria 5956
25 Ga0070711_100183253 3300005439 Bacteria 1604
26 Ga0070708_100222077 3300005445 Bacteria 1772
27 Ga0070663_100054048 3300005455 Bacteria 2869
28 Ga0070663_100236290 3300005455 Bacteria 1441
29 Ga0070678_100104609 3300005456 Bacteria 2202
30 Ga0070681_10094056 3300005458 Bacteria 2946
31 Ga0070706_100194888 3300005467 Unclassified 1893
32 Ga0070706_100553831 3300005467 Bacteria 1070
33 Ga0070707_100054322 3300005468 Bacteria 3840
34 Ga0070698_100034868 3300005471 Bacteria 5205
35 Ga0070699_100233916 3300005518 Bacteria 1639
36 Ga0070699_100427553 3300005518 Bacteria 1199
37 Ga0070679_100107280 3300005530 Bacteria 2778
38 Ga0070679_100359065 3300005530 Unclassified 1404
39 Ga0070684_100037298 3300005535 Bacteria 4169
40 Ga0070684_100063099 3300005535 Bacteria 3247
41 Ga0070697_100456825 3300005536 Bacteria 1113
42 Ga0068853_100107365 3300005539 Bacteria 2475
43 Ga0070686_100226102 3300005544 Bacteria 1355
44 Ga0070695_100020354 3300005545 Bacteria 4050
45 Ga0070695_100077264 3300005545 Bacteria 2194
46 Ga0070665_100043439 3300005548 Bacteria 4518
47 Ga0070665_100153383 3300005548 Bacteria 2306
48 Ga0068855_100149853 3300005563 Bacteria 2652
49 Ga0068855_100501727 3300005563 Bacteria 1318
50 Ga0070664_100097429 3300005564 Bacteria 2553
51 Ga0068857_100026661 3300005577 Bacteria 5093
52 Ga0068857_100564312 3300005577 Bacteria 1073
53 Ga0068854_100172970 3300005578 Bacteria 1682
54 Ga0068856_100050075 3300005614 Bacteria 4117
55 Ga0068852_100014091 3300005616 Bacteria 6138
56 Ga0068852_100136055 3300005616 Bacteria 2269
57 Ga0068859_100069418 3300005617 Bacteria 3559
58 Ga0068864_100009204 3300005618 Bacteria 8145
59 Ga0068861_100063555 3300005719 Bacteria 2838
60 Ga0068861_100218134 3300005719 Bacteria 1611
61 Ga0068851_10136641 3300005834 Bacteria 1330
62 Ga0068860_100019679 3300005843 Bacteria 6545
63 Ga0081455_10014776 3300005937 Bacteria 7618
64 Ga0081455_10036809 3300005937 Bacteria 4352
65 Ga0081540_1003843 3300005983 Bacteria 11743
66 Ga0081540_1053709 3300005983 Bacteria 1973
67 Ga0075365_10003792 3300006038 Bacteria 7882
68 Ga0075364_10015317 3300006051 Bacteria 4753
69 Ga0070716_100226603 3300006173 Bacteria 1259
70 Ga0070712_100315992 3300006175 Unclassified 1269
71 Ga0075362_10084896 3300006177 Bacteria 1463
72 Ga0075367_10214093 3300006178 Bacteria 1205
73 Ga0097621_100254757 3300006237 Bacteria 1538
74 Ga0075370_10022057 3300006353 Bacteria 3492
75 Ga0075428_100001655 3300006844 Bacteria 23712
76 Ga0075428_100011074 3300006844 Bacteria 10033
77 Ga0075428_100049115 3300006844 Bacteria 4630
78 Ga0075428_100132500 3300006844 Bacteria 2710
79 Ga0075430_100243428 3300006846 Unclassified 1490
80 Ga0075430_100318093 3300006846 Bacteria 1287
81 Ga0075431_100000251 3300006847 Bacteria 40790
82 Ga0075431_100002605 3300006847 Bacteria 17444
83 Ga0075431_100069941 3300006847 Unclassified 3621
84 Ga0075431_100131788 3300006847 Bacteria 2578
85 Ga0075431_100210040 3300006847 Bacteria 1989
86 Ga0075431_100321807 3300006847 Bacteria 1559
87 Ga0075434_100248633 3300006871 Bacteria 1797
88 Ga0075429_100001930 3300006880 Bacteria 17187
89 Ga0075429_100113931 3300006880 Bacteria 2363
90 Ga0075429_100262989 3300006880 Bacteria 1511
91 Ga0075429_100300106 3300006880 Unclassified 1406
92 Ga0075436_100217374 3300006914 Bacteria 1356
93 Ga0097620_100069414 3300006931 Bacteria 3559
94 Ga0099824_1005150 3300006942 Bacteria 18530
95 Ga0075435_100043122 3300007076 Bacteria 3611
96 Ga0075435_100376158 3300007076 Bacteria 1220
97 Ga0099794_10004680 3300007265 Bacteria 5417
98 Ga0099794_10010178 3300007265 Bacteria 3984
99 Ga0099795_10001073 3300007788 Bacteria 5654
100 Ga0099795_10050007 3300007788 Bacteria 1518
101 Ga0105251_10101294 3300009011 Bacteria 1316
102 Ga0105240_10031664 3300009093 Bacteria 6854
103 Ga0111539_10001595 3300009094 Bacteria 30229
104 Ga0111539_10152203 3300009094 Bacteria 2707
105 Ga0111539_10563052 3300009094 Bacteria 1327
106 Ga0111539_10636150 3300009094 Bacteria 1242
107 Ga0105245_10042164 3300009098 Bacteria 4071
108 Ga0105247_10077438 3300009101 Bacteria 2090
109 Ga0114129_10000066 3300009147 Bacteria 93802
110 Ga0114129_10012594 3300009147 Bacteria 12042
111 Ga0114129_10240543 3300009147 Bacteria 2433
112 Ga0114129_10249794 3300009147 Bacteria 2382
113 Ga0114129_10256323 3300009147 Bacteria 2346
114 Ga0114129_10935769 3300009147 Bacteria 1096
115 Ga0105241_10265300 3300009174 Bacteria 1461
116 Ga0105241_10327650 3300009174 Bacteria 1323
117 Ga0105242_10364013 3300009176 Unclassified 1339
118 Ga0105248_10318594 3300009177 Bacteria 1751
119 Ga0105248_10328910 3300009177 Bacteria 1721
120 Ga0105237_10027556 3300009545 Bacteria 5798
121 Ga0105237_10144018 3300009545 Bacteria 2377
122 Ga0105237_10176087 3300009545 Bacteria 2139
123 Ga0105237_10404197 3300009545 Bacteria 1370
124 Ga0105238_10153397 3300009551 Bacteria 2279
125 Ga0105249_10085145 3300009553 Bacteria 2945
126 Ga0105249_10118371 3300009553 Bacteria 2514
127 Ga0099796_10001125 3300010159 Bacteria 5154
128 Ga0105239_10050236 3300010375 Bacteria 4574
129 Ga0105239_10079141 3300010375 Bacteria 3617
130 Ga0105239_10215995 3300010375 Bacteria 2150
131 Ga0105239_10485277 3300010375 Bacteria 1404
132 Ga0105246_10154985 3300011119 Bacteria 1739
133 Ga0157370_10011815 3300013104 Bacteria 9112
134 Ga0157370_10063238 3300013104 Bacteria 3507
135 Ga0157370_10225597 3300013104 Bacteria 1734
136 Ga0157369_10020952 3300013105 Bacteria 7309
137 Ga0157369_10033836 3300013105 Bacteria 5613
138 Ga0157369_10369524 3300013105 Bacteria 1489
139 Ga0157369_10518584 3300013105 Bacteria 1233
140 Ga0157374_10010646 3300013296 Bacteria 7921
141 Ga0157374_10407016 3300013296 Bacteria 1358
142 Ga0157378_10299318 3300013297 Bacteria 1556
143 Ga0163162_10317964 3300013306 Bacteria 1689
144 Ga0163162_10668292 3300013306 Bacteria 1162
145 Ga0157372_10067552 3300013307 Bacteria 4017
146 Ga0157372_10157194 3300013307 Bacteria 2626
147 Ga0157372_10564517 3300013307 Bacteria 1327
148 Ga0157375_10077081 3300013308 Bacteria 3362
149 Ga0157375_10179371 3300013308 Bacteria 2269
150 Ga0157375_10273565 3300013308 Bacteria 1851
151 Ga0157375_10487860 3300013308 Bacteria 1397
152 Ga0163163_10212578 3300014325 Bacteria 1983
153 Ga0163163_10266172 3300014325 Bacteria 1765
154 Ga0182008_10035739 3300014497 Bacteria 2487
155 Ga0157379_10220431 3300014968 Bacteria 1719
156 Ga0157376_10132033 3300014969 Bacteria 2230
157 Ga0182006_1040741 3300015261 Bacteria 1827
158 Ga0214544_1000009 3300021320 Bacteria 285865
159 Ga0214542_1000002 3300021321 Bacteria 720798
160 Ga0214545_1000002 3300021324 Bacteria 727485
161 Ga0214543_1000013 3300021327 Bacteria 329117
162 Ga0209026_1000118 3300025250 Bacteria 130611
163 Ga0209148_1014455 3300025254 Bacteria 1394
164 Ga0209759_1000076 3300025256 Bacteria 175911
165 Ga0209025_1016466 3300025294 Bacteria 4358
166 Ga0209564_1036572 3300025295 Bacteria 1399
167 Ga0209758_1000808 3300025297 Bacteria 44084
168 Ga0207656_10031840 3300025321 Bacteria 2188
169 Ga0207710_10063492 3300025900 Bacteria 1680
170 Ga0207710_10110625 3300025900 Bacteria 1304
171 Ga0207705_10035840 3300025909 Bacteria 3550
172 Ga0207705_10175106 3300025909 Bacteria 1617
173 Ga0207684_10105256 3300025910 Unclassified 2413
174 Ga0207707_10004215 3300025912 Bacteria 12726
175 Ga0207707_10074204 3300025912 Bacteria 2967
176 Ga0207695_10108446 3300025913 Bacteria 2761
177 Ga0207671_10038989 3300025914 Bacteria 3520
178 Ga0207671_10051739 3300025914 Bacteria 3044
179 Ga0207693_10020887 3300025915 Bacteria 5205
180 Ga0207693_10026715 3300025915 Bacteria 4567
181 Ga0207663_10020497 3300025916 Bacteria 3744
182 Ga0207663_10069465 3300025916 Bacteria 2266
183 Ga0207663_10161069 3300025916 Bacteria 1584
184 Ga0207660_10233871 3300025917 Unclassified 1446
185 Ga0207657_10006008 3300025919 Bacteria 12636
186 Ga0207657_10018110 3300025919 Bacteria 6738
187 Ga0207652_10181986 3300025921 Unclassified 1889
188 Ga0207646_10219228 3300025922 Bacteria 1719
189 Ga0207681_10136920 3300025923 Bacteria 1819
190 Ga0207687_10069766 3300025927 Bacteria 2507
191 Ga0207664_10119204 3300025929 Bacteria 2206
192 Ga0207644_10065924 3300025931 Bacteria 2635
193 Ga0207644_10269560 3300025931 Bacteria 1364
194 Ga0207690_10036556 3300025932 Bacteria 3181
195 Ga0207690_10119809 3300025932 Bacteria 1910
196 Ga0207690_10192996 3300025932 Bacteria 1541
197 Ga0207670_10391557 3300025936 Bacteria 1109
198 Ga0207669_10098355 3300025937 Bacteria 1927
199 Ga0207665_10164376 3300025939 Bacteria 1599
200 Ga0207689_10026622 3300025942 Bacteria 4845
201 Ga0207661_10018806 3300025944 Bacteria 5140
202 Ga0207679_10201653 3300025945 Bacteria 1662
203 Ga0207679_10253860 3300025945 Bacteria 1496
204 Ga0207712_10360085 3300025961 Bacteria 1212
205 Ga0207668_10300836 3300025972 Bacteria 1324
206 Ga0207677_10233886 3300026023 Bacteria 1482
207 Ga0207677_10258662 3300026023 Bacteria 1418
208 Ga0207703_10194122 3300026035 Bacteria 1800
209 Ga0207639_10228969 3300026041 Bacteria 1610
210 Ga0207678_10071668 3300026067 Bacteria 2971
211 Ga0207678_10117152 3300026067 Bacteria 2273
212 Ga0207678_10351427 3300026067 Bacteria 1271
213 Ga0207702_10037716 3300026078 Bacteria 4046
214 Ga0207702_10572895 3300026078 Bacteria 1106
215 Ga0207676_10027290 3300026095 Bacteria 4252
216 Ga0207674_10154232 3300026116 Bacteria 2252
217 Ga0207674_10586680 3300026116 Bacteria 1077
218 Ga0207675_100100251 3300026118 Bacteria 2728
219 Ga0207675_100215384 3300026118 Bacteria 1849
220 Ga0207698_10431546 3300026142 Bacteria 1267
221 Ga0209389_1000026 3300027296 Bacteria 147580
222 Ga0209389_1000117 3300027296 Bacteria 71506
223 Ga0209589_1000022 3300027357 Bacteria 180757
224 Ga0209489_100058 3300027361 Bacteria 147117
225 Ga0209489_102405 3300027361 Bacteria 38216
226 Ga0209700_100021 3300027363 Bacteria 230859
227 Ga0207428_10000891 3300027907 Bacteria 33501
228 Ga0268266_10017370 3300028379 Bacteria 6139
229 Ga0268265_10135323 3300028380 Bacteria 2055
230 Ga0268264_10002781 3300028381 Bacteria 15267
231 Ga0268264_10046387 3300028381 Bacteria 3609
232 Ga0307515_10055973 3300028794 Bacteria 5745
233 Ga0307511_10100627 3300030521 Bacteria 1900
234 Ga0307509_10060170 3300031507 Bacteria 4015
235 Ga0307516_10214287 3300031730 Bacteria 1638
236 Ga0307507_10007804 3300033179 Bacteria 15233
237 Ga0373934_0008273 3300035086 Bacteria 3874
238 Ga0373934_0041096 3300035086 Bacteria 1825
239 Ga0373923_0099078 3300035111 Bacteria 1283
240 Ga0373936_0016796 3300035113 Bacteria 2817
241 Ga0373941_0006720 3300035115 Bacteria 2782
242 Ga0373954_0006543 3300035118 Bacteria 5078
243 Ga0373954_0041691 3300035118 Bacteria 2141
244 Ga0373956_0021579 3300035119 Bacteria 2747
245 Ga0373957_0168131 3300035120 Bacteria 905
246 Ga0373943_0010120 3300035170 Bacteria 4231
247 Ga0373946_0003431 3300035171 Bacteria 5623
248 Ga0373955_0005698 3300035172 Bacteria 5606
249 Ga0373955_0038979 3300035172 Bacteria 2534
250 Ga0373924_0020308 3300035410 Bacteria 2580
251 Ga0373931_0002116 3300035691 Bacteria 8744
252 Ga0373931_0304737 3300035691 Bacteria 985
253 Ga0373935_0000128 3300035692 Bacteria 34347
254 Ga0373935_0096496 3300035692 Bacteria 1943
255 Ga0373927_0013611 3300035695 Bacteria 5402
256 Ga0373927_0013957 3300035695 Bacteria 5328
257 Ga0373927_0040008 3300035695 Bacteria 3042
258 Ga0373947_0006253 3300035725 Bacteria 6924
259 Ga0373937_0027072 3300036401 Bacteria 5182
260 Ga0373925_0002522 3300037068 Bacteria 14617
261 Ga0373925_0551638 3300037068 Bacteria 948
262 Ga0395899_0003556 3300037312 Bacteria 12338
263 Ga0395899_0023932 3300037312 Bacteria 4621
264 Ga0395900_0005201 3300037418 Bacteria 13656
265 Ga0395900_0194095 3300037418 Bacteria 2058
266 Ga0395898_0011685 3300037466 Bacteria 9107
267 Ga0395898_0051986 3300037466 Bacteria 4004
268 Ga0395898_0086408 3300037466 Bacteria 3023
269 Ga0395898_0238381 3300037466 Bacteria 1735
270 Ga0395905_0009284 3300037471 Bacteria 9620
271 Ga0395905_0011866 3300037471 Bacteria 8412
272 Ga0395905_0149891 3300037471 Bacteria 2194
273 Ga0395901_0010742 3300038443 Bacteria 9284
274 Ga0395901_0123098 3300038443 Bacteria 2726
275 Ga0395901_0127349 3300038443 Bacteria 2676
276 Ga0395901_0242049 3300038443 Bacteria 1881
277 Ga0439465_0031326 3300041413 Bacteria 1694
278 Ga0439448_0113312 3300042005 Bacteria 927
279 Ga0439459_0021043 3300042438 Bacteria 1249
280 Ga0451576_0722280 3300045051 Bacteria 1047
281 Ga0495592_0010943 3300046454 Bacteria 6847
282 Ga0495603_0001212 3300046455 Bacteria 15064
283 Ga0495603_0023141 3300046455 Bacteria 3761
284 Ga0495590_0017386 3300046457 Bacteria 2589
285 Ga0495629_0001713 3300046459 Bacteria 17220
286 Ga0495641_0000402 3300046461 Bacteria 36037
287 Ga0495651_0037082 3300046462 Bacteria 3795
288 Ga0495653_0400446 3300046463 Bacteria 873
289 Ga0495580_0001155 3300046472 Bacteria 23222
290 Ga0495580_0179785 3300046472 Bacteria 1461
291 Ga0495582_0000063 3300046473 Bacteria 54381
292 Ga0495582_0167911 3300046473 Bacteria 1249
293 Ga0495605_0139926 3300046474 Bacteria 1086
294 Ga0495639_0001528 3300046475 Bacteria 10322
295 Ga0495639_0089047 3300046475 Bacteria 1446
296 Ga0495662_0004861 3300046476 Bacteria 6732
297 Ga0495664_0004784 3300046477 Bacteria 7407
298 Ga0495594_0000237 3300046499 Bacteria 26610
299 Ga0495607_0014492 3300046501 Bacteria 5125
300 Ga0495583_0002010 3300046506 Bacteria 18560
301 Ga0495608_0019214 3300046511 Bacteria 4705
302 Ga0495616_0013909 3300046513 Bacteria 4522
303 Ga0495618_0030855 3300046514 Bacteria 3350
304 Ga0495628_0026667 3300046516 Bacteria 4707
305 Ga0495628_0065756 3300046516 Bacteria 2835
306 Ga0495630_0010676 3300046517 Bacteria 6631
307 Ga0495631_0124198 3300046518 Bacteria 1110
308 Ga0495632_0111640 3300046519 Bacteria 1283
309 Ga0495643_0004541 3300046522 Bacteria 9662
310 Ga0495666_0013601 3300046526 Bacteria 4058
311 Ga0495652_0018844 3300046529 Bacteria 6151
312 Ga0495652_0031212 3300046529 Bacteria 4667
313 Ga0495665_0001528 3300046531 Bacteria 12332
314 Ga0495587_0013225 3300046536 Bacteria 5187
315 Ga0495621_0099460 3300046539 Bacteria 1105
316 Ga0495597_0128082 3300046542 Bacteria 1054
317 Ga0495645_0022516 3300046543 Bacteria 4559
318 Ga0495622_0001950 3300046557 Bacteria 10129
319 Ga0495622_0021827 3300046557 Bacteria 2982
320 Ga0495667_0048753 3300046559 Bacteria 2796
321 Ga0495667_0057384 3300046559 Bacteria 2559
322 Ga0495634_0000645 3300046642 Bacteria 33906
323 Ga0495634_0021060 3300046642 Bacteria 4616
324 Ga0495625_0023844 3300046660 Bacteria 4669
325 Ga0495625_0223192 3300046660 Bacteria 1234
326 Ga0495635_0000640 3300046663 Bacteria 22461
327 Ga0495635_0005172 3300046663 Bacteria 9080
328 Ga0495635_0127405 3300046663 Bacteria 1736
329 Ga0495588_0015704 3300046674 Bacteria 3650
330 Ga0495588_0050239 3300046674 Bacteria 2145
331 Ga0495657_0024471 3300046675 Bacteria 4299
332 Ga0495599_0045305 3300046678 Bacteria 2758
333 Ga0495599_0118214 3300046678 Bacteria 1648
334 Ga0495623_0029603 3300046679 Bacteria 3523
335 Ga0495646_0059637 3300046680 Bacteria 2278
336 Ga0495646_0063020 3300046680 Bacteria 2203
337 Ga0495647_0000793 3300046681 Bacteria 9422
338 Ga0495658_0001369 3300046683 Bacteria 12785
339 Ga0495613_0134073 3300046689 Bacteria 1773
340 Ga0495624_0000224 3300046690 Bacteria 44228
341 Ga0495649_0012029 3300046694 Bacteria 5054
342 Ga0495600_0180030 3300046809 Bacteria 1362
343 Ga0495660_0010344 3300046810 Bacteria 5425
344 Ga0495581_0000237 3300047315 Bacteria 26157
345 Ga0495581_0211532 3300047315 Bacteria 1134
346 Ga0495604_0018008 3300047317 Bacteria 5653
347 Ga0495674_0001107 3300047319 Bacteria 25900
348 Ga0495674_0046149 3300047319 Bacteria 3868
349 Ga0495674_0150896 3300047319 Bacteria 1949
350 Ga0495676_0006639 3300047321 Bacteria 10666
351 Ga0495680_0069128 3300047322 Bacteria 2695
352 Ga0495687_004544 3300047443 Bacteria 9306
353 Ga0495687_004840 3300047443 Bacteria 8858
354 Ga0495675_0013704 3300047444 Bacteria 5123
355 Ga0495684_0011844 3300047471 Bacteria 6730
356 Ga0495684_0016387 3300047471 Bacteria 5707
357 Ga0495686_0165982 3300047472 Bacteria 1287
358 Ga0495593_0000150 3300047673 Bacteria 34569
359 Ga0495593_0172886 3300047673 Bacteria 1089
360 Ga0495602_0032921 3300048088 Bacteria 4872
361 Ga0495626_0054848 3300048091 Bacteria 1829
362 Ga0496100_0244424 3300048903 Bacteria 1325
363 Ga0496101_0106734 3300048904 Bacteria 2103
364 Ga0496102_0052890 3300048905 Bacteria 3701
365 Ga0496104_0012572 3300048907 Bacteria 7618
366 Ga0496104_0220539 3300048907 Bacteria 1809
367 Ga0496105_0029305 3300048908 Bacteria 4505
368 Ga0496106_0000001 3300048909 Bacteria 497458
369 Ga0496106_0016508 3300048909 Bacteria 5464
370 Ga0496106_0065306 3300048909 Bacteria 2770
371 Ga0496107_0045463 3300048910 Bacteria 3158
372 Ga0496108_0008606 3300048911 Bacteria 8275
373 Ga0496108_0158308 3300048911 Bacteria 1956
374 Ga0496108_0179332 3300048911 Bacteria 1834
375 Ga0496109_0031055 3300048912 Bacteria 4791
376 Ga0496109_0097880 3300048912 Bacteria 2719
377 Ga0496110_0048250 3300048913 Bacteria 3733
378 Ga0496110_0112156 3300048913 Bacteria 2451
379 Ga0496110_0120360 3300048913 Bacteria 2365
380 Ga0496110_0364811 3300048913 Bacteria 1316
381 Ga0496112_0146682 3300048915 Bacteria 2328
382 Ga0496112_0414785 3300048915 Bacteria 1286
383 Ga0496116_0118272 3300048919 Bacteria 1540
384 Ga0496117_0060580 3300048920 Bacteria 2607
385 Ga0496118_0003099 3300048921 Bacteria 21319
386 Ga0496118_0069279 3300048921 Bacteria 2556
387 Ga0496119_0091638 3300048922 Bacteria 1726
388 Ga0496121_0001201 3300048924 Bacteria 45377
389 Ga0496121_0015069 3300048924 Bacteria 8134
390 Ga0496121_0203178 3300048924 Bacteria 1410
391 Ga0496124_0090829 3300048927 Bacteria 2490
392 Ga0496124_0154704 3300048927 Bacteria 1794
393 Ga0496124_0395784 3300048927 Bacteria 960
394 Ga0496125_0133030 3300048928 Bacteria 1746
395 Ga0496126_0000900 3300048929 Bacteria 51728
396 Ga0496126_0006861 3300048929 Bacteria 12621
397 Ga0495678_039661 3300049459 Bacteria 1898
398 Ga0501034_0001130 3300049571 Bacteria 37180
399 Ga0501034_0002311 3300049571 Bacteria 23303
400 Ga0501034_0317553 3300049571 Bacteria 1491
401 Ga0501070_0338030 3300049586 Bacteria 1223
402 Ga0501044_0081309 3300049823 Bacteria 3280
403 nmdc:mga03683_34063_c1 3300050489 Bacteria 2059
404 nmdc:mga00v17_39422_c1 3300050491 Bacteria 2829
405 nmdc:mga0yw44_8823_c1 3300050492 Bacteria 5049
406 nmdc:mga0k408_17540_c1 3300050493 Bacteria 3990
407 nmdc:mga06z11_210258_c1 3300050494 Bacteria 1133
408 nmdc:mga07m45_15399_c1 3300050496 Bacteria 4083
409 nmdc:mga05p37_127000_c1 3300050507 Bacteria 3131
410 nmdc:mga05p37_218308_c1 3300050507 Bacteria 2302
411 nmdc:mga05p37_277578_c1 3300050507 Bacteria 2000
412 nmdc:mga05p37_669026_c1 3300050507 Bacteria 1159
413 nmdc:mga05p37_681_c1 3300050507 Bacteria 37660
414 nmdc:mga09592_2798_c1 3300050508 Bacteria 14136
415 nmdc:mga09592_44098_c1 3300050508 Bacteria 3753
416 nmdc:mga0qj67_263893_c1 3300050509 Bacteria 1397
417 nmdc:mga06r32_123580_c1 3300050510 Bacteria 2554
418 nmdc:mga06r32_330395_c1 3300050510 Unclassified 1510
419 nmdc:mga06r32_392979_c1 3300050510 Bacteria 1369
420 nmdc:mga06r32_394_c1 3300050510 Bacteria 36886
421 nmdc:mga06r32_5029_c1 3300050510 Bacteria 11903
422 nmdc:mga08y16_218797_c1 3300050511 Bacteria 1972
423 nmdc:mga08y16_218897_c1 3300050511 Bacteria 1971
424 nmdc:mga08y16_4098_c1 3300050511 Bacteria 15215
425 nmdc:mga0rr50_154642_c1 3300050513 Bacteria 1857
426 nmdc:mga08x19_221675_c1 3300050514 Bacteria 1299
427 Ga0495601_0022661 3300053077 Bacteria 3858
428 Ga0495601_0197241 3300053077 Bacteria 1316
429 Ga0495612_0057484 3300053078 Bacteria 1606
430 Ga0500635_0004817 3300053080 Bacteria 3496
431 Ga0495595_0004098 3300053084 Bacteria 5842
432 Ga0495619_0334859 3300053085 Bacteria 1048
433 Ga0500647_0029719 3300053091 Bacteria 2593
434 Ga0500651_0195716 3300053093 Bacteria 1195
435 Ga0500641_0003413 3300053096 Bacteria 5619
436 Ga0500595_030913 3300053119 Bacteria 1800
437 Ga0500577_0000415 3300053142 Bacteria 10941
438 Ga0500577_0086257 3300053142 Bacteria 1261
439 Ga0500589_004864 3300053147 Bacteria 5141
440 Ga0500604_0010349 3300053151 Bacteria 2494
441 Ga0500634_0082883 3300053161 Bacteria 1648
442 Ga0500638_097942 3300053162 Bacteria 1372
443 Ga0500636_0054710 3300053177 Bacteria 2339

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_10364013 Ga0105242_103640132 241
2 3300053077 Ga0495601_0197241 Ga0495601_0197241_575_1306 241
3 3300035120 Ga0373957_0168131 Ga0373957_0168131_13_774 243
4 3300046463 Ga0495653_0400446 Ga0495653_0400446_95_856 243
5 3300014968 Ga0157379_10220431 Ga0157379_102204312 251
6 3300025900 Ga0207710_10110625 Ga0207710_101106251 252
7 3300006847 Ga0075431_100002605 Ga0075431_10000260513 273
8 3300005439 Ga0070711_100183253 Ga0070711_1001832532 279
9 3300025916 Ga0207663_10161069 Ga0207663_101610691 279
10 3300005616 Ga0068852_100136055 Ga0068852_1001360552 280
11 3300053162 Ga0500638_097942 Ga0500638_097942_86_958 280
12 3300005937 Ga0081455_10014776 Ga0081455_100147768 282
13 3300006038 Ga0075365_10003792 Ga0075365_100037927 282
14 3300006844 Ga0075428_100011074 Ga0075428_1000110747 282
15 3300005436 Ga0070713_100441411 Ga0070713_1004414112 285
16 3300009545 Ga0105237_10404197 Ga0105237_104041972 285
17 3300013105 Ga0157369_10369524 Ga0157369_103695242 285
18 3300035086 Ga0373934_0041096 Ga0373934_0041096_74_961 285
19 3300035113 Ga0373936_0016796 Ga0373936_0016796_687_1574 285
20 3300035118 Ga0373954_0041691 Ga0373954_0041691_1200_2087 285
21 3300035170 Ga0373943_0010120 Ga0373943_0010120_181_1068 285
22 3300035171 Ga0373946_0003431 Ga0373946_0003431_2267_3154 285
23 3300035692 Ga0373935_0000128 Ga0373935_0000128_28781_29668 285
24 3300035695 Ga0373927_0013611 Ga0373927_0013611_644_1531 285
25 3300035725 Ga0373947_0006253 Ga0373947_0006253_1000_1887 285
26 3300037068 Ga0373925_0002522 Ga0373925_0002522_3792_4679 285
27 3300046454 Ga0495592_0010943 Ga0495592_0010943_3931_4818 285
28 3300046455 Ga0495603_0001212 Ga0495603_0001212_7039_7926 285
29 3300046459 Ga0495629_0001713 Ga0495629_0001713_5836_6723 285
30 3300046461 Ga0495641_0000402 Ga0495641_0000402_5976_6863 285
31 3300046472 Ga0495580_0001155 Ga0495580_0001155_4594_5481 285
32 3300046473 Ga0495582_0000063 Ga0495582_0000063_46143_47030 285
33 3300046475 Ga0495639_0001528 Ga0495639_0001528_1528_2415 285
34 3300046476 Ga0495662_0004861 Ga0495662_0004861_2094_2981 285
35 3300046477 Ga0495664_0004784 Ga0495664_0004784_4172_5059 285
36 3300046499 Ga0495594_0000237 Ga0495594_0000237_7988_8875 285
37 3300046516 Ga0495628_0065756 Ga0495628_0065756_284_1171 285
38 3300046517 Ga0495630_0010676 Ga0495630_0010676_442_1329 285
39 3300046526 Ga0495666_0013601 Ga0495666_0013601_959_1846 285
40 3300046529 Ga0495652_0018844 Ga0495652_0018844_2752_3639 285
41 3300046531 Ga0495665_0001528 Ga0495665_0001528_1138_2025 285
42 3300046557 Ga0495622_0001950 Ga0495622_0001950_7442_8329 285
43 3300046559 Ga0495667_0057384 Ga0495667_0057384_521_1408 285
44 3300046642 Ga0495634_0000645 Ga0495634_0000645_25033_25920 285
45 3300046663 Ga0495635_0000640 Ga0495635_0000640_17371_18258 285
46 3300046674 Ga0495588_0015704 Ga0495588_0015704_644_1531 285
47 3300046678 Ga0495599_0045305 Ga0495599_0045305_773_1660 285
48 3300046680 Ga0495646_0059637 Ga0495646_0059637_75_962 285
49 3300046681 Ga0495647_0000793 Ga0495647_0000793_4575_5462 285
50 3300046683 Ga0495658_0001369 Ga0495658_0001369_4839_5726 285
51 3300046690 Ga0495624_0000224 Ga0495624_0000224_35589_36476 285
52 3300046809 Ga0495600_0180030 Ga0495600_0180030_306_1193 285
53 3300047315 Ga0495581_0000237 Ga0495581_0000237_25015_25902 285
54 3300047319 Ga0495674_0001107 Ga0495674_0001107_17471_18358 285
55 3300047321 Ga0495676_0006639 Ga0495676_0006639_3008_3895 285
56 3300047471 Ga0495684_0016387 Ga0495684_0016387_2705_3592 285
57 3300047673 Ga0495593_0000150 Ga0495593_0000150_7632_8519 285
58 3300048913 Ga0496110_0120360 Ga0496110_0120360_100_987 285
59 3300053085 Ga0495619_0334859 Ga0495619_0334859_140_1027 285
60 3300005563 Ga0068855_100501727 Ga0068855_1005017271 289
61 3300005471 Ga0070698_100034868 Ga0070698_1000348683 291
62 3300006175 Ga0070712_100315992 Ga0070712_1003159922 291
63 3300025910 Ga0207684_10105256 Ga0207684_101052562 291
64 3300050493 nmdc:mga0k408_17540_c1 nmdc:mga0k408_17540_c1_2684_3589 291
65 3300005467 Ga0070706_100194888 Ga0070706_1001948882 292
66 iso_pu_bacteria 2857524615 2857529729 293
67 3300005341 Ga0070691_10113516 Ga0070691_101135162 295
68 3300005545 Ga0070695_100020354 Ga0070695_1000203544 295
69 3300005719 Ga0068861_100063555 Ga0068861_1000635553 295
70 3300026116 Ga0207674_10154232 Ga0207674_101542322 295
71 3300026118 Ga0207675_100100251 Ga0207675_1001002514 295
72 iso_pu_bacteria 2515154122 2515685688 295
73 iso_pu_bacteria 2515154189 2516021835 295
74 iso_pu_bacteria 2883087390 2883089015 295
75 iso_pu_bacteria 2885270888 2885277113 295
76 iso_pu_bacteria 2902682994 2902688178 295
77 iso_pu_bacteria 2935608549 2935615192 295
78 iso_pu_bacteria 8019648815 8019654787 295
79 iso_pu_bacteria 2513237092 2513627196 296
80 iso_pu_bacteria 2513237094 2513637869 296
81 iso_pu_bacteria 2513237161 2514010840 296
82 iso_pu_bacteria 2599185301 2599941048 296
83 iso_pu_bacteria 2617270735 2617354074 296
84 iso_pu_bacteria 2617270741 2617376658 296
85 iso_pu_bacteria 2617270742 2617380961 296
86 iso_pu_bacteria 2824679649 2824682522 296
87 iso_pu_bacteria 2824732956 2824735734 296
88 iso_pu_bacteria 2824746037 2824751690 296
89 iso_pu_bacteria 2824773399 2824779102 296
90 iso_pu_bacteria 2838122688 2838126501 296
91 iso_pu_bacteria 2841941048 2841947158 296
92 iso_pu_bacteria 2841949485 2841950602 296
93 iso_pu_bacteria 2841966195 2841966916 296
94 iso_pu_bacteria 2841974524 2841975665 296
95 iso_pu_bacteria 2841983080 2841990028 296
96 iso_pu_bacteria 2842482326 2842487422 296
97 iso_pu_bacteria 2847930680 2847935306 296
98 iso_pu_bacteria 2847939898 2847945903 296
99 iso_pu_bacteria 2874620515 2874627926 296
100 iso_pu_bacteria 2879083081 2879088950 296
101 iso_pu_bacteria 2881665667 2881670862 296
102 iso_pu_bacteria 2885409591 2885416958 296
103 iso_pu_bacteria 2904449895 2904453903 296
104 iso_pu_bacteria 2904456579 2904462387 296
105 iso_pu_bacteria 2904666416 2904672754 296
106 iso_pu_bacteria 2906626472 2906627049 296
107 iso_pu_bacteria 2906643746 2906650081 296
108 iso_pu_bacteria 2908775508 2908779238 296
109 iso_pu_bacteria 2922393267 2922395449 296
110 iso_pu_bacteria 2977864932 2977868190 296
111 iso_pu_bacteria 3005483717 3005490042 296
112 iso_pu_bacteria 8016583857 8016587027 296
113 iso_pu_bacteria 8016603502 8016603867 296
114 iso_pu_bacteria 8016613128 8016613913 296
115 iso_pu_bacteria 8016622563 8016625103 296
116 iso_pu_bacteria 8019547302 8019552138 296
117 iso_pu_bacteria 8019619141 8019624669 296
118 iso_pu_bacteria 8019629233 8019630835 296
119 iso_pu_bacteria 8019659431 8019667693 296
120 iso_pu_bacteria 8056689827 8056695994 296
121 3300005329 Ga0070683_100021732 Ga0070683_1000217325 297
122 3300005336 Ga0070680_100166575 Ga0070680_1001665752 297
123 3300005344 Ga0070661_100410803 Ga0070661_1004108031 297
124 3300005455 Ga0070663_100236290 Ga0070663_1002362902 297
125 3300005564 Ga0070664_100097429 Ga0070664_1000974292 297
126 3300005614 Ga0068856_100050075 Ga0068856_1000500753 297
127 3300005616 Ga0068852_100014091 Ga0068852_1000140914 297
128 3300011119 Ga0105246_10154985 Ga0105246_101549851 297
129 3300025945 Ga0207679_10201653 Ga0207679_102016532 297
130 3300026078 Ga0207702_10037716 Ga0207702_100377162 297
131 iso_pu_bacteria 2582581867 2585404027 297
132 iso_pu_bacteria 2904690495 2904694866 297
133 iso_pu_bacteria 2908756301 2908759992 297
134 iso_pu_bacteria 2935908558 2935910577 297
135 iso_pu_bacteria 2935926038 2935927512 297
136 iso_pu_bacteria 2935934488 2935936617 297
137 iso_pu_bacteria 2935942939 2935943831 297
138 iso_pu_bacteria 2935951376 2935952268 297
139 iso_pu_bacteria 2935967501 2935969108 297
140 iso_pu_bacteria 2937848649 2937848881 297
141 iso_pu_bacteria 2977922695 2977925522 297
142 iso_pu_bacteria 3004211236 3004217057 297
143 iso_pu_bacteria 3004218560 3004225350 297
144 iso_pu_bacteria 3005594810 3005600420 297
145 iso_pu_bacteria 8019687851 8019696936 297
146 3300025937 Ga0207669_10098355 Ga0207669_100983552 298
147 3300046455 Ga0495603_0023141 Ga0495603_0023141_1429_2325 298
148 3300046475 Ga0495639_0089047 Ga0495639_0089047_274_1170 298
149 3300046539 Ga0495621_0099460 Ga0495621_0099460_111_1007 298
150 3300046660 Ga0495625_0223192 Ga0495625_0223192_16_912 298
151 3300046674 Ga0495588_0050239 Ga0495588_0050239_204_1100 298
152 3300049571 Ga0501034_0317553 Ga0501034_0317553_566_1465 298
153 3300003322 rootL2_10037332 rootL2_100373323 299
154 3300003323 rootH1_10050544 rootH1_100505442 299
155 3300005336 Ga0070680_100272846 Ga0070680_1002728462 299
156 3300005339 Ga0070660_100035784 Ga0070660_1000357842 299
157 3300005341 Ga0070691_10061597 Ga0070691_100615971 299
158 3300005366 Ga0070659_100058902 Ga0070659_1000589022 299
159 3300005434 Ga0070709_10005233 Ga0070709_100052339 299
160 3300005435 Ga0070714_100199418 Ga0070714_1001994182 299
161 3300005439 Ga0070711_100009618 Ga0070711_1000096182 299
162 3300005445 Ga0070708_100222077 Ga0070708_1002220772 299
163 3300005458 Ga0070681_10094056 Ga0070681_100940562 299
164 3300005467 Ga0070706_100553831 Ga0070706_1005538311 299
165 3300005468 Ga0070707_100054322 Ga0070707_1000543224 299
166 3300005530 Ga0070679_100359065 Ga0070679_1003590652 299
167 3300005535 Ga0070684_100037298 Ga0070684_1000372984 299
168 3300005535 Ga0070684_100063099 Ga0070684_1000630992 299
169 3300005536 Ga0070697_100456825 Ga0070697_1004568252 299
170 3300005539 Ga0068853_100107365 Ga0068853_1001073652 299
171 3300005577 Ga0068857_100026661 Ga0068857_1000266612 299
172 3300005577 Ga0068857_100564312 Ga0068857_1005643121 299
173 3300005834 Ga0068851_10136641 Ga0068851_101366411 299
174 3300006844 Ga0075428_100049115 Ga0075428_1000491154 299
175 3300006847 Ga0075431_100210040 Ga0075431_1002100402 299
176 3300006914 Ga0075436_100217374 Ga0075436_1002173742 299
177 3300007265 Ga0099794_10010178 Ga0099794_100101784 299
178 3300007788 Ga0099795_10001073 Ga0099795_100010733 299
179 3300009093 Ga0105240_10031664 Ga0105240_100316646 299
180 3300009147 Ga0114129_10935769 Ga0114129_109357691 299
181 3300010159 Ga0099796_10001125 Ga0099796_100011254 299
182 3300013104 Ga0157370_10011815 Ga0157370_1001181513 299
183 3300013104 Ga0157370_10225597 Ga0157370_102255972 299
184 3300013105 Ga0157369_10020952 Ga0157369_100209527 299
185 3300013105 Ga0157369_10033836 Ga0157369_100338367 299
186 3300025321 Ga0207656_10031840 Ga0207656_100318402 299
187 3300025909 Ga0207705_10175106 Ga0207705_101751062 299
188 3300025912 Ga0207707_10004215 Ga0207707_100042155 299
189 3300025912 Ga0207707_10074204 Ga0207707_100742045 299
190 3300025913 Ga0207695_10108446 Ga0207695_101084464 299
191 3300025914 Ga0207671_10051739 Ga0207671_100517392 299
192 3300025915 Ga0207693_10020887 Ga0207693_100208873 299
193 3300025916 Ga0207663_10020497 Ga0207663_100204973 299
194 3300025917 Ga0207660_10233871 Ga0207660_102338711 299
195 3300025919 Ga0207657_10006008 Ga0207657_1000600812 299
196 3300025921 Ga0207652_10181986 Ga0207652_101819862 299
197 3300025922 Ga0207646_10219228 Ga0207646_102192281 299
198 3300025929 Ga0207664_10119204 Ga0207664_101192041 299
199 3300025932 Ga0207690_10119809 Ga0207690_101198092 299
200 3300025939 Ga0207665_10164376 Ga0207665_101643761 299
201 3300025944 Ga0207661_10018806 Ga0207661_100188063 299
202 3300026116 Ga0207674_10586680 Ga0207674_105866802 299
203 3300028794 Ga0307515_10055973 Ga0307515_100559733 299
204 3300050507 nmdc:mga05p37_669026_c1 nmdc:mga05p37_669026_c1_82_987 299
205 3300050508 nmdc:mga09592_44098_c1 nmdc:mga09592_44098_c1_2815_3714 299
206 3300050510 nmdc:mga06r32_5029_c1 nmdc:mga06r32_5029_c1_3569_4474 299
207 3300050514 nmdc:mga08x19_221675_c1 nmdc:mga08x19_221675_c1_44_943 299
208 3300053078 Ga0495612_0057484 Ga0495612_0057484_667_1566 299
209 3300005327 Ga0070658_10096082 Ga0070658_100960823 300
210 3300005331 Ga0070670_100184225 Ga0070670_1001842252 300
211 3300005339 Ga0070660_100025489 Ga0070660_1000254892 300
212 3300005355 Ga0070671_100097434 Ga0070671_1000974342 300
213 3300005366 Ga0070659_100470967 Ga0070659_1004709671 300
214 3300005456 Ga0070678_100104609 Ga0070678_1001046092 300
215 3300005518 Ga0070699_100427553 Ga0070699_1004275531 300
216 3300005530 Ga0070679_100107280 Ga0070679_1001072804 300
217 3300005563 Ga0068855_100149853 Ga0068855_1001498533 300
218 3300005578 Ga0068854_100172970 Ga0068854_1001729701 300
219 3300005617 Ga0068859_100069418 Ga0068859_1000694182 300
220 3300005618 Ga0068864_100009204 Ga0068864_1000092046 300
221 3300006237 Ga0097621_100254757 Ga0097621_1002547572 300
222 3300006844 Ga0075428_100001655 Ga0075428_1000016556 300
223 3300006844 Ga0075428_100132500 Ga0075428_1001325002 300
224 3300006847 Ga0075431_100000251 Ga0075431_10000025145 300
225 3300006847 Ga0075431_100131788 Ga0075431_1001317882 300
226 3300006880 Ga0075429_100001930 Ga0075429_1000019308 300
227 3300006931 Ga0097620_100069414 Ga0097620_1000694143 300
228 3300006942 Ga0099824_1005150 Ga0099824_10051507 300
229 3300007076 Ga0075435_100043122 Ga0075435_1000431222 300
230 3300009094 Ga0111539_10001595 Ga0111539_1000159513 300
231 3300009094 Ga0111539_10636150 Ga0111539_106361502 300
232 3300009098 Ga0105245_10042164 Ga0105245_100421644 300
233 3300009101 Ga0105247_10077438 Ga0105247_100774382 300
234 3300009147 Ga0114129_10000066 Ga0114129_100000664 300
235 3300009147 Ga0114129_10249794 Ga0114129_102497942 300
236 3300009147 Ga0114129_10256323 Ga0114129_102563231 300
237 3300009545 Ga0105237_10176087 Ga0105237_101760872 300
238 3300009551 Ga0105238_10153397 Ga0105238_101533972 300
239 3300010375 Ga0105239_10215995 Ga0105239_102159952 300
240 3300010375 Ga0105239_10485277 Ga0105239_104852772 300
241 3300013104 Ga0157370_10063238 Ga0157370_100632382 300
242 3300013105 Ga0157369_10518584 Ga0157369_105185841 300
243 3300013296 Ga0157374_10010646 Ga0157374_100106468 300
244 3300013297 Ga0157378_10299318 Ga0157378_102993182 300
245 3300013306 Ga0163162_10317964 Ga0163162_103179641 300
246 3300013307 Ga0157372_10067552 Ga0157372_100675526 300
247 3300013307 Ga0157372_10157194 Ga0157372_101571944 300
248 3300013308 Ga0157375_10077081 Ga0157375_100770813 300
249 3300013308 Ga0157375_10179371 Ga0157375_101793712 300
250 3300013308 Ga0157375_10273565 Ga0157375_102735652 300
251 3300014325 Ga0163163_10212578 Ga0163163_102125781 300
252 3300014325 Ga0163163_10266172 Ga0163163_102661722 300
253 3300014497 Ga0182008_10035739 Ga0182008_100357392 300
254 3300014969 Ga0157376_10132033 Ga0157376_101320331 300
255 3300015261 Ga0182006_1040741 Ga0182006_10407412 300
256 3300021320 Ga0214544_1000009 Ga0214544_100000912 300
257 3300021321 Ga0214542_1000002 Ga0214542_1000002453 300
258 3300021324 Ga0214545_1000002 Ga0214545_1000002267 300
259 3300021327 Ga0214543_1000013 Ga0214543_100001355 300
260 3300025254 Ga0209148_1014455 Ga0209148_10144552 300
261 3300025297 Ga0209758_1000808 Ga0209758_100080835 300
262 3300025919 Ga0207657_10018110 Ga0207657_100181107 300
263 3300025927 Ga0207687_10069766 Ga0207687_100697662 300
264 3300025931 Ga0207644_10269560 Ga0207644_102695602 300
265 3300025932 Ga0207690_10192996 Ga0207690_101929962 300
266 3300025936 Ga0207670_10391557 Ga0207670_103915571 300
267 3300025945 Ga0207679_10253860 Ga0207679_102538601 300
268 3300025972 Ga0207668_10300836 Ga0207668_103008362 300
269 3300026023 Ga0207677_10258662 Ga0207677_102586622 300
270 3300026041 Ga0207639_10228969 Ga0207639_102289691 300
271 3300026067 Ga0207678_10071668 Ga0207678_100716682 300
272 3300026067 Ga0207678_10351427 Ga0207678_103514272 300
273 3300026078 Ga0207702_10572895 Ga0207702_105728951 300
274 3300026095 Ga0207676_10027290 Ga0207676_100272903 300
275 3300026118 Ga0207675_100215384 Ga0207675_1002153842 300
276 3300026142 Ga0207698_10431546 Ga0207698_104315461 300
277 3300027296 Ga0209389_1000026 Ga0209389_1000026105 300
278 3300027296 Ga0209389_1000117 Ga0209389_100011735 300
279 3300027357 Ga0209589_1000022 Ga0209589_1000022105 300
280 3300027361 Ga0209489_100058 Ga0209489_100058106 300
281 3300027361 Ga0209489_102405 Ga0209489_10240514 300
282 3300027363 Ga0209700_100021 Ga0209700_10002135 300
283 3300027907 Ga0207428_10000891 Ga0207428_100008918 300
284 3300028380 Ga0268265_10135323 Ga0268265_101353232 300
285 3300035115 Ga0373941_0006720 Ga0373941_0006720_834_1742 300
286 3300035691 Ga0373931_0002116 Ga0373931_0002116_3167_4075 300
287 3300037312 Ga0395899_0003556 Ga0395899_0003556_8713_9618 300
288 3300037312 Ga0395899_0023932 Ga0395899_0023932_2906_3808 300
289 3300037418 Ga0395900_0005201 Ga0395900_0005201_363_1265 300
290 3300037418 Ga0395900_0194095 Ga0395900_0194095_550_1458 300
291 3300037466 Ga0395898_0011685 Ga0395898_0011685_41_946 300
292 3300037466 Ga0395898_0086408 Ga0395898_0086408_1156_2064 300
293 3300037466 Ga0395898_0238381 Ga0395898_0238381_155_1063 300
294 3300037471 Ga0395905_0009284 Ga0395905_0009284_8586_9491 300
295 3300037471 Ga0395905_0011866 Ga0395905_0011866_1906_2814 300
296 3300037471 Ga0395905_0149891 Ga0395905_0149891_238_1146 300
297 3300038443 Ga0395901_0010742 Ga0395901_0010742_5315_6217 300
298 3300038443 Ga0395901_0123098 Ga0395901_0123098_714_1622 300
299 3300038443 Ga0395901_0242049 Ga0395901_0242049_753_1658 300
300 3300041413 Ga0439465_0031326 Ga0439465_0031326_608_1528 300
301 3300042005 Ga0439448_0113312 Ga0439448_0113312_13_915 300
302 3300042438 Ga0439459_0021043 Ga0439459_0021043_56_958 300
303 3300046518 Ga0495631_0124198 Ga0495631_0124198_159_1091 300
304 3300047443 Ga0495687_004544 Ga0495687_004544_2920_3825 300
305 3300047472 Ga0495686_0165982 Ga0495686_0165982_314_1246 300
306 3300047673 Ga0495593_0172886 Ga0495593_0172886_121_1029 300
307 3300048907 Ga0496104_0012572 Ga0496104_0012572_167_1075 300
308 3300048907 Ga0496104_0220539 Ga0496104_0220539_61_990 300
309 3300048908 Ga0496105_0029305 Ga0496105_0029305_1336_2244 300
310 3300048911 Ga0496108_0158308 Ga0496108_0158308_48_956 300
311 3300048911 Ga0496108_0179332 Ga0496108_0179332_797_1729 300
312 3300048912 Ga0496109_0031055 Ga0496109_0031055_2198_3106 300
313 3300048913 Ga0496110_0048250 Ga0496110_0048250_1554_2462 300
314 3300048913 Ga0496110_0364811 Ga0496110_0364811_116_1024 300
315 3300048915 Ga0496112_0146682 Ga0496112_0146682_1386_2294 300
316 3300048915 Ga0496112_0414785 Ga0496112_0414785_94_1026 300
317 3300049571 Ga0501034_0002311 Ga0501034_0002311_9037_9945 300
318 3300049586 Ga0501070_0338030 Ga0501070_0338030_99_1007 300
319 3300050507 nmdc:mga05p37_127000_c1 nmdc:mga05p37_127000_c1_113_1021 300
320 3300050507 nmdc:mga05p37_218308_c1 nmdc:mga05p37_218308_c1_686_1591 300
321 3300050507 nmdc:mga05p37_681_c1 nmdc:mga05p37_681_c1_11376_12407 300
322 3300050508 nmdc:mga09592_2798_c1 nmdc:mga09592_2798_c1_4746_5777 300
323 3300050510 nmdc:mga06r32_123580_c1 nmdc:mga06r32_123580_c1_491_1399 300
324 3300050510 nmdc:mga06r32_394_c1 nmdc:mga06r32_394_c1_30440_31471 300
325 3300050511 nmdc:mga08y16_218897_c1 nmdc:mga08y16_218897_c1_551_1459 300
326 3300050511 nmdc:mga08y16_4098_c1 nmdc:mga08y16_4098_c1_5497_6528 300
327 3300050513 nmdc:mga0rr50_154642_c1 nmdc:mga0rr50_154642_c1_221_1201 300
328 3300053142 Ga0500577_0086257 Ga0500577_0086257_26_997 300
329 iso_pu_bacteria 2513237139 2513876499 300
330 iso_pu_bacteria 2802429603 2805919778 300
331 iso_pu_bacteria 2824687955 2824691871 300
332 iso_pu_bacteria 2824696289 2824699164 300
333 3300002741 JGI25157J39369_1001347 JGI25157J39369_10013477 301
334 3300005334 Ga0068869_100244238 Ga0068869_1002442382 301
335 3300005338 Ga0068868_100026122 Ga0068868_1000261223 301
336 3300005339 Ga0070660_100265580 Ga0070660_1002655802 301
337 3300005347 Ga0070668_100230875 Ga0070668_1002308751 301
338 3300005455 Ga0070663_100054048 Ga0070663_1000540482 301
339 3300005518 Ga0070699_100233916 Ga0070699_1002339162 301
340 3300005544 Ga0070686_100226102 Ga0070686_1002261021 301
341 3300005545 Ga0070695_100077264 Ga0070695_1000772642 301
342 3300005548 Ga0070665_100043439 Ga0070665_1000434393 301
343 3300005548 Ga0070665_100153383 Ga0070665_1001533834 301
344 3300005719 Ga0068861_100218134 Ga0068861_1002181342 301
345 3300005843 Ga0068860_100019679 Ga0068860_1000196797 301
346 3300005937 Ga0081455_10036809 Ga0081455_100368093 301
347 3300005983 Ga0081540_1003843 Ga0081540_10038437 301
348 3300005983 Ga0081540_1053709 Ga0081540_10537094 301
349 3300006051 Ga0075364_10015317 Ga0075364_100153172 301
350 3300006173 Ga0070716_100226603 Ga0070716_1002266033 301
351 3300006177 Ga0075362_10084896 Ga0075362_100848962 301
352 3300006178 Ga0075367_10214093 Ga0075367_102140932 301
353 3300006353 Ga0075370_10022057 Ga0075370_100220573 301
354 3300006846 Ga0075430_100243428 Ga0075430_1002434282 301
355 3300006846 Ga0075430_100318093 Ga0075430_1003180932 301
356 3300006847 Ga0075431_100069941 Ga0075431_1000699416 301
357 3300006847 Ga0075431_100321807 Ga0075431_1003218072 301
358 3300006871 Ga0075434_100248633 Ga0075434_1002486333 301
359 3300006880 Ga0075429_100113931 Ga0075429_1001139312 301
360 3300006880 Ga0075429_100262989 Ga0075429_1002629891 301
361 3300006880 Ga0075429_100300106 Ga0075429_1003001061 301
362 3300007076 Ga0075435_100376158 Ga0075435_1003761581 301
363 3300007265 Ga0099794_10004680 Ga0099794_100046802 301
364 3300007788 Ga0099795_10050007 Ga0099795_100500071 301
365 3300009011 Ga0105251_10101294 Ga0105251_101012941 301
366 3300009094 Ga0111539_10152203 Ga0111539_101522032 301
367 3300009094 Ga0111539_10563052 Ga0111539_105630522 301
368 3300009147 Ga0114129_10012594 Ga0114129_100125942 301
369 3300009147 Ga0114129_10240543 Ga0114129_102405432 301
370 3300009174 Ga0105241_10265300 Ga0105241_102653001 301
371 3300009174 Ga0105241_10327650 Ga0105241_103276502 301
372 3300009177 Ga0105248_10318594 Ga0105248_103185942 301
373 3300009177 Ga0105248_10328910 Ga0105248_103289102 301
374 3300009545 Ga0105237_10027556 Ga0105237_100275563 301
375 3300009545 Ga0105237_10144018 Ga0105237_101440183 301
376 3300009553 Ga0105249_10085145 Ga0105249_100851452 301
377 3300009553 Ga0105249_10118371 Ga0105249_101183712 301
378 3300010375 Ga0105239_10050236 Ga0105239_100502361 301
379 3300010375 Ga0105239_10079141 Ga0105239_100791414 301
380 3300013296 Ga0157374_10407016 Ga0157374_104070162 301
381 3300013306 Ga0163162_10668292 Ga0163162_106682922 301
382 3300013307 Ga0157372_10564517 Ga0157372_105645171 301
383 3300013308 Ga0157375_10487860 Ga0157375_104878601 301
384 3300025250 Ga0209026_1000118 Ga0209026_100011843 301
385 3300025256 Ga0209759_1000076 Ga0209759_100007686 301
386 3300025294 Ga0209025_1016466 Ga0209025_10164662 301
387 3300025295 Ga0209564_1036572 Ga0209564_10365722 301
388 3300025900 Ga0207710_10063492 Ga0207710_100634923 301
389 3300025909 Ga0207705_10035840 Ga0207705_100358403 301
390 3300025914 Ga0207671_10038989 Ga0207671_100389893 301
391 3300025915 Ga0207693_10026715 Ga0207693_100267154 301
392 3300025916 Ga0207663_10069465 Ga0207663_100694652 301
393 3300025923 Ga0207681_10136920 Ga0207681_101369202 301
394 3300025931 Ga0207644_10065924 Ga0207644_100659241 301
395 3300025932 Ga0207690_10036556 Ga0207690_100365561 301
396 3300025942 Ga0207689_10026622 Ga0207689_100266223 301
397 3300025961 Ga0207712_10360085 Ga0207712_103600851 301
398 3300026023 Ga0207677_10233886 Ga0207677_102338862 301
399 3300026035 Ga0207703_10194122 Ga0207703_101941223 301
400 3300026067 Ga0207678_10117152 Ga0207678_101171521 301
401 3300028379 Ga0268266_10017370 Ga0268266_100173703 301
402 3300028381 Ga0268264_10002781 Ga0268264_100027816 301
403 3300028381 Ga0268264_10046387 Ga0268264_100463872 301
404 3300030521 Ga0307511_10100627 Ga0307511_101006272 301
405 3300031507 Ga0307509_10060170 Ga0307509_100601703 301
406 3300031730 Ga0307516_10214287 Ga0307516_102142871 301
407 3300033179 Ga0307507_10007804 Ga0307507_1000780412 301
408 3300035086 Ga0373934_0008273 Ga0373934_0008273_685_1590 301
409 3300035111 Ga0373923_0099078 Ga0373923_0099078_167_1072 301
410 3300035118 Ga0373954_0006543 Ga0373954_0006543_2398_3303 301
411 3300035119 Ga0373956_0021579 Ga0373956_0021579_14_919 301
412 3300035172 Ga0373955_0005698 Ga0373955_0005698_2386_3291 301
413 3300035172 Ga0373955_0038979 Ga0373955_0038979_416_1321 301
414 3300035410 Ga0373924_0020308 Ga0373924_0020308_1328_2233 301
415 3300035691 Ga0373931_0304737 Ga0373931_0304737_38_949 301
416 3300035692 Ga0373935_0096496 Ga0373935_0096496_291_1196 301
417 3300035695 Ga0373927_0013957 Ga0373927_0013957_396_1301 301
418 3300035695 Ga0373927_0040008 Ga0373927_0040008_1284_2195 301
419 3300036401 Ga0373937_0027072 Ga0373937_0027072_2231_3136 301
420 3300037068 Ga0373925_0551638 Ga0373925_0551638_10_921 301
421 3300037466 Ga0395898_0051986 Ga0395898_0051986_2899_3804 301
422 3300038443 Ga0395901_0127349 Ga0395901_0127349_1059_1964 301
423 3300045051 Ga0451576_0722280 Ga0451576_0722280_63_974 301
424 3300046457 Ga0495590_0017386 Ga0495590_0017386_1650_2555 301
425 3300046462 Ga0495651_0037082 Ga0495651_0037082_685_1590 301
426 3300046472 Ga0495580_0179785 Ga0495580_0179785_239_1147 301
427 3300046473 Ga0495582_0167911 Ga0495582_0167911_160_1068 301
428 3300046474 Ga0495605_0139926 Ga0495605_0139926_123_1028 301
429 3300046501 Ga0495607_0014492 Ga0495607_0014492_1038_1943 301
430 3300046506 Ga0495583_0002010 Ga0495583_0002010_15946_16851 301
431 3300046511 Ga0495608_0019214 Ga0495608_0019214_74_979 301
432 3300046513 Ga0495616_0013909 Ga0495616_0013909_684_1589 301
433 3300046514 Ga0495618_0030855 Ga0495618_0030855_1676_2581 301
434 3300046516 Ga0495628_0026667 Ga0495628_0026667_1565_2470 301
435 3300046519 Ga0495632_0111640 Ga0495632_0111640_107_1012 301
436 3300046522 Ga0495643_0004541 Ga0495643_0004541_7328_8233 301
437 3300046529 Ga0495652_0031212 Ga0495652_0031212_2237_3142 301
438 3300046536 Ga0495587_0013225 Ga0495587_0013225_1781_2686 301
439 3300046542 Ga0495597_0128082 Ga0495597_0128082_84_989 301
440 3300046543 Ga0495645_0022516 Ga0495645_0022516_2550_3455 301
441 3300046557 Ga0495622_0021827 Ga0495622_0021827_472_1377 301
442 3300046559 Ga0495667_0048753 Ga0495667_0048753_57_962 301
443 3300046642 Ga0495634_0021060 Ga0495634_0021060_2258_3163 301
444 3300046660 Ga0495625_0023844 Ga0495625_0023844_3246_4151 301
445 3300046663 Ga0495635_0005172 Ga0495635_0005172_6372_7277 301
446 3300046663 Ga0495635_0127405 Ga0495635_0127405_372_1277 301
447 3300046675 Ga0495657_0024471 Ga0495657_0024471_1583_2488 301
448 3300046678 Ga0495599_0118214 Ga0495599_0118214_375_1280 301
449 3300046679 Ga0495623_0029603 Ga0495623_0029603_1975_2880 301
450 3300046680 Ga0495646_0063020 Ga0495646_0063020_200_1105 301
451 3300046689 Ga0495613_0134073 Ga0495613_0134073_628_1533 301
452 3300046694 Ga0495649_0012029 Ga0495649_0012029_3850_4755 301
453 3300046810 Ga0495660_0010344 Ga0495660_0010344_3078_3983 301
454 3300047315 Ga0495581_0211532 Ga0495581_0211532_10_918 301
455 3300047317 Ga0495604_0018008 Ga0495604_0018008_2165_3070 301
456 3300047319 Ga0495674_0046149 Ga0495674_0046149_1419_2324 301
457 3300047319 Ga0495674_0150896 Ga0495674_0150896_628_1539 301
458 3300047322 Ga0495680_0069128 Ga0495680_0069128_1556_2461 301
459 3300047443 Ga0495687_004840 Ga0495687_004840_5177_6082 301
460 3300047444 Ga0495675_0013704 Ga0495675_0013704_1938_2843 301
461 3300047471 Ga0495684_0011844 Ga0495684_0011844_2747_3652 301
462 3300048088 Ga0495602_0032921 Ga0495602_0032921_2190_3095 301
463 3300048091 Ga0495626_0054848 Ga0495626_0054848_161_1066 301
464 3300048903 Ga0496100_0244424 Ga0496100_0244424_30_941 301
465 3300048904 Ga0496101_0106734 Ga0496101_0106734_855_1766 301
466 3300048905 Ga0496102_0052890 Ga0496102_0052890_1947_2858 301
467 3300048909 Ga0496106_0000001 Ga0496106_0000001_297638_298594 301
468 3300048909 Ga0496106_0016508 Ga0496106_0016508_1224_2129 301
469 3300048909 Ga0496106_0065306 Ga0496106_0065306_522_1433 301
470 3300048910 Ga0496107_0045463 Ga0496107_0045463_1030_1941 301
471 3300048911 Ga0496108_0008606 Ga0496108_0008606_1661_2572 301
472 3300048912 Ga0496109_0097880 Ga0496109_0097880_935_1846 301
473 3300048913 Ga0496110_0112156 Ga0496110_0112156_1302_2213 301
474 3300048919 Ga0496116_0118272 Ga0496116_0118272_352_1257 301
475 3300048920 Ga0496117_0060580 Ga0496117_0060580_1668_2573 301
476 3300048921 Ga0496118_0003099 Ga0496118_0003099_10492_11397 301
477 3300048921 Ga0496118_0069279 Ga0496118_0069279_1144_2115 301
478 3300048922 Ga0496119_0091638 Ga0496119_0091638_465_1370 301
479 3300048924 Ga0496121_0001201 Ga0496121_0001201_28462_29367 301
480 3300048924 Ga0496121_0015069 Ga0496121_0015069_6767_7723 301
481 3300048924 Ga0496121_0203178 Ga0496121_0203178_166_1086 301
482 3300048927 Ga0496124_0090829 Ga0496124_0090829_1316_2221 301
483 3300048927 Ga0496124_0154704 Ga0496124_0154704_532_1488 301
484 3300048927 Ga0496124_0395784 Ga0496124_0395784_27_950 301
485 3300048928 Ga0496125_0133030 Ga0496125_0133030_379_1314 301
486 3300048929 Ga0496126_0000900 Ga0496126_0000900_7899_8870 301
487 3300048929 Ga0496126_0006861 Ga0496126_0006861_814_1719 301
488 3300049459 Ga0495678_039661 Ga0495678_039661_118_1023 301
489 3300049571 Ga0501034_0001130 Ga0501034_0001130_22510_23421 301
490 3300049823 Ga0501044_0081309 Ga0501044_0081309_1293_2204 301
491 3300050489 nmdc:mga03683_34063_c1 nmdc:mga03683_34063_c1_893_1804 301
492 3300050491 nmdc:mga00v17_39422_c1 nmdc:mga00v17_39422_c1_560_1471 301
493 3300050492 nmdc:mga0yw44_8823_c1 nmdc:mga0yw44_8823_c1_2457_3368 301
494 3300050494 nmdc:mga06z11_210258_c1 nmdc:mga06z11_210258_c1_52_987 301
495 3300050496 nmdc:mga07m45_15399_c1 nmdc:mga07m45_15399_c1_1950_2870 301
496 3300050507 nmdc:mga05p37_277578_c1 nmdc:mga05p37_277578_c1_160_1071 301
497 3300050509 nmdc:mga0qj67_263893_c1 nmdc:mga0qj67_263893_c1_113_1042 301
498 3300050510 nmdc:mga06r32_330395_c1 nmdc:mga06r32_330395_c1_487_1416 301
499 3300050510 nmdc:mga06r32_392979_c1 nmdc:mga06r32_392979_c1_186_1115 301
500 3300050511 nmdc:mga08y16_218797_c1 nmdc:mga08y16_218797_c1_661_1572 301
501 3300053077 Ga0495601_0022661 Ga0495601_0022661_557_1462 301
502 3300053080 Ga0500635_0004817 Ga0500635_0004817_1953_2858 301
503 3300053084 Ga0495595_0004098 Ga0495595_0004098_3014_3919 301
504 3300053091 Ga0500647_0029719 Ga0500647_0029719_536_1441 301
505 3300053093 Ga0500651_0195716 Ga0500651_0195716_140_1045 301
506 3300053096 Ga0500641_0003413 Ga0500641_0003413_4312_5217 301
507 3300053119 Ga0500595_030913 Ga0500595_030913_255_1160 301
508 3300053142 Ga0500577_0000415 Ga0500577_0000415_4560_5465 301
509 3300053147 Ga0500589_004864 Ga0500589_004864_1376_2281 301
510 3300053151 Ga0500604_0010349 Ga0500604_0010349_287_1192 301
511 3300053161 Ga0500634_0082883 Ga0500634_0082883_281_1186 301
512 3300053177 Ga0500636_0054710 Ga0500636_0054710_546_1451 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

3

62

0.97

PF03466

LysR_substrate

LysR substrate binding domain

84

298

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9302 6 88
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9283 6 88
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9276 3 87
7trv-assembly1.cif.gz_A crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9218 6 89
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9189 6 88
ID Description Score Start End Superfamily
af_Q57083_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.978 6 85 1.10.10.10
af_P0A9F6_3_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9728 3 87 1.10.10.10
af_P75836_3_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9534 7 88 1.10.10.10
af_P67662_3_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9527 6 86 1.10.10.10
af_P0A9G2_1_86_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9511 1 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0K2RCL1-F1-model_v4 HTH-type transcriptional regulator GltR 0.9029 5 82 GO:0003700
AF-A0A258CPL3-F1-model_v4 LysR family transcriptional regulator 0.8993 3 86 GO:0003700
GO:0006351
GO:0043565
AF-A0A258CPL3-F1-model_v4 LysR family transcriptional regulator 0.8798 3 86 GO:0003700
GO:0006351
GO:0043565
AF-A0A1Q5IPR2-F1-model_v4 Transcriptional regulator 0.879 6 87 GO:0000976
GO:0003700
AF-A0A840A4H8-F1-model_v4 DNA-binding transcriptional LysR family regulator 0.8745 3 93 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
89.48 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map