F457463
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 512 | 247 | 495 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0006325|Ga0466967_0006325_864_1373 |
| Length | 169 |
| Sequence | MLSGGAQGAILSKPEDYLALAVQLALDNVLIRKGRPFGALLVKDGQIVASAVNNVLASHDPTAHAELEAIRLAARAQQNPRLDGHVMYASGHPCPMCLAAMYLVGIPQVYYAYSNEDGEPVGLSTSSLYAELTKPLSMQAMQLEHRPVRPAGMDLYEAWKRLNDDPPKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 2 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 3 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 4 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 5 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 6 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 7 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 8 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 9 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 10 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 11 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 12 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 13 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 14 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 17 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 18 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 19 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 81 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 91 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 135 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 137 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 138 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 143 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 144 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 145 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 146 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 147 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 148 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 149 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 150 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 151 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 152 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 153 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 154 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 155 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 156 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 157 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 158 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 159 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 160 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 161 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 162 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 163 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 164 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 199 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 200 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 201 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 202 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 203 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 204 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 205 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 206 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 207 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 208 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 209 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 210 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 211 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 212 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 213 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 214 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 215 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 216 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 245 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 246 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 247 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.48 |
| Metatranscriptomes | 0.2 |
| Isolates | 3.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.85 |
| Nodule | 0.98 |
| Rhizoplane | 2.34 |
| Rhizosphere | 65.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000165 | 3300001979 | Bacteria | 26307 |
| 2 | JGI25162J39368_1000111 | 3300002737 | Bacteria | 89317 |
| 3 | JGI25154J39366_1000536 | 3300002738 | Bacteria | 18958 |
| 4 | JGI25159J45721_1006237 | 3300002987 | Bacteria | 3603 |
| 5 | JGI25151J46595_10000846 | 3300003187 | Bacteria | 24391 |
| 6 | JGI25151J46595_10001459 | 3300003187 | Bacteria | 16043 |
| 7 | JGI25151J46595_10015852 | 3300003187 | Bacteria | 3309 |
| 8 | JGI25151J46595_10021024 | 3300003187 | Bacteria | 2738 |
| 9 | JGI25165J46597_1001440 | 3300003214 | Bacteria | 12658 |
| 10 | JGI25165J46597_1035630 | 3300003214 | Bacteria | 640 |
| 11 | JGI25153J46596_10056366 | 3300003215 | Bacteria | 1094 |
| 12 | rootL2_10174794 | 3300003322 | Bacteria | 3022 |
| 13 | rootH1_10242536 | 3300003323 | Bacteria | 3288 |
| 14 | Ga0055538_1002615 | 3300003751 | Bacteria | 2565 |
| 15 | Ga0055539_1000201 | 3300003752 | Bacteria | 47514 |
| 16 | Ga0055533_1000937 | 3300003756 | Bacteria | 8647 |
| 17 | Ga0055532_1000073 | 3300003758 | Bacteria | 131021 |
| 18 | Ga0055525_1000366 | 3300003759 | Bacteria | 30305 |
| 19 | Ga0055525_1005504 | 3300003759 | Bacteria | 1075 |
| 20 | Ga0055535_1000055 | 3300003761 | Bacteria | 131021 |
| 21 | Ga0055542_1000721 | 3300003762 | Bacteria | 25885 |
| 22 | Ga0055529_1000149 | 3300003763 | Bacteria | 100620 |
| 23 | Ga0055526_1003295 | 3300003771 | Bacteria | 10350 |
| 24 | Ga0055526_1004820 | 3300003771 | Bacteria | 7973 |
| 25 | Ga0055526_1022147 | 3300003771 | Bacteria | 2176 |
| 26 | Ga0055526_1024545 | 3300003771 | Bacteria | 1967 |
| 27 | Ga0055526_1027604 | 3300003771 | Bacteria | 1748 |
| 28 | Ga0055537_1000057 | 3300003773 | Bacteria | 81507 |
| 29 | Ga0055524_1000066 | 3300003775 | Bacteria | 131691 |
| 30 | Ga0055524_1015029 | 3300003775 | Bacteria | 2840 |
| 31 | Ga0055524_1018659 | 3300003775 | Bacteria | 2400 |
| 32 | Ga0055524_1022085 | 3300003775 | Bacteria | 2089 |
| 33 | Ga0055536_1000339 | 3300003781 | Bacteria | 34551 |
| 34 | Ga0055536_1007488 | 3300003781 | Bacteria | 4871 |
| 35 | Ga0055536_1010363 | 3300003781 | Bacteria | 3712 |
| 36 | Ga0055536_1084748 | 3300003781 | Bacteria | 594 |
| 37 | Ga0055534_1000175 | 3300003784 | Bacteria | 47703 |
| 38 | Ga0055534_1000247 | 3300003784 | Bacteria | 38231 |
| 39 | Ga0055534_1002727 | 3300003784 | Bacteria | 5942 |
| 40 | Ga0055528_1000023 | 3300003790 | Bacteria | 131856 |
| 41 | Ga0055530_10004258 | 3300003791 | Bacteria | 7490 |
| 42 | Ga0055531_10009885 | 3300003794 | Bacteria | 4824 |
| 43 | Ga0055531_10023298 | 3300003794 | Bacteria | 2328 |
| 44 | Ga0055531_10023925 | 3300003794 | Bacteria | 2272 |
| 45 | Ga0055531_10041843 | 3300003794 | Bacteria | 1320 |
| 46 | Ga0055541_1000336 | 3300003841 | Bacteria | 14777 |
| 47 | Ga0055541_1008961 | 3300003841 | Bacteria | 1570 |
| 48 | Ga0055543_1072670 | 3300004625 | Bacteria | 538 |
| 49 | Ga0065165_1000119 | 3300005262 | Bacteria | 134464 |
| 50 | Ga0065165_1000545 | 3300005262 | Bacteria | 56973 |
| 51 | Ga0065165_1097193 | 3300005262 | Bacteria | 742 |
| 52 | Ga0070680_100268598 | 3300005336 | Bacteria | 1444 |
| 53 | Ga0070680_100349743 | 3300005336 | Bacteria | 1257 |
| 54 | Ga0070682_100014762 | 3300005337 | Bacteria | 4518 |
| 55 | Ga0070661_100000061 | 3300005344 | Bacteria | 86581 |
| 56 | Ga0070659_100002481 | 3300005366 | Bacteria | 13107 |
| 57 | Ga0070659_100170551 | 3300005366 | Bacteria | 1782 |
| 58 | Ga0070714_100553614 | 3300005435 | Bacteria | 1101 |
| 59 | Ga0070663_100000009 | 3300005455 | Bacteria | 187718 |
| 60 | Ga0070663_100013889 | 3300005455 | Bacteria | 5152 |
| 61 | Ga0070663_100068421 | 3300005455 | Bacteria | 2578 |
| 62 | Ga0070663_100144834 | 3300005455 | Bacteria | 1817 |
| 63 | Ga0070663_100279202 | 3300005455 | Bacteria | 1331 |
| 64 | Ga0070681_10067174 | 3300005458 | Bacteria | 3554 |
| 65 | Ga0070681_10321866 | 3300005458 | Bacteria | 1456 |
| 66 | Ga0070679_100035873 | 3300005530 | Bacteria | 4920 |
| 67 | Ga0070684_100017185 | 3300005535 | Bacteria | 5930 |
| 68 | Ga0068853_100013529 | 3300005539 | Bacteria | 6666 |
| 69 | Ga0068855_100752393 | 3300005563 | Bacteria | 1039 |
| 70 | Ga0070664_100000010 | 3300005564 | Bacteria | 165664 |
| 71 | Ga0068857_101052441 | 3300005577 | Bacteria | 784 |
| 72 | Ga0068854_100028644 | 3300005578 | Bacteria | 3851 |
| 73 | Ga0068856_100000045 | 3300005614 | Bacteria | 110625 |
| 74 | Ga0068852_100231301 | 3300005616 | Bacteria | 1762 |
| 75 | Ga0075428_100003085 | 3300006844 | Bacteria | 18177 |
| 76 | Ga0075430_100281184 | 3300006846 | Bacteria | 1377 |
| 77 | Ga0075431_100026710 | 3300006847 | Bacteria | 5921 |
| 78 | Ga0075429_100008248 | 3300006880 | Bacteria | 9058 |
| 79 | Ga0105251_10032244 | 3300009011 | Bacteria | 2613 |
| 80 | Ga0105251_10159556 | 3300009011 | Bacteria | 1017 |
| 81 | Ga0105240_10000739 | 3300009093 | Bacteria | 59740 |
| 82 | Ga0105240_10120343 | 3300009093 | Bacteria | 3162 |
| 83 | Ga0105240_10139498 | 3300009093 | Bacteria | 2899 |
| 84 | Ga0105240_10336432 | 3300009093 | Bacteria | 1716 |
| 85 | Ga0114129_10018969 | 3300009147 | Bacteria | 9798 |
| 86 | Ga0105241_10221252 | 3300009174 | Bacteria | 1591 |
| 87 | Ga0105237_10002121 | 3300009545 | Bacteria | 25037 |
| 88 | Ga0105238_10004352 | 3300009551 | Bacteria | 14054 |
| 89 | Ga0105238_10061034 | 3300009551 | Bacteria | 3774 |
| 90 | Ga0105239_10000454 | 3300010375 | Bacteria | 59740 |
| 91 | Ga0157327_1006626 | 3300012512 | Bacteria | 981 |
| 92 | Ga0157373_10004941 | 3300013100 | Bacteria | 10027 |
| 93 | Ga0157373_10018501 | 3300013100 | Bacteria | 5072 |
| 94 | Ga0157371_10000088 | 3300013102 | Bacteria | 145526 |
| 95 | Ga0157371_10017730 | 3300013102 | Bacteria | 5283 |
| 96 | Ga0157371_10705839 | 3300013102 | Bacteria | 755 |
| 97 | Ga0157370_10000041 | 3300013104 | Bacteria | 133912 |
| 98 | Ga0157370_10008961 | 3300013104 | Bacteria | 10742 |
| 99 | Ga0157370_10495702 | 3300013104 | Bacteria | 1122 |
| 100 | Ga0157370_10660278 | 3300013104 | Bacteria | 955 |
| 101 | Ga0157369_10265362 | 3300013105 | Bacteria | 1790 |
| 102 | Ga0157369_10435994 | 3300013105 | Bacteria | 1357 |
| 103 | Ga0171462_1015 | 3300013250 | Bacteria | 169578 |
| 104 | Ga0157372_10000097 | 3300013307 | Bacteria | 90742 |
| 105 | Ga0157372_10171824 | 3300013307 | Bacteria | 2508 |
| 106 | Ga0182008_10022898 | 3300014497 | Bacteria | 3197 |
| 107 | Ga0182006_1003196 | 3300015261 | Bacteria | 8528 |
| 108 | Ga0182006_1016828 | 3300015261 | Bacteria | 3116 |
| 109 | Ga0182007_10002998 | 3300015262 | Bacteria | 8175 |
| 110 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 111 | Ga0197907_10007993 | 3300020069 | Bacteria | 783 |
| 112 | Ga0209760_100795 | 3300025207 | Bacteria | 4333 |
| 113 | Ga0209784_100008 | 3300025224 | Bacteria | 740293 |
| 114 | Ga0209784_100262 | 3300025224 | Bacteria | 31953 |
| 115 | Ga0209566_100006 | 3300025225 | Bacteria | 789272 |
| 116 | Ga0209566_100407 | 3300025225 | Bacteria | 34223 |
| 117 | Ga0209566_100636 | 3300025225 | Bacteria | 21451 |
| 118 | Ga0209674_100045 | 3300025226 | Bacteria | 362387 |
| 119 | Ga0209674_100114 | 3300025226 | Bacteria | 139197 |
| 120 | Ga0209147_100005 | 3300025229 | Bacteria | 1036530 |
| 121 | Ga0209563_100016 | 3300025230 | Bacteria | 802091 |
| 122 | Ga0209563_111699 | 3300025230 | Bacteria | 1230 |
| 123 | Ga0209437_100064 | 3300025233 | Bacteria | 334360 |
| 124 | Ga0209258_100007 | 3300025242 | Bacteria | 1036530 |
| 125 | Ga0209646_1000027 | 3300025246 | Bacteria | 395141 |
| 126 | Ga0209026_1003785 | 3300025250 | Bacteria | 4791 |
| 127 | Ga0209677_100008 | 3300025253 | Bacteria | 802091 |
| 128 | Ga0209677_105391 | 3300025253 | Bacteria | 3349 |
| 129 | Ga0209148_1000019 | 3300025254 | Bacteria | 748518 |
| 130 | Ga0209759_1004768 | 3300025256 | Bacteria | 4956 |
| 131 | Ga0209759_1045859 | 3300025256 | Bacteria | 711 |
| 132 | Ga0209233_1000081 | 3300025261 | Bacteria | 336832 |
| 133 | Ga0209233_1004045 | 3300025261 | Bacteria | 5074 |
| 134 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 135 | Ga0209565_1000094 | 3300025263 | Bacteria | 134853 |
| 136 | Ga0209455_1000011 | 3300025272 | Bacteria | 947242 |
| 137 | Ga0209673_1000027 | 3300025273 | Bacteria | 360561 |
| 138 | Ga0209673_1007856 | 3300025273 | Bacteria | 4831 |
| 139 | Ga0209673_1007992 | 3300025273 | Bacteria | 4770 |
| 140 | Ga0209130_1000244 | 3300025284 | Bacteria | 68915 |
| 141 | Ga0209130_1000702 | 3300025284 | Bacteria | 29997 |
| 142 | Ga0209130_1015852 | 3300025284 | Bacteria | 1843 |
| 143 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 144 | Ga0209675_1000079 | 3300025291 | Bacteria | 155554 |
| 145 | Ga0209675_1002258 | 3300025291 | Bacteria | 10059 |
| 146 | Ga0209675_1010617 | 3300025291 | Bacteria | 3127 |
| 147 | Ga0209675_1021220 | 3300025291 | Bacteria | 1736 |
| 148 | Ga0209676_1000176 | 3300025292 | Bacteria | 152347 |
| 149 | Ga0209676_1001097 | 3300025292 | Bacteria | 30146 |
| 150 | Ga0209676_1005557 | 3300025292 | Bacteria | 6527 |
| 151 | Ga0209676_1006363 | 3300025292 | Bacteria | 5852 |
| 152 | Ga0209676_1030419 | 3300025292 | Bacteria | 1651 |
| 153 | Ga0209676_1039738 | 3300025292 | Bacteria | 1333 |
| 154 | Ga0209676_1040147 | 3300025292 | Bacteria | 1321 |
| 155 | Ga0209025_1000046 | 3300025294 | Bacteria | 348962 |
| 156 | Ga0209025_1000224 | 3300025294 | Bacteria | 133328 |
| 157 | Ga0209025_1002162 | 3300025294 | Bacteria | 21902 |
| 158 | Ga0209025_1007268 | 3300025294 | Bacteria | 8321 |
| 159 | Ga0209025_1015187 | 3300025294 | Bacteria | 4667 |
| 160 | Ga0209025_1077870 | 3300025294 | Unclassified | 1141 |
| 161 | Ga0209564_1000050 | 3300025295 | Bacteria | 360560 |
| 162 | Ga0209564_1000166 | 3300025295 | Bacteria | 160208 |
| 163 | Ga0209564_1000308 | 3300025295 | Bacteria | 96489 |
| 164 | Ga0209564_1000509 | 3300025295 | Bacteria | 63951 |
| 165 | Ga0209564_1005648 | 3300025295 | Bacteria | 7026 |
| 166 | Ga0209564_1047058 | 3300025295 | Bacteria | 1091 |
| 167 | Ga0209758_1002177 | 3300025297 | Bacteria | 20570 |
| 168 | Ga0209050_1001060 | 3300025298 | Bacteria | 33818 |
| 169 | Ga0209050_1006506 | 3300025298 | Bacteria | 6888 |
| 170 | Ga0209050_1046019 | 3300025298 | Bacteria | 1150 |
| 171 | Ga0209256_1000031 | 3300025299 | Bacteria | 410189 |
| 172 | Ga0209256_1000960 | 3300025299 | Bacteria | 34857 |
| 173 | Ga0209256_1001956 | 3300025299 | Bacteria | 18677 |
| 174 | Ga0209256_1008858 | 3300025299 | Bacteria | 4549 |
| 175 | Ga0209256_1008871 | 3300025299 | Bacteria | 4545 |
| 176 | Ga0207426_1000151 | 3300025302 | Bacteria | 185103 |
| 177 | Ga0207426_1000215 | 3300025302 | Bacteria | 136757 |
| 178 | Ga0207426_1035838 | 3300025302 | Bacteria | 1581 |
| 179 | Ga0207426_1079226 | 3300025302 | Bacteria | 895 |
| 180 | Ga0209051_1070857 | 3300025303 | Bacteria | 1050 |
| 181 | Ga0209257_1000255 | 3300025304 | Bacteria | 123098 |
| 182 | Ga0209257_1000283 | 3300025304 | Bacteria | 113507 |
| 183 | Ga0209257_1006338 | 3300025304 | Bacteria | 7690 |
| 184 | Ga0209257_1007543 | 3300025304 | Bacteria | 6532 |
| 185 | Ga0209257_1035848 | 3300025304 | Bacteria | 1530 |
| 186 | Ga0207696_1007558 | 3300025711 | Bacteria | 4240 |
| 187 | Ga0207655_1014101 | 3300025728 | Bacteria | 4539 |
| 188 | Ga0207713_1020832 | 3300025735 | Bacteria | 3162 |
| 189 | Ga0207705_10977475 | 3300025909 | Bacteria | 654 |
| 190 | Ga0207654_11179577 | 3300025911 | Bacteria | 558 |
| 191 | Ga0207707_10094144 | 3300025912 | Bacteria | 2617 |
| 192 | Ga0207695_10000788 | 3300025913 | Bacteria | 59670 |
| 193 | Ga0207695_10006520 | 3300025913 | Bacteria | 15107 |
| 194 | Ga0207695_10296570 | 3300025913 | Bacteria | 1508 |
| 195 | Ga0207695_10565390 | 3300025913 | Bacteria | 1018 |
| 196 | Ga0207671_10000411 | 3300025914 | Bacteria | 59718 |
| 197 | Ga0207671_10137651 | 3300025914 | Bacteria | 1879 |
| 198 | Ga0207649_10000605 | 3300025920 | Bacteria | 24240 |
| 199 | Ga0207652_10049707 | 3300025921 | Bacteria | 3591 |
| 200 | Ga0207652_10974597 | 3300025921 | Bacteria | 746 |
| 201 | Ga0207694_10118163 | 3300025924 | Bacteria | 2115 |
| 202 | Ga0207664_10154990 | 3300025929 | Bacteria | 1949 |
| 203 | Ga0207690_10063206 | 3300025932 | Bacteria | 2523 |
| 204 | Ga0207690_10137932 | 3300025932 | Bacteria | 1793 |
| 205 | Ga0207661_10000109 | 3300025944 | Bacteria | 52179 |
| 206 | Ga0207679_10000002 | 3300025945 | Bacteria | 634491 |
| 207 | Ga0207640_10009624 | 3300025981 | Bacteria | 5419 |
| 208 | Ga0207639_10002690 | 3300026041 | Bacteria | 11929 |
| 209 | Ga0207678_10000018 | 3300026067 | Bacteria | 135549 |
| 210 | Ga0207678_10045408 | 3300026067 | Bacteria | 3799 |
| 211 | Ga0207678_10078794 | 3300026067 | Bacteria | 2822 |
| 212 | Ga0207702_10000053 | 3300026078 | Bacteria | 137538 |
| 213 | Ga0207674_10001653 | 3300026116 | Bacteria | 28692 |
| 214 | Ga0207698_11607399 | 3300026142 | Bacteria | 665 |
| 215 | Ga0209371_1000006 | 3300027312 | Bacteria | 1055642 |
| 216 | Ga0209282_1000019 | 3300027666 | Bacteria | 184034 |
| 217 | Ga0268265_10176603 | 3300028380 | Bacteria | 1831 |
| 218 | Ga0307515_10000029 | 3300028794 | Bacteria | 365410 |
| 219 | Ga0307515_10009918 | 3300028794 | Bacteria | 18339 |
| 220 | Ga0268256_1000007 | 3300030500 | Bacteria | 1055326 |
| 221 | Ga0307513_10010270 | 3300031456 | Bacteria | 11754 |
| 222 | Ga0307406_10297576 | 3300031901 | Bacteria | 1238 |
| 223 | Ga0307406_10619919 | 3300031901 | Bacteria | 894 |
| 224 | Ga0395899_0002516 | 3300037312 | Bacteria | 14851 |
| 225 | Ga0395899_0008931 | 3300037312 | Bacteria | 7714 |
| 226 | Ga0395899_0139154 | 3300037312 | Bacteria | 1728 |
| 227 | Ga0395899_0176000 | 3300037312 | Bacteria | 1504 |
| 228 | Ga0395899_0212784 | 3300037312 | Bacteria | 1342 |
| 229 | Ga0395899_0326895 | 3300037312 | Bacteria | 1031 |
| 230 | Ga0395899_0334003 | 3300037312 | Bacteria | 1018 |
| 231 | Ga0395900_0000006 | 3300037418 | Bacteria | 495364 |
| 232 | Ga0395900_0005617 | 3300037418 | Bacteria | 13113 |
| 233 | Ga0395900_0054526 | 3300037418 | Bacteria | 4116 |
| 234 | Ga0395900_0118521 | 3300037418 | Bacteria | 2716 |
| 235 | Ga0395900_0171384 | 3300037418 | Bacteria | 2209 |
| 236 | Ga0395900_0542173 | 3300037418 | Bacteria | 1109 |
| 237 | Ga0395898_0012851 | 3300037466 | Bacteria | 8637 |
| 238 | Ga0395898_0098108 | 3300037466 | Bacteria | 2813 |
| 239 | Ga0395898_0114289 | 3300037466 | Bacteria | 2586 |
| 240 | Ga0395898_0141682 | 3300037466 | Bacteria | 2302 |
| 241 | Ga0395898_0206248 | 3300037466 | Bacteria | 1875 |
| 242 | Ga0395898_0432874 | 3300037466 | Bacteria | 1253 |
| 243 | Ga0395898_0763789 | 3300037466 | Bacteria | 908 |
| 244 | Ga0395905_0034107 | 3300037471 | Bacteria | 4778 |
| 245 | Ga0395905_0147200 | 3300037471 | Bacteria | 2216 |
| 246 | Ga0395901_0000001 | 3300038443 | Bacteria | 800383 |
| 247 | Ga0395901_0035004 | 3300038443 | Bacteria | 5189 |
| 248 | Ga0395901_0037019 | 3300038443 | Bacteria | 5046 |
| 249 | Ga0395901_0290340 | 3300038443 | Bacteria | 1697 |
| 250 | Ga0395901_0397832 | 3300038443 | Bacteria | 1415 |
| 251 | Ga0395901_0843535 | 3300038443 | Bacteria | 902 |
| 252 | Ga0395901_1811127 | 3300038443 | Bacteria | 559 |
| 253 | Ga0439439_0121575 | 3300041406 | Bacteria | 728 |
| 254 | Ga0439465_0005898 | 3300041413 | Bacteria | 3895 |
| 255 | Ga0439432_017466 | 3300042006 | Bacteria | 2407 |
| 256 | Ga0439449_0013888 | 3300042007 | Bacteria | 3028 |
| 257 | Ga0439452_017109 | 3300042010 | Bacteria | 1957 |
| 258 | Ga0450904_000366 | 3300042139 | Bacteria | 9499 |
| 259 | Ga0466969_0008077 | 3300044656 | Bacteria | 5589 |
| 260 | Ga0466972_0001290 | 3300044658 | Bacteria | 12101 |
| 261 | Ga0466978_0006655 | 3300044671 | Bacteria | 5915 |
| 262 | Ga0466982_0094720 | 3300044672 | Bacteria | 1850 |
| 263 | Ga0466965_0002975 | 3300044683 | Bacteria | 7344 |
| 264 | Ga0466961_0000200 | 3300044693 | Bacteria | 40374 |
| 265 | Ga0466963_0021800 | 3300044694 | Bacteria | 4047 |
| 266 | Ga0466964_0178833 | 3300044706 | Bacteria | 1004 |
| 267 | Ga0466971_0038113 | 3300044719 | Bacteria | 2156 |
| 268 | Ga0466968_0016833 | 3300044735 | Bacteria | 2914 |
| 269 | Ga0466970_0001061 | 3300044765 | Bacteria | 13303 |
| 270 | Ga0466960_0085652 | 3300044901 | Bacteria | 1596 |
| 271 | Ga0466959_0000415 | 3300045049 | Bacteria | 24900 |
| 272 | Ga0466958_0335632 | 3300045836 | Bacteria | 972 |
| 273 | Ga0466967_0006325 | 3300045976 | Bacteria | 8362 |
| 274 | Ga0495627_013868 | 3300046453 | Bacteria | 2828 |
| 275 | Ga0495591_081478 | 3300046458 | Bacteria | 824 |
| 276 | Ga0495580_0315167 | 3300046472 | Bacteria | 1063 |
| 277 | Ga0495580_0735408 | 3300046472 | Bacteria | 643 |
| 278 | Ga0495605_0003211 | 3300046474 | Bacteria | 9805 |
| 279 | Ga0495605_0032403 | 3300046474 | Bacteria | 2660 |
| 280 | Ga0495584_0159253 | 3300046491 | Bacteria | 1147 |
| 281 | Ga0495584_0179618 | 3300046491 | Bacteria | 1076 |
| 282 | Ga0495596_0000086 | 3300046500 | Bacteria | 64736 |
| 283 | Ga0495607_0017794 | 3300046501 | Bacteria | 4550 |
| 284 | Ga0495607_0104383 | 3300046501 | Bacteria | 1512 |
| 285 | Ga0495583_0005337 | 3300046506 | Bacteria | 8766 |
| 286 | Ga0495610_0000221 | 3300046512 | Bacteria | 61150 |
| 287 | Ga0495610_0011438 | 3300046512 | Bacteria | 5426 |
| 288 | Ga0495616_0007103 | 3300046513 | Bacteria | 6725 |
| 289 | Ga0495616_0046048 | 3300046513 | Bacteria | 2204 |
| 290 | Ga0495632_0012840 | 3300046519 | Bacteria | 4805 |
| 291 | Ga0495643_0008500 | 3300046522 | Bacteria | 6492 |
| 292 | Ga0495648_0101533 | 3300046524 | Bacteria | 1586 |
| 293 | Ga0495648_0175328 | 3300046524 | Bacteria | 1095 |
| 294 | Ga0495663_0003532 | 3300046525 | Bacteria | 4501 |
| 295 | Ga0495654_0020142 | 3300046530 | Bacteria | 3479 |
| 296 | Ga0495665_0083648 | 3300046531 | Bacteria | 1678 |
| 297 | Ga0495609_0004101 | 3300046538 | Bacteria | 8104 |
| 298 | Ga0495597_0000065 | 3300046542 | Bacteria | 90745 |
| 299 | Ga0495597_0075972 | 3300046542 | Bacteria | 1441 |
| 300 | Ga0495622_0091789 | 3300046557 | Bacteria | 1395 |
| 301 | Ga0495633_0040885 | 3300046558 | Bacteria | 2207 |
| 302 | Ga0495661_0021165 | 3300046665 | Bacteria | 4242 |
| 303 | Ga0495661_0070625 | 3300046665 | Bacteria | 2043 |
| 304 | Ga0495670_0051545 | 3300046691 | Bacteria | 2060 |
| 305 | Ga0495671_0003443 | 3300046692 | Bacteria | 9716 |
| 306 | Ga0495671_0112300 | 3300046692 | Bacteria | 1331 |
| 307 | Ga0495649_0022167 | 3300046694 | Bacteria | 3554 |
| 308 | Ga0495589_0015514 | 3300046794 | Bacteria | 3919 |
| 309 | Ga0495674_0000977 | 3300047319 | Bacteria | 27450 |
| 310 | Ga0495672_0005503 | 3300047320 | Bacteria | 10034 |
| 311 | Ga0495672_0101382 | 3300047320 | Bacteria | 1560 |
| 312 | Ga0495683_0195698 | 3300047323 | Bacteria | 914 |
| 313 | Ga0495687_041758 | 3300047443 | Bacteria | 2009 |
| 314 | Ga0495673_0069340 | 3300047469 | Bacteria | 1487 |
| 315 | Ga0495681_0010942 | 3300047470 | Bacteria | 5448 |
| 316 | Ga0495626_0081388 | 3300048091 | Bacteria | 1438 |
| 317 | Ga0496100_0000617 | 3300048903 | Bacteria | 16844 |
| 318 | Ga0496101_0000987 | 3300048904 | Bacteria | 16825 |
| 319 | Ga0496101_0033944 | 3300048904 | Bacteria | 3602 |
| 320 | Ga0496102_0000165 | 3300048905 | Bacteria | 89141 |
| 321 | Ga0496103_0000728 | 3300048906 | Bacteria | 24278 |
| 322 | Ga0496104_0425026 | 3300048907 | Bacteria | 1240 |
| 323 | Ga0496104_1377212 | 3300048907 | Bacteria | 608 |
| 324 | Ga0496105_0933244 | 3300048908 | Bacteria | 652 |
| 325 | Ga0496106_0043212 | 3300048909 | Bacteria | 3381 |
| 326 | Ga0496107_1016545 | 3300048910 | Bacteria | 601 |
| 327 | Ga0496112_0193458 | 3300048915 | Bacteria | 1995 |
| 328 | Ga0496114_0200421 | 3300048917 | Bacteria | 1748 |
| 329 | Ga0496116_0007050 | 3300048919 | Bacteria | 10064 |
| 330 | Ga0496116_0042730 | 3300048919 | Bacteria | 3095 |
| 331 | Ga0496116_0057197 | 3300048919 | Bacteria | 2551 |
| 332 | Ga0496116_0074697 | 3300048919 | Bacteria | 2131 |
| 333 | Ga0496117_0001246 | 3300048920 | Bacteria | 38001 |
| 334 | Ga0496117_0287960 | 3300048920 | Bacteria | 876 |
| 335 | Ga0496118_0000283 | 3300048921 | Bacteria | 89206 |
| 336 | Ga0496118_0238760 | 3300048921 | Bacteria | 1042 |
| 337 | Ga0496119_0000011 | 3300048922 | Bacteria | 438315 |
| 338 | Ga0496119_0045652 | 3300048922 | Bacteria | 2744 |
| 339 | Ga0496119_0194325 | 3300048922 | Bacteria | 1055 |
| 340 | Ga0496120_0002123 | 3300048923 | Bacteria | 21185 |
| 341 | Ga0496121_0001382 | 3300048924 | Bacteria | 41101 |
| 342 | Ga0496121_0006825 | 3300048924 | Bacteria | 13967 |
| 343 | Ga0496121_0010364 | 3300048924 | Bacteria | 10527 |
| 344 | Ga0496121_0015295 | 3300048924 | Bacteria | 8057 |
| 345 | Ga0496122_0002013 | 3300048925 | Bacteria | 30221 |
| 346 | Ga0496122_0045811 | 3300048925 | Bacteria | 3394 |
| 347 | Ga0496122_0123247 | 3300048925 | Bacteria | 1666 |
| 348 | Ga0496123_0000493 | 3300048926 | Bacteria | 68308 |
| 349 | Ga0496123_0052369 | 3300048926 | Bacteria | 2709 |
| 350 | Ga0496125_0024579 | 3300048928 | Bacteria | 5537 |
| 351 | Ga0496126_0156201 | 3300048929 | Bacteria | 1952 |
| 352 | Ga0495682_0231346 | 3300049460 | Bacteria | 654 |
| 353 | Ga0501031_0012439 | 3300049568 | Bacteria | 5552 |
| 354 | Ga0501031_0172932 | 3300049568 | Bacteria | 1411 |
| 355 | Ga0501031_0262202 | 3300049568 | Bacteria | 1123 |
| 356 | Ga0501032_0022038 | 3300049569 | Bacteria | 4422 |
| 357 | Ga0501032_0030996 | 3300049569 | Bacteria | 3668 |
| 358 | Ga0501032_0044529 | 3300049569 | Bacteria | 3003 |
| 359 | Ga0501032_0090851 | 3300049569 | Bacteria | 2026 |
| 360 | Ga0501032_0124280 | 3300049569 | Bacteria | 1705 |
| 361 | Ga0501032_0199542 | 3300049569 | Bacteria | 1306 |
| 362 | Ga0501032_0278274 | 3300049569 | Bacteria | 1083 |
| 363 | Ga0501032_0680491 | 3300049569 | Bacteria | 653 |
| 364 | Ga0501033_0000446 | 3300049570 | Bacteria | 39481 |
| 365 | Ga0501033_0019827 | 3300049570 | Bacteria | 5083 |
| 366 | Ga0501033_0022737 | 3300049570 | Bacteria | 4727 |
| 367 | Ga0501033_0029784 | 3300049570 | Bacteria | 4102 |
| 368 | Ga0501033_0048131 | 3300049570 | Bacteria | 3167 |
| 369 | Ga0501033_0053457 | 3300049570 | Bacteria | 2991 |
| 370 | Ga0501033_0083288 | 3300049570 | Bacteria | 2345 |
| 371 | Ga0501033_0126924 | 3300049570 | Bacteria | 1849 |
| 372 | Ga0501033_0176588 | 3300049570 | Bacteria | 1532 |
| 373 | Ga0501033_0236737 | 3300049570 | Bacteria | 1296 |
| 374 | Ga0501034_0004324 | 3300049571 | Bacteria | 15844 |
| 375 | Ga0501034_0185096 | 3300049571 | Bacteria | 2047 |
| 376 | Ga0501034_0318546 | 3300049571 | Bacteria | 1488 |
| 377 | Ga0501034_0375448 | 3300049571 | Bacteria | 1347 |
| 378 | Ga0501034_0388659 | 3300049571 | Bacteria | 1319 |
| 379 | Ga0501034_0399774 | 3300049571 | Bacteria | 1297 |
| 380 | Ga0501034_0520976 | 3300049571 | Bacteria | 1101 |
| 381 | Ga0501034_0538518 | 3300049571 | Bacteria | 1078 |
| 382 | Ga0501034_0544357 | 3300049571 | Bacteria | 1071 |
| 383 | Ga0501034_0662850 | 3300049571 | Bacteria | 944 |
| 384 | Ga0501036_0005424 | 3300049572 | Bacteria | 10334 |
| 385 | Ga0501036_0029074 | 3300049572 | Bacteria | 4672 |
| 386 | Ga0501036_0095573 | 3300049572 | Bacteria | 2512 |
| 387 | Ga0501036_0181086 | 3300049572 | Bacteria | 1774 |
| 388 | Ga0501036_0216566 | 3300049572 | Bacteria | 1608 |
| 389 | Ga0501036_0545303 | 3300049572 | Bacteria | 964 |
| 390 | Ga0501036_0803996 | 3300049572 | Bacteria | 774 |
| 391 | Ga0501037_0000179 | 3300049573 | Bacteria | 58767 |
| 392 | Ga0501037_0001481 | 3300049573 | Bacteria | 17182 |
| 393 | Ga0501037_0058510 | 3300049573 | Bacteria | 2812 |
| 394 | Ga0501037_0107945 | 3300049573 | Bacteria | 2006 |
| 395 | Ga0501037_0230112 | 3300049573 | Bacteria | 1302 |
| 396 | Ga0501037_0242597 | 3300049573 | Bacteria | 1263 |
| 397 | Ga0501037_0423386 | 3300049573 | Bacteria | 911 |
| 398 | Ga0501037_0430329 | 3300049573 | Bacteria | 902 |
| 399 | Ga0501038_0008730 | 3300049574 | Bacteria | 9300 |
| 400 | Ga0501038_0016736 | 3300049574 | Bacteria | 6642 |
| 401 | Ga0501038_0080825 | 3300049574 | Bacteria | 2739 |
| 402 | Ga0501038_0174718 | 3300049574 | Bacteria | 1737 |
| 403 | Ga0501038_0238033 | 3300049574 | Bacteria | 1446 |
| 404 | Ga0501038_0306094 | 3300049574 | Bacteria | 1246 |
| 405 | Ga0501039_0001884 | 3300049575 | Bacteria | 15509 |
| 406 | Ga0501039_0105688 | 3300049575 | Bacteria | 2198 |
| 407 | Ga0501039_0980498 | 3300049575 | Bacteria | 657 |
| 408 | Ga0501042_0011846 | 3300049578 | Bacteria | 5889 |
| 409 | Ga0501042_0168464 | 3300049578 | Bacteria | 1581 |
| 410 | Ga0501043_0000005 | 3300049579 | Bacteria | 254466 |
| 411 | Ga0501043_0005191 | 3300049579 | Bacteria | 10540 |
| 412 | Ga0501043_0007432 | 3300049579 | Bacteria | 8698 |
| 413 | Ga0501043_0036224 | 3300049579 | Bacteria | 3881 |
| 414 | Ga0501043_0043005 | 3300049579 | Bacteria | 3551 |
| 415 | Ga0501043_0122225 | 3300049579 | Bacteria | 2042 |
| 416 | Ga0501043_0200972 | 3300049579 | Bacteria | 1547 |
| 417 | Ga0501043_0275677 | 3300049579 | Bacteria | 1290 |
| 418 | Ga0501043_0285858 | 3300049579 | Bacteria | 1263 |
| 419 | Ga0501043_0539030 | 3300049579 | Bacteria | 868 |
| 420 | Ga0501046_0000376 | 3300049580 | Bacteria | 45083 |
| 421 | Ga0501046_0021898 | 3300049580 | Bacteria | 5269 |
| 422 | Ga0501046_0071918 | 3300049580 | Bacteria | 2686 |
| 423 | Ga0501046_0246319 | 3300049580 | Bacteria | 1317 |
| 424 | Ga0501046_0354414 | 3300049580 | Bacteria | 1065 |
| 425 | Ga0501046_0704145 | 3300049580 | Bacteria | 711 |
| 426 | Ga0501046_0910026 | 3300049580 | Bacteria | 613 |
| 427 | Ga0501047_0022956 | 3300049581 | Bacteria | 5989 |
| 428 | Ga0501047_0055387 | 3300049581 | Bacteria | 3835 |
| 429 | Ga0501047_0070774 | 3300049581 | Bacteria | 3358 |
| 430 | Ga0501047_0074428 | 3300049581 | Bacteria | 3270 |
| 431 | Ga0501047_0088937 | 3300049581 | Bacteria | 2966 |
| 432 | Ga0501047_0121847 | 3300049581 | Bacteria | 2489 |
| 433 | Ga0501047_0154601 | 3300049581 | Bacteria | 2168 |
| 434 | Ga0501047_0170493 | 3300049581 | Bacteria | 2045 |
| 435 | Ga0501047_0277327 | 3300049581 | Bacteria | 1522 |
| 436 | Ga0501047_0809349 | 3300049581 | Bacteria | 752 |
| 437 | Ga0501048_0168532 | 3300049582 | Bacteria | 1551 |
| 438 | Ga0501048_0408100 | 3300049582 | Bacteria | 971 |
| 439 | Ga0501068_0047823 | 3300049584 | Bacteria | 2581 |
| 440 | Ga0501068_0608383 | 3300049584 | Bacteria | 712 |
| 441 | Ga0501069_0000011 | 3300049585 | Bacteria | 153214 |
| 442 | Ga0501069_0205867 | 3300049585 | Bacteria | 1141 |
| 443 | Ga0501070_0001424 | 3300049586 | Bacteria | 21419 |
| 444 | Ga0501070_0013988 | 3300049586 | Bacteria | 6756 |
| 445 | Ga0501070_0032558 | 3300049586 | Bacteria | 4363 |
| 446 | Ga0501070_0046609 | 3300049586 | Bacteria | 3604 |
| 447 | Ga0501070_0047624 | 3300049586 | Bacteria | 3562 |
| 448 | Ga0501070_0059996 | 3300049586 | Bacteria | 3153 |
| 449 | Ga0501070_0134414 | 3300049586 | Bacteria | 2042 |
| 450 | Ga0501070_0140286 | 3300049586 | Bacteria | 1995 |
| 451 | Ga0501070_1064001 | 3300049586 | Bacteria | 625 |
| 452 | Ga0501071_0059243 | 3300049587 | Bacteria | 2770 |
| 453 | Ga0501073_0078435 | 3300049589 | Bacteria | 2298 |
| 454 | Ga0501074_0000336 | 3300049590 | Bacteria | 27389 |
| 455 | Ga0501080_0001369 | 3300049742 | Bacteria | 20402 |
| 456 | Ga0501080_0904887 | 3300049742 | Bacteria | 769 |
| 457 | Ga0501081_0114796 | 3300049743 | Bacteria | 1914 |
| 458 | Ga0501083_0000805 | 3300049744 | Bacteria | 20562 |
| 459 | Ga0501035_0000107 | 3300049822 | Bacteria | 103130 |
| 460 | Ga0501035_0007869 | 3300049822 | Bacteria | 9961 |
| 461 | Ga0501035_0013853 | 3300049822 | Bacteria | 7443 |
| 462 | Ga0501035_0015836 | 3300049822 | Bacteria | 6958 |
| 463 | Ga0501035_0039263 | 3300049822 | Bacteria | 4284 |
| 464 | Ga0501035_0060690 | 3300049822 | Bacteria | 3366 |
| 465 | Ga0501035_0062852 | 3300049822 | Bacteria | 3303 |
| 466 | Ga0501035_0063985 | 3300049822 | Bacteria | 3270 |
| 467 | Ga0501035_0107961 | 3300049822 | Bacteria | 2440 |
| 468 | Ga0501035_0115867 | 3300049822 | Bacteria | 2345 |
| 469 | Ga0501035_0206022 | 3300049822 | Bacteria | 1685 |
| 470 | Ga0501035_0268985 | 3300049822 | Bacteria | 1443 |
| 471 | Ga0501035_1005676 | 3300049822 | Bacteria | 655 |
| 472 | Ga0501044_0000077 | 3300049823 | Bacteria | 119196 |
| 473 | Ga0501044_0000154 | 3300049823 | Bacteria | 85407 |
| 474 | Ga0501044_0005777 | 3300049823 | Bacteria | 13696 |
| 475 | Ga0501044_0009552 | 3300049823 | Bacteria | 10560 |
| 476 | Ga0501044_0026244 | 3300049823 | Bacteria | 6168 |
| 477 | Ga0501044_0055808 | 3300049823 | Bacteria | 4056 |
| 478 | Ga0501044_0064444 | 3300049823 | Bacteria | 3741 |
| 479 | Ga0501044_0101420 | 3300049823 | Bacteria | 2895 |
| 480 | Ga0501044_0133295 | 3300049823 | Bacteria | 2477 |
| 481 | Ga0501044_0157858 | 3300049823 | Bacteria | 2247 |
| 482 | Ga0501044_0366195 | 3300049823 | Bacteria | 1359 |
| 483 | Ga0501044_0366330 | 3300049823 | Bacteria | 1358 |
| 484 | Ga0501044_0541164 | 3300049823 | Bacteria | 1062 |
| 485 | Ga0501044_0564691 | 3300049823 | Bacteria | 1034 |
| 486 | Ga0501044_0588697 | 3300049823 | Bacteria | 1006 |
| 487 | Ga0501044_0756750 | 3300049823 | Bacteria | 853 |
| 488 | Ga0501044_0835310 | 3300049823 | Bacteria | 799 |
| 489 | Ga0501044_1364424 | 3300049823 | Bacteria | 575 |
| 490 | nmdc:mga09592_9834_c1 | 3300050508 | Bacteria | 7775 |
| 491 | nmdc:mga06r32_233866_c1 | 3300050510 | Bacteria | 1826 |
| 492 | Ga0501082_0015310 | 3300060353 | Bacteria | 6603 |
| 493 | Ga0501082_0215324 | 3300060353 | Bacteria | 1671 |
| 494 | Ga0501082_0380269 | 3300060353 | Bacteria | 1232 |
| 495 | Ga0466962_0011043 | 3300061719 | Bacteria | 4348 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025292 | Ga0209676_1039738 | Ga0209676_10397383 | 145 |
| 2 | iso_pu_bacteria | 8003014200 | 8003016238 | 146 |
| 3 | iso_pu_bacteria | 2928058823 | 2928059548 | 147 |
| 4 | iso_pu_bacteria | 2939631187 | 2939631236 | 147 |
| 5 | iso_pu_bacteria | 2941489479 | 2941493695 | 147 |
| 6 | iso_pu_bacteria | 2995948881 | 2995952358 | 147 |
| 7 | 3300003187 | JGI25151J46595_10000846 | JGI25151J46595_100008468 | 148 |
| 8 | 3300003215 | JGI25153J46596_10056366 | JGI25153J46596_100563662 | 148 |
| 9 | 3300025292 | Ga0209676_1040147 | Ga0209676_10401473 | 148 |
| 10 | 3300025294 | Ga0209025_1000224 | Ga0209025_100022416 | 148 |
| 11 | 3300025297 | Ga0209758_1002177 | Ga0209758_100217715 | 148 |
| 12 | 3300046512 | Ga0495610_0011438 | Ga0495610_0011438_4586_5053 | 148 |
| 13 | 3300048917 | Ga0496114_0200421 | Ga0496114_0200421_1143_1607 | 148 |
| 14 | 3300049568 | Ga0501031_0172932 | Ga0501031_0172932_522_992 | 148 |
| 15 | 3300049569 | Ga0501032_0044529 | Ga0501032_0044529_1152_1622 | 148 |
| 16 | 3300049569 | Ga0501032_0278274 | Ga0501032_0278274_158_625 | 148 |
| 17 | 3300049570 | Ga0501033_0029784 | Ga0501033_0029784_738_1205 | 148 |
| 18 | 3300049570 | Ga0501033_0048131 | Ga0501033_0048131_467_937 | 148 |
| 19 | 3300049571 | Ga0501034_0185096 | Ga0501034_0185096_323_790 | 148 |
| 20 | 3300049571 | Ga0501034_0662850 | Ga0501034_0662850_326_796 | 148 |
| 21 | 3300049572 | Ga0501036_0029074 | Ga0501036_0029074_1396_1866 | 148 |
| 22 | 3300049573 | Ga0501037_0058510 | Ga0501037_0058510_1982_2452 | 148 |
| 23 | 3300049573 | Ga0501037_0423386 | Ga0501037_0423386_45_506 | 148 |
| 24 | 3300049574 | Ga0501038_0008730 | Ga0501038_0008730_285_752 | 148 |
| 25 | 3300049574 | Ga0501038_0174718 | Ga0501038_0174718_112_582 | 148 |
| 26 | 3300049575 | Ga0501039_0105688 | Ga0501039_0105688_994_1464 | 148 |
| 27 | 3300049579 | Ga0501043_0122225 | Ga0501043_0122225_1547_2014 | 148 |
| 28 | 3300049580 | Ga0501046_0071918 | Ga0501046_0071918_2024_2494 | 148 |
| 29 | 3300049580 | Ga0501046_0354414 | Ga0501046_0354414_12_479 | 148 |
| 30 | 3300049581 | Ga0501047_0070774 | Ga0501047_0070774_909_1379 | 148 |
| 31 | 3300049581 | Ga0501047_0121847 | Ga0501047_0121847_1463_1930 | 148 |
| 32 | 3300049582 | Ga0501048_0408100 | Ga0501048_0408100_87_557 | 148 |
| 33 | 3300049586 | Ga0501070_0059996 | Ga0501070_0059996_352_813 | 148 |
| 34 | 3300049822 | Ga0501035_0039263 | Ga0501035_0039263_2095_2565 | 148 |
| 35 | 3300049823 | Ga0501044_0026244 | Ga0501044_0026244_2296_2766 | 148 |
| 36 | 3300049823 | Ga0501044_0541164 | Ga0501044_0541164_27_494 | 148 |
| 37 | 3300049823 | Ga0501044_0588697 | Ga0501044_0588697_450_920 | 148 |
| 38 | iso_pu_bacteria | 2582581306 | 2585264773 | 148 |
| 39 | iso_pu_bacteria | 2582581865 | 2585386158 | 148 |
| 40 | iso_pu_bacteria | 2617270742 | 2617381089 | 148 |
| 41 | iso_pu_bacteria | 2643221550 | 2643772219 | 148 |
| 42 | iso_pu_bacteria | 2643221734 | 2644734034 | 148 |
| 43 | iso_pu_bacteria | 2643221736 | 2644747361 | 148 |
| 44 | iso_pu_bacteria | 2728368998 | 2728749167 | 148 |
| 45 | iso_pu_bacteria | 2842482326 | 2842484266 | 148 |
| 46 | iso_pu_bacteria | 2917699015 | 2917701851 | 148 |
| 47 | iso_pu_bacteria | 2996336353 | 2996338875 | 148 |
| 48 | 3300003781 | Ga0055536_1010363 | Ga0055536_10103632 | 149 |
| 49 | 3300003794 | Ga0055531_10009885 | Ga0055531_100098852 | 149 |
| 50 | 3300006844 | Ga0075428_100003085 | Ga0075428_1000030856 | 149 |
| 51 | 3300006846 | Ga0075430_100281184 | Ga0075430_1002811842 | 149 |
| 52 | 3300006847 | Ga0075431_100026710 | Ga0075431_1000267103 | 149 |
| 53 | 3300006880 | Ga0075429_100008248 | Ga0075429_1000082482 | 149 |
| 54 | 3300009147 | Ga0114129_10018969 | Ga0114129_100189697 | 149 |
| 55 | 3300025291 | Ga0209675_1010617 | Ga0209675_10106174 | 149 |
| 56 | 3300025292 | Ga0209676_1005557 | Ga0209676_10055572 | 149 |
| 57 | 3300025292 | Ga0209676_1006363 | Ga0209676_10063636 | 149 |
| 58 | 3300025298 | Ga0209050_1006506 | Ga0209050_10065062 | 149 |
| 59 | 3300025299 | Ga0209256_1001956 | Ga0209256_10019562 | 149 |
| 60 | 3300025304 | Ga0209257_1000255 | Ga0209257_100025579 | 149 |
| 61 | 3300028380 | Ga0268265_10176603 | Ga0268265_101766032 | 149 |
| 62 | 3300037418 | Ga0395900_0171384 | Ga0395900_0171384_870_1337 | 149 |
| 63 | 3300038443 | Ga0395901_0290340 | Ga0395901_0290340_659_1126 | 149 |
| 64 | 3300041406 | Ga0439439_0121575 | Ga0439439_0121575_63_578 | 149 |
| 65 | 3300041413 | Ga0439465_0005898 | Ga0439465_0005898_874_1332 | 149 |
| 66 | 3300042007 | Ga0439449_0013888 | Ga0439449_0013888_532_1047 | 149 |
| 67 | 3300042010 | Ga0439452_017109 | Ga0439452_017109_1226_1684 | 149 |
| 68 | 3300049569 | Ga0501032_0199542 | Ga0501032_0199542_122_583 | 149 |
| 69 | 3300049570 | Ga0501033_0126924 | Ga0501033_0126924_57_518 | 149 |
| 70 | 3300049571 | Ga0501034_0399774 | Ga0501034_0399774_507_968 | 149 |
| 71 | 3300049573 | Ga0501037_0242597 | Ga0501037_0242597_407_868 | 149 |
| 72 | 3300049574 | Ga0501038_0080825 | Ga0501038_0080825_2037_2498 | 149 |
| 73 | 3300049579 | Ga0501043_0007432 | Ga0501043_0007432_5173_5631 | 149 |
| 74 | 3300049579 | Ga0501043_0043005 | Ga0501043_0043005_1416_1877 | 149 |
| 75 | 3300049579 | Ga0501043_0285858 | Ga0501043_0285858_792_1250 | 149 |
| 76 | 3300049581 | Ga0501047_0074428 | Ga0501047_0074428_575_1036 | 149 |
| 77 | 3300049823 | Ga0501044_0055808 | Ga0501044_0055808_305_766 | 149 |
| 78 | 3300050508 | nmdc:mga09592_9834_c1 | nmdc:mga09592_9834_c1_3080_3547 | 149 |
| 79 | 3300050510 | nmdc:mga06r32_233866_c1 | nmdc:mga06r32_233866_c1_768_1235 | 149 |
| 80 | iso_pu_bacteria | 643692032 | 643827892 | 149 |
| 81 | 3300003323 | rootH1_10242536 | rootH1_102425364 | 150 |
| 82 | 3300003773 | Ga0055537_1000057 | Ga0055537_100005713 | 150 |
| 83 | 3300003775 | Ga0055524_1000066 | Ga0055524_100006688 | 150 |
| 84 | 3300003784 | Ga0055534_1000175 | Ga0055534_10001756 | 150 |
| 85 | 3300003790 | Ga0055528_1000023 | Ga0055528_100002387 | 150 |
| 86 | 3300005262 | Ga0065165_1097193 | Ga0065165_10971932 | 150 |
| 87 | 3300005435 | Ga0070714_100553614 | Ga0070714_1005536142 | 150 |
| 88 | 3300013102 | Ga0157371_10705839 | Ga0157371_107058391 | 150 |
| 89 | 3300015689 | Ga0183360_10001 | Ga0183360_10001888 | 150 |
| 90 | 3300025263 | Ga0209565_1000005 | Ga0209565_1000005253 | 150 |
| 91 | 3300025273 | Ga0209673_1000027 | Ga0209673_1000027254 | 150 |
| 92 | 3300025284 | Ga0209130_1000244 | Ga0209130_100024456 | 150 |
| 93 | 3300025291 | Ga0209675_1000004 | Ga0209675_1000004253 | 150 |
| 94 | 3300025295 | Ga0209564_1000050 | Ga0209564_1000050254 | 150 |
| 95 | 3300025299 | Ga0209256_1000031 | Ga0209256_1000031254 | 150 |
| 96 | 3300025302 | Ga0207426_1000151 | Ga0207426_100015156 | 150 |
| 97 | 3300025929 | Ga0207664_10154990 | Ga0207664_101549903 | 150 |
| 98 | 3300028794 | Ga0307515_10000029 | Ga0307515_10000029164 | 150 |
| 99 | 3300031456 | Ga0307513_10010270 | Ga0307513_100102703 | 150 |
| 100 | 3300037312 | Ga0395899_0002516 | Ga0395899_0002516_6357_6833 | 150 |
| 101 | 3300037312 | Ga0395899_0176000 | Ga0395899_0176000_254_721 | 150 |
| 102 | 3300037312 | Ga0395899_0212784 | Ga0395899_0212784_197_664 | 150 |
| 103 | 3300037312 | Ga0395899_0326895 | Ga0395899_0326895_186_650 | 150 |
| 104 | 3300037418 | Ga0395900_0000006 | Ga0395900_0000006_384504_384980 | 150 |
| 105 | 3300037418 | Ga0395900_0005617 | Ga0395900_0005617_6936_7403 | 150 |
| 106 | 3300037418 | Ga0395900_0054526 | Ga0395900_0054526_1095_1559 | 150 |
| 107 | 3300037466 | Ga0395898_0012851 | Ga0395898_0012851_1635_2102 | 150 |
| 108 | 3300037466 | Ga0395898_0114289 | Ga0395898_0114289_1812_2279 | 150 |
| 109 | 3300037466 | Ga0395898_0141682 | Ga0395898_0141682_951_1415 | 150 |
| 110 | 3300037466 | Ga0395898_0206248 | Ga0395898_0206248_1009_1485 | 150 |
| 111 | 3300037471 | Ga0395905_0034107 | Ga0395905_0034107_1541_2017 | 150 |
| 112 | 3300038443 | Ga0395901_0000001 | Ga0395901_0000001_427752_428228 | 150 |
| 113 | 3300038443 | Ga0395901_0037019 | Ga0395901_0037019_2391_2855 | 150 |
| 114 | 3300038443 | Ga0395901_0843535 | Ga0395901_0843535_143_610 | 150 |
| 115 | 3300038443 | Ga0395901_1811127 | Ga0395901_1811127_77_544 | 150 |
| 116 | 3300045976 | Ga0466967_0006325 | Ga0466967_0006325_864_1373 | 150 |
| 117 | 3300046474 | Ga0495605_0032403 | Ga0495605_0032403_1686_2153 | 150 |
| 118 | 3300046542 | Ga0495597_0000065 | Ga0495597_0000065_34081_34539 | 150 |
| 119 | 3300048924 | Ga0496121_0010364 | Ga0496121_0010364_5462_5935 | 150 |
| 120 | 3300049570 | Ga0501033_0022737 | Ga0501033_0022737_350_829 | 150 |
| 121 | 3300049571 | Ga0501034_0318546 | Ga0501034_0318546_147_611 | 150 |
| 122 | 3300049571 | Ga0501034_0544357 | Ga0501034_0544357_492_971 | 150 |
| 123 | 3300049572 | Ga0501036_0095573 | Ga0501036_0095573_430_909 | 150 |
| 124 | 3300049572 | Ga0501036_0216566 | Ga0501036_0216566_957_1421 | 150 |
| 125 | 3300049573 | Ga0501037_0107945 | Ga0501037_0107945_658_1122 | 150 |
| 126 | 3300049574 | Ga0501038_0016736 | Ga0501038_0016736_64_528 | 150 |
| 127 | 3300049578 | Ga0501042_0168464 | Ga0501042_0168464_971_1435 | 150 |
| 128 | 3300049579 | Ga0501043_0539030 | Ga0501043_0539030_120_584 | 150 |
| 129 | 3300049580 | Ga0501046_0246319 | Ga0501046_0246319_311_790 | 150 |
| 130 | 3300049580 | Ga0501046_0704145 | Ga0501046_0704145_195_659 | 150 |
| 131 | 3300049581 | Ga0501047_0055387 | Ga0501047_0055387_1964_2428 | 150 |
| 132 | 3300049581 | Ga0501047_0170493 | Ga0501047_0170493_204_683 | 150 |
| 133 | 3300049582 | Ga0501048_0168532 | Ga0501048_0168532_946_1410 | 150 |
| 134 | 3300049743 | Ga0501081_0114796 | Ga0501081_0114796_928_1401 | 150 |
| 135 | 3300049822 | Ga0501035_0063985 | Ga0501035_0063985_454_933 | 150 |
| 136 | 3300049823 | Ga0501044_0133295 | Ga0501044_0133295_684_1148 | 150 |
| 137 | iso_pu_bacteria | 8057101203 | 8057101968 | 150 |
| 138 | 3300001979 | JGI24740J21852_10000165 | JGI24740J21852_100001653 | 151 |
| 139 | 3300002737 | JGI25162J39368_1000111 | JGI25162J39368_10001119 | 151 |
| 140 | 3300002738 | JGI25154J39366_1000536 | JGI25154J39366_100053615 | 151 |
| 141 | 3300002987 | JGI25159J45721_1006237 | JGI25159J45721_10062373 | 151 |
| 142 | 3300003187 | JGI25151J46595_10001459 | JGI25151J46595_100014594 | 151 |
| 143 | 3300003187 | JGI25151J46595_10015852 | JGI25151J46595_100158521 | 151 |
| 144 | 3300003187 | JGI25151J46595_10021024 | JGI25151J46595_100210242 | 151 |
| 145 | 3300003214 | JGI25165J46597_1001440 | JGI25165J46597_10014402 | 151 |
| 146 | 3300003214 | JGI25165J46597_1035630 | JGI25165J46597_10356301 | 151 |
| 147 | 3300003322 | rootL2_10174794 | rootL2_101747941 | 151 |
| 148 | 3300003751 | Ga0055538_1002615 | Ga0055538_10026152 | 151 |
| 149 | 3300003752 | Ga0055539_1000201 | Ga0055539_10002018 | 151 |
| 150 | 3300003756 | Ga0055533_1000937 | Ga0055533_100093710 | 151 |
| 151 | 3300003758 | Ga0055532_1000073 | Ga0055532_100007329 | 151 |
| 152 | 3300003759 | Ga0055525_1000366 | Ga0055525_10003668 | 151 |
| 153 | 3300003759 | Ga0055525_1005504 | Ga0055525_10055042 | 151 |
| 154 | 3300003761 | Ga0055535_1000055 | Ga0055535_100005529 | 151 |
| 155 | 3300003762 | Ga0055542_1000721 | Ga0055542_100072125 | 151 |
| 156 | 3300003763 | Ga0055529_1000149 | Ga0055529_10001492 | 151 |
| 157 | 3300003771 | Ga0055526_1003295 | Ga0055526_100329512 | 151 |
| 158 | 3300003771 | Ga0055526_1004820 | Ga0055526_10048208 | 151 |
| 159 | 3300003771 | Ga0055526_1022147 | Ga0055526_10221473 | 151 |
| 160 | 3300003771 | Ga0055526_1024545 | Ga0055526_10245452 | 151 |
| 161 | 3300003771 | Ga0055526_1027604 | Ga0055526_10276043 | 151 |
| 162 | 3300003775 | Ga0055524_1015029 | Ga0055524_10150293 | 151 |
| 163 | 3300003775 | Ga0055524_1018659 | Ga0055524_10186593 | 151 |
| 164 | 3300003775 | Ga0055524_1022085 | Ga0055524_10220853 | 151 |
| 165 | 3300003781 | Ga0055536_1000339 | Ga0055536_100033924 | 151 |
| 166 | 3300003781 | Ga0055536_1007488 | Ga0055536_10074882 | 151 |
| 167 | 3300003781 | Ga0055536_1084748 | Ga0055536_10847481 | 151 |
| 168 | 3300003784 | Ga0055534_1000247 | Ga0055534_100024712 | 151 |
| 169 | 3300003784 | Ga0055534_1002727 | Ga0055534_10027271 | 151 |
| 170 | 3300003791 | Ga0055530_10004258 | Ga0055530_100042588 | 151 |
| 171 | 3300003794 | Ga0055531_10023298 | Ga0055531_100232983 | 151 |
| 172 | 3300003794 | Ga0055531_10023925 | Ga0055531_100239253 | 151 |
| 173 | 3300003794 | Ga0055531_10041843 | Ga0055531_100418432 | 151 |
| 174 | 3300003841 | Ga0055541_1000336 | Ga0055541_100033611 | 151 |
| 175 | 3300003841 | Ga0055541_1008961 | Ga0055541_10089612 | 151 |
| 176 | 3300004625 | Ga0055543_1072670 | Ga0055543_10726701 | 151 |
| 177 | 3300005262 | Ga0065165_1000119 | Ga0065165_1000119119 | 151 |
| 178 | 3300005262 | Ga0065165_1000545 | Ga0065165_100054514 | 151 |
| 179 | 3300005336 | Ga0070680_100268598 | Ga0070680_1002685982 | 151 |
| 180 | 3300005336 | Ga0070680_100349743 | Ga0070680_1003497434 | 151 |
| 181 | 3300005337 | Ga0070682_100014762 | Ga0070682_1000147624 | 151 |
| 182 | 3300005344 | Ga0070661_100000061 | Ga0070661_10000006144 | 151 |
| 183 | 3300005366 | Ga0070659_100002481 | Ga0070659_1000024816 | 151 |
| 184 | 3300005366 | Ga0070659_100170551 | Ga0070659_1001705512 | 151 |
| 185 | 3300005455 | Ga0070663_100000009 | Ga0070663_10000000922 | 151 |
| 186 | 3300005455 | Ga0070663_100013889 | Ga0070663_1000138892 | 151 |
| 187 | 3300005455 | Ga0070663_100068421 | Ga0070663_1000684213 | 151 |
| 188 | 3300005455 | Ga0070663_100144834 | Ga0070663_1001448344 | 151 |
| 189 | 3300005455 | Ga0070663_100279202 | Ga0070663_1002792022 | 151 |
| 190 | 3300005458 | Ga0070681_10067174 | Ga0070681_100671741 | 151 |
| 191 | 3300005458 | Ga0070681_10321866 | Ga0070681_103218662 | 151 |
| 192 | 3300005530 | Ga0070679_100035873 | Ga0070679_1000358736 | 151 |
| 193 | 3300005535 | Ga0070684_100017185 | Ga0070684_1000171854 | 151 |
| 194 | 3300005539 | Ga0068853_100013529 | Ga0068853_1000135299 | 151 |
| 195 | 3300005563 | Ga0068855_100752393 | Ga0068855_1007523932 | 151 |
| 196 | 3300005564 | Ga0070664_100000010 | Ga0070664_10000001052 | 151 |
| 197 | 3300005577 | Ga0068857_101052441 | Ga0068857_1010524412 | 151 |
| 198 | 3300005578 | Ga0068854_100028644 | Ga0068854_1000286442 | 151 |
| 199 | 3300005614 | Ga0068856_100000045 | Ga0068856_1000000458 | 151 |
| 200 | 3300005616 | Ga0068852_100231301 | Ga0068852_1002313011 | 151 |
| 201 | 3300009011 | Ga0105251_10032244 | Ga0105251_100322442 | 151 |
| 202 | 3300009011 | Ga0105251_10159556 | Ga0105251_101595562 | 151 |
| 203 | 3300009093 | Ga0105240_10000739 | Ga0105240_1000073950 | 151 |
| 204 | 3300009093 | Ga0105240_10120343 | Ga0105240_101203432 | 151 |
| 205 | 3300009093 | Ga0105240_10139498 | Ga0105240_101394983 | 151 |
| 206 | 3300009093 | Ga0105240_10336432 | Ga0105240_103364323 | 151 |
| 207 | 3300009174 | Ga0105241_10221252 | Ga0105241_102212522 | 151 |
| 208 | 3300009545 | Ga0105237_10002121 | Ga0105237_100021212 | 151 |
| 209 | 3300009551 | Ga0105238_10004352 | Ga0105238_1000435210 | 151 |
| 210 | 3300009551 | Ga0105238_10061034 | Ga0105238_100610342 | 151 |
| 211 | 3300010375 | Ga0105239_10000454 | Ga0105239_1000045450 | 151 |
| 212 | 3300012512 | Ga0157327_1006626 | Ga0157327_10066262 | 151 |
| 213 | 3300013100 | Ga0157373_10004941 | Ga0157373_100049415 | 151 |
| 214 | 3300013100 | Ga0157373_10018501 | Ga0157373_100185014 | 151 |
| 215 | 3300013102 | Ga0157371_10000088 | Ga0157371_1000008895 | 151 |
| 216 | 3300013102 | Ga0157371_10017730 | Ga0157371_100177304 | 151 |
| 217 | 3300013104 | Ga0157370_10000041 | Ga0157370_1000004195 | 151 |
| 218 | 3300013104 | Ga0157370_10008961 | Ga0157370_1000896110 | 151 |
| 219 | 3300013104 | Ga0157370_10495702 | Ga0157370_104957022 | 151 |
| 220 | 3300013104 | Ga0157370_10660278 | Ga0157370_106602782 | 151 |
| 221 | 3300013105 | Ga0157369_10265362 | Ga0157369_102653623 | 151 |
| 222 | 3300013105 | Ga0157369_10435994 | Ga0157369_104359943 | 151 |
| 223 | 3300013250 | Ga0171462_1015 | Ga0171462_1015119 | 151 |
| 224 | 3300013307 | Ga0157372_10000097 | Ga0157372_1000009728 | 151 |
| 225 | 3300013307 | Ga0157372_10171824 | Ga0157372_101718245 | 151 |
| 226 | 3300014497 | Ga0182008_10022898 | Ga0182008_100228982 | 151 |
| 227 | 3300015261 | Ga0182006_1003196 | Ga0182006_10031966 | 151 |
| 228 | 3300015261 | Ga0182006_1016828 | Ga0182006_10168282 | 151 |
| 229 | 3300015262 | Ga0182007_10002998 | Ga0182007_100029988 | 151 |
| 230 | 3300020069 | Ga0197907_10007993 | Ga0197907_100079931 | 151 |
| 231 | 3300025207 | Ga0209760_100795 | Ga0209760_1007953 | 151 |
| 232 | 3300025224 | Ga0209784_100008 | Ga0209784_100008196 | 151 |
| 233 | 3300025224 | Ga0209784_100262 | Ga0209784_10026229 | 151 |
| 234 | 3300025225 | Ga0209566_100006 | Ga0209566_100006196 | 151 |
| 235 | 3300025225 | Ga0209566_100407 | Ga0209566_10040715 | 151 |
| 236 | 3300025225 | Ga0209566_100636 | Ga0209566_1006369 | 151 |
| 237 | 3300025226 | Ga0209674_100045 | Ga0209674_100045115 | 151 |
| 238 | 3300025226 | Ga0209674_100114 | Ga0209674_1001143 | 151 |
| 239 | 3300025229 | Ga0209147_100005 | Ga0209147_100005189 | 151 |
| 240 | 3300025230 | Ga0209563_100016 | Ga0209563_100016196 | 151 |
| 241 | 3300025230 | Ga0209563_111699 | Ga0209563_1116992 | 151 |
| 242 | 3300025233 | Ga0209437_100064 | Ga0209437_10006477 | 151 |
| 243 | 3300025242 | Ga0209258_100007 | Ga0209258_100007189 | 151 |
| 244 | 3300025246 | Ga0209646_1000027 | Ga0209646_100002771 | 151 |
| 245 | 3300025250 | Ga0209026_1003785 | Ga0209026_10037857 | 151 |
| 246 | 3300025253 | Ga0209677_100008 | Ga0209677_100008496 | 151 |
| 247 | 3300025253 | Ga0209677_105391 | Ga0209677_1053912 | 151 |
| 248 | 3300025254 | Ga0209148_1000019 | Ga0209148_1000019165 | 151 |
| 249 | 3300025256 | Ga0209759_1004768 | Ga0209759_10047682 | 151 |
| 250 | 3300025256 | Ga0209759_1045859 | Ga0209759_10458591 | 151 |
| 251 | 3300025261 | Ga0209233_1000081 | Ga0209233_1000081225 | 151 |
| 252 | 3300025261 | Ga0209233_1004045 | Ga0209233_10040455 | 151 |
| 253 | 3300025263 | Ga0209565_1000094 | Ga0209565_1000094102 | 151 |
| 254 | 3300025272 | Ga0209455_1000011 | Ga0209455_1000011114 | 151 |
| 255 | 3300025273 | Ga0209673_1007856 | Ga0209673_10078562 | 151 |
| 256 | 3300025273 | Ga0209673_1007992 | Ga0209673_10079925 | 151 |
| 257 | 3300025284 | Ga0209130_1000702 | Ga0209130_10007028 | 151 |
| 258 | 3300025284 | Ga0209130_1015852 | Ga0209130_10158521 | 151 |
| 259 | 3300025291 | Ga0209675_1000079 | Ga0209675_100007918 | 151 |
| 260 | 3300025291 | Ga0209675_1002258 | Ga0209675_100225811 | 151 |
| 261 | 3300025291 | Ga0209675_1021220 | Ga0209675_10212201 | 151 |
| 262 | 3300025292 | Ga0209676_1000176 | Ga0209676_1000176100 | 151 |
| 263 | 3300025292 | Ga0209676_1001097 | Ga0209676_10010972 | 151 |
| 264 | 3300025292 | Ga0209676_1030419 | Ga0209676_10304192 | 151 |
| 265 | 3300025294 | Ga0209025_1000046 | Ga0209025_100004671 | 151 |
| 266 | 3300025294 | Ga0209025_1002162 | Ga0209025_10021627 | 151 |
| 267 | 3300025294 | Ga0209025_1007268 | Ga0209025_10072688 | 151 |
| 268 | 3300025294 | Ga0209025_1015187 | Ga0209025_10151874 | 151 |
| 269 | 3300025294 | Ga0209025_1077870 | Ga0209025_10778702 | 151 |
| 270 | 3300025295 | Ga0209564_1000166 | Ga0209564_100016693 | 151 |
| 271 | 3300025295 | Ga0209564_1000308 | Ga0209564_100030818 | 151 |
| 272 | 3300025295 | Ga0209564_1000509 | Ga0209564_100050915 | 151 |
| 273 | 3300025295 | Ga0209564_1005648 | Ga0209564_10056485 | 151 |
| 274 | 3300025295 | Ga0209564_1047058 | Ga0209564_10470583 | 151 |
| 275 | 3300025298 | Ga0209050_1001060 | Ga0209050_100106028 | 151 |
| 276 | 3300025298 | Ga0209050_1046019 | Ga0209050_10460192 | 151 |
| 277 | 3300025299 | Ga0209256_1000960 | Ga0209256_10009602 | 151 |
| 278 | 3300025299 | Ga0209256_1008858 | Ga0209256_10088582 | 151 |
| 279 | 3300025299 | Ga0209256_1008871 | Ga0209256_10088712 | 151 |
| 280 | 3300025302 | Ga0207426_1000215 | Ga0207426_1000215119 | 151 |
| 281 | 3300025302 | Ga0207426_1035838 | Ga0207426_10358382 | 151 |
| 282 | 3300025302 | Ga0207426_1079226 | Ga0207426_10792261 | 151 |
| 283 | 3300025303 | Ga0209051_1070857 | Ga0209051_10708573 | 151 |
| 284 | 3300025304 | Ga0209257_1000283 | Ga0209257_100028349 | 151 |
| 285 | 3300025304 | Ga0209257_1006338 | Ga0209257_10063388 | 151 |
| 286 | 3300025304 | Ga0209257_1007543 | Ga0209257_10075437 | 151 |
| 287 | 3300025304 | Ga0209257_1035848 | Ga0209257_10358482 | 151 |
| 288 | 3300025711 | Ga0207696_1007558 | Ga0207696_10075583 | 151 |
| 289 | 3300025728 | Ga0207655_1014101 | Ga0207655_10141014 | 151 |
| 290 | 3300025735 | Ga0207713_1020832 | Ga0207713_10208322 | 151 |
| 291 | 3300025909 | Ga0207705_10977475 | Ga0207705_109774752 | 151 |
| 292 | 3300025911 | Ga0207654_11179577 | Ga0207654_111795771 | 151 |
| 293 | 3300025912 | Ga0207707_10094144 | Ga0207707_100941443 | 151 |
| 294 | 3300025913 | Ga0207695_10000788 | Ga0207695_1000078837 | 151 |
| 295 | 3300025913 | Ga0207695_10006520 | Ga0207695_100065207 | 151 |
| 296 | 3300025913 | Ga0207695_10296570 | Ga0207695_102965702 | 151 |
| 297 | 3300025913 | Ga0207695_10565390 | Ga0207695_105653902 | 151 |
| 298 | 3300025914 | Ga0207671_10000411 | Ga0207671_1000041150 | 151 |
| 299 | 3300025914 | Ga0207671_10137651 | Ga0207671_101376512 | 151 |
| 300 | 3300025920 | Ga0207649_10000605 | Ga0207649_100006057 | 151 |
| 301 | 3300025921 | Ga0207652_10049707 | Ga0207652_100497074 | 151 |
| 302 | 3300025921 | Ga0207652_10974597 | Ga0207652_109745972 | 151 |
| 303 | 3300025924 | Ga0207694_10118163 | Ga0207694_101181632 | 151 |
| 304 | 3300025932 | Ga0207690_10063206 | Ga0207690_100632062 | 151 |
| 305 | 3300025932 | Ga0207690_10137932 | Ga0207690_101379323 | 151 |
| 306 | 3300025944 | Ga0207661_10000109 | Ga0207661_1000010915 | 151 |
| 307 | 3300025945 | Ga0207679_10000002 | Ga0207679_10000002523 | 151 |
| 308 | 3300025981 | Ga0207640_10009624 | Ga0207640_100096244 | 151 |
| 309 | 3300026041 | Ga0207639_10002690 | Ga0207639_100026906 | 151 |
| 310 | 3300026067 | Ga0207678_10000018 | Ga0207678_1000001892 | 151 |
| 311 | 3300026067 | Ga0207678_10045408 | Ga0207678_100454084 | 151 |
| 312 | 3300026067 | Ga0207678_10078794 | Ga0207678_100787943 | 151 |
| 313 | 3300026078 | Ga0207702_10000053 | Ga0207702_1000005366 | 151 |
| 314 | 3300026116 | Ga0207674_10001653 | Ga0207674_100016536 | 151 |
| 315 | 3300026142 | Ga0207698_11607399 | Ga0207698_116073992 | 151 |
| 316 | 3300027312 | Ga0209371_1000006 | Ga0209371_1000006651 | 151 |
| 317 | 3300027666 | Ga0209282_1000019 | Ga0209282_100001966 | 151 |
| 318 | 3300028794 | Ga0307515_10009918 | Ga0307515_100099187 | 151 |
| 319 | 3300030500 | Ga0268256_1000007 | Ga0268256_1000007651 | 151 |
| 320 | 3300031901 | Ga0307406_10297576 | Ga0307406_102975762 | 151 |
| 321 | 3300031901 | Ga0307406_10619919 | Ga0307406_106199192 | 151 |
| 322 | 3300037312 | Ga0395899_0008931 | Ga0395899_0008931_6551_7024 | 151 |
| 323 | 3300037312 | Ga0395899_0139154 | Ga0395899_0139154_630_1109 | 151 |
| 324 | 3300037312 | Ga0395899_0334003 | Ga0395899_0334003_115_570 | 151 |
| 325 | 3300037418 | Ga0395900_0118521 | Ga0395900_0118521_2090_2569 | 151 |
| 326 | 3300037418 | Ga0395900_0542173 | Ga0395900_0542173_149_622 | 151 |
| 327 | 3300037466 | Ga0395898_0098108 | Ga0395898_0098108_567_1040 | 151 |
| 328 | 3300037466 | Ga0395898_0432874 | Ga0395898_0432874_120_599 | 151 |
| 329 | 3300037466 | Ga0395898_0763789 | Ga0395898_0763789_206_676 | 151 |
| 330 | 3300037471 | Ga0395905_0147200 | Ga0395905_0147200_1144_1614 | 151 |
| 331 | 3300038443 | Ga0395901_0035004 | Ga0395901_0035004_4583_5056 | 151 |
| 332 | 3300038443 | Ga0395901_0397832 | Ga0395901_0397832_812_1285 | 151 |
| 333 | 3300042006 | Ga0439432_017466 | Ga0439432_017466_1419_1907 | 151 |
| 334 | 3300042139 | Ga0450904_000366 | Ga0450904_000366_1570_2043 | 151 |
| 335 | 3300044656 | Ga0466969_0008077 | Ga0466969_0008077_2236_2691 | 151 |
| 336 | 3300044658 | Ga0466972_0001290 | Ga0466972_0001290_2640_3095 | 151 |
| 337 | 3300044671 | Ga0466978_0006655 | Ga0466978_0006655_2234_2689 | 151 |
| 338 | 3300044672 | Ga0466982_0094720 | Ga0466982_0094720_757_1212 | 151 |
| 339 | 3300044683 | Ga0466965_0002975 | Ga0466965_0002975_2199_2654 | 151 |
| 340 | 3300044693 | Ga0466961_0000200 | Ga0466961_0000200_2419_2874 | 151 |
| 341 | 3300044694 | Ga0466963_0021800 | Ga0466963_0021800_1188_1643 | 151 |
| 342 | 3300044706 | Ga0466964_0178833 | Ga0466964_0178833_500_955 | 151 |
| 343 | 3300044719 | Ga0466971_0038113 | Ga0466971_0038113_117_572 | 151 |
| 344 | 3300044735 | Ga0466968_0016833 | Ga0466968_0016833_1684_2139 | 151 |
| 345 | 3300044765 | Ga0466970_0001061 | Ga0466970_0001061_10342_10797 | 151 |
| 346 | 3300044901 | Ga0466960_0085652 | Ga0466960_0085652_678_1133 | 151 |
| 347 | 3300045049 | Ga0466959_0000415 | Ga0466959_0000415_22408_22863 | 151 |
| 348 | 3300045836 | Ga0466958_0335632 | Ga0466958_0335632_146_601 | 151 |
| 349 | 3300046453 | Ga0495627_013868 | Ga0495627_013868_1793_2275 | 151 |
| 350 | 3300046458 | Ga0495591_081478 | Ga0495591_081478_310_786 | 151 |
| 351 | 3300046472 | Ga0495580_0315167 | Ga0495580_0315167_429_899 | 151 |
| 352 | 3300046472 | Ga0495580_0735408 | Ga0495580_0735408_132_599 | 151 |
| 353 | 3300046474 | Ga0495605_0003211 | Ga0495605_0003211_1929_2405 | 151 |
| 354 | 3300046491 | Ga0495584_0159253 | Ga0495584_0159253_453_929 | 151 |
| 355 | 3300046491 | Ga0495584_0179618 | Ga0495584_0179618_136_606 | 151 |
| 356 | 3300046500 | Ga0495596_0000086 | Ga0495596_0000086_49840_50316 | 151 |
| 357 | 3300046501 | Ga0495607_0017794 | Ga0495607_0017794_1762_2244 | 151 |
| 358 | 3300046501 | Ga0495607_0104383 | Ga0495607_0104383_85_561 | 151 |
| 359 | 3300046506 | Ga0495583_0005337 | Ga0495583_0005337_4292_4759 | 151 |
| 360 | 3300046512 | Ga0495610_0000221 | Ga0495610_0000221_1426_1902 | 151 |
| 361 | 3300046513 | Ga0495616_0007103 | Ga0495616_0007103_962_1438 | 151 |
| 362 | 3300046513 | Ga0495616_0046048 | Ga0495616_0046048_743_1213 | 151 |
| 363 | 3300046519 | Ga0495632_0012840 | Ga0495632_0012840_2823_3305 | 151 |
| 364 | 3300046522 | Ga0495643_0008500 | Ga0495643_0008500_1857_2339 | 151 |
| 365 | 3300046524 | Ga0495648_0101533 | Ga0495648_0101533_730_1197 | 151 |
| 366 | 3300046524 | Ga0495648_0175328 | Ga0495648_0175328_14_490 | 151 |
| 367 | 3300046525 | Ga0495663_0003532 | Ga0495663_0003532_1845_2327 | 151 |
| 368 | 3300046530 | Ga0495654_0020142 | Ga0495654_0020142_1548_2030 | 151 |
| 369 | 3300046531 | Ga0495665_0083648 | Ga0495665_0083648_23_490 | 151 |
| 370 | 3300046538 | Ga0495609_0004101 | Ga0495609_0004101_7510_7986 | 151 |
| 371 | 3300046542 | Ga0495597_0075972 | Ga0495597_0075972_872_1348 | 151 |
| 372 | 3300046557 | Ga0495622_0091789 | Ga0495622_0091789_765_1232 | 151 |
| 373 | 3300046558 | Ga0495633_0040885 | Ga0495633_0040885_1301_1768 | 151 |
| 374 | 3300046665 | Ga0495661_0021165 | Ga0495661_0021165_1747_2229 | 151 |
| 375 | 3300046665 | Ga0495661_0070625 | Ga0495661_0070625_1436_1912 | 151 |
| 376 | 3300046691 | Ga0495670_0051545 | Ga0495670_0051545_933_1409 | 151 |
| 377 | 3300046692 | Ga0495671_0003443 | Ga0495671_0003443_3815_4291 | 151 |
| 378 | 3300046692 | Ga0495671_0112300 | Ga0495671_0112300_462_929 | 151 |
| 379 | 3300046694 | Ga0495649_0022167 | Ga0495649_0022167_1059_1535 | 151 |
| 380 | 3300046794 | Ga0495589_0015514 | Ga0495589_0015514_1478_1948 | 151 |
| 381 | 3300047319 | Ga0495674_0000977 | Ga0495674_0000977_4603_5073 | 151 |
| 382 | 3300047320 | Ga0495672_0005503 | Ga0495672_0005503_1601_2077 | 151 |
| 383 | 3300047320 | Ga0495672_0101382 | Ga0495672_0101382_156_623 | 151 |
| 384 | 3300047323 | Ga0495683_0195698 | Ga0495683_0195698_279_749 | 151 |
| 385 | 3300047443 | Ga0495687_041758 | Ga0495687_041758_86_556 | 151 |
| 386 | 3300047469 | Ga0495673_0069340 | Ga0495673_0069340_55_522 | 151 |
| 387 | 3300047470 | Ga0495681_0010942 | Ga0495681_0010942_2844_3326 | 151 |
| 388 | 3300048091 | Ga0495626_0081388 | Ga0495626_0081388_143_610 | 151 |
| 389 | 3300048903 | Ga0496100_0000617 | Ga0496100_0000617_2829_3299 | 151 |
| 390 | 3300048904 | Ga0496101_0000987 | Ga0496101_0000987_2829_3299 | 151 |
| 391 | 3300048904 | Ga0496101_0033944 | Ga0496101_0033944_1711_2181 | 151 |
| 392 | 3300048905 | Ga0496102_0000165 | Ga0496102_0000165_74959_75429 | 151 |
| 393 | 3300048906 | Ga0496103_0000728 | Ga0496103_0000728_976_1446 | 151 |
| 394 | 3300048907 | Ga0496104_0425026 | Ga0496104_0425026_223_693 | 151 |
| 395 | 3300048907 | Ga0496104_1377212 | Ga0496104_1377212_46_516 | 151 |
| 396 | 3300048908 | Ga0496105_0933244 | Ga0496105_0933244_35_505 | 151 |
| 397 | 3300048909 | Ga0496106_0043212 | Ga0496106_0043212_1805_2275 | 151 |
| 398 | 3300048910 | Ga0496107_1016545 | Ga0496107_1016545_31_501 | 151 |
| 399 | 3300048915 | Ga0496112_0193458 | Ga0496112_0193458_587_1057 | 151 |
| 400 | 3300048919 | Ga0496116_0007050 | Ga0496116_0007050_1958_2434 | 151 |
| 401 | 3300048919 | Ga0496116_0042730 | Ga0496116_0042730_2048_2503 | 151 |
| 402 | 3300048919 | Ga0496116_0057197 | Ga0496116_0057197_745_1221 | 151 |
| 403 | 3300048919 | Ga0496116_0074697 | Ga0496116_0074697_171_641 | 151 |
| 404 | 3300048920 | Ga0496117_0001246 | Ga0496117_0001246_15348_15818 | 151 |
| 405 | 3300048920 | Ga0496117_0287960 | Ga0496117_0287960_47_502 | 151 |
| 406 | 3300048921 | Ga0496118_0000283 | Ga0496118_0000283_13791_14261 | 151 |
| 407 | 3300048921 | Ga0496118_0238760 | Ga0496118_0238760_252_707 | 151 |
| 408 | 3300048922 | Ga0496119_0000011 | Ga0496119_0000011_12102_12560 | 151 |
| 409 | 3300048922 | Ga0496119_0045652 | Ga0496119_0045652_360_830 | 151 |
| 410 | 3300048922 | Ga0496119_0194325 | Ga0496119_0194325_303_773 | 151 |
| 411 | 3300048923 | Ga0496120_0002123 | Ga0496120_0002123_11917_12375 | 151 |
| 412 | 3300048924 | Ga0496121_0001382 | Ga0496121_0001382_26918_27388 | 151 |
| 413 | 3300048924 | Ga0496121_0006825 | Ga0496121_0006825_702_1172 | 151 |
| 414 | 3300048924 | Ga0496121_0015295 | Ga0496121_0015295_548_1024 | 151 |
| 415 | 3300048925 | Ga0496122_0002013 | Ga0496122_0002013_14396_14872 | 151 |
| 416 | 3300048925 | Ga0496122_0045811 | Ga0496122_0045811_1558_2040 | 151 |
| 417 | 3300048925 | Ga0496122_0123247 | Ga0496122_0123247_779_1249 | 151 |
| 418 | 3300048926 | Ga0496123_0000493 | Ga0496123_0000493_16489_16965 | 151 |
| 419 | 3300048926 | Ga0496123_0052369 | Ga0496123_0052369_521_1003 | 151 |
| 420 | 3300048928 | Ga0496125_0024579 | Ga0496125_0024579_3638_4093 | 151 |
| 421 | 3300048929 | Ga0496126_0156201 | Ga0496126_0156201_1469_1939 | 151 |
| 422 | 3300049460 | Ga0495682_0231346 | Ga0495682_0231346_167_637 | 151 |
| 423 | 3300049568 | Ga0501031_0012439 | Ga0501031_0012439_719_1228 | 151 |
| 424 | 3300049568 | Ga0501031_0262202 | Ga0501031_0262202_186_674 | 151 |
| 425 | 3300049569 | Ga0501032_0022038 | Ga0501032_0022038_2295_2804 | 151 |
| 426 | 3300049569 | Ga0501032_0030996 | Ga0501032_0030996_608_1096 | 151 |
| 427 | 3300049569 | Ga0501032_0090851 | Ga0501032_0090851_1520_2014 | 151 |
| 428 | 3300049569 | Ga0501032_0124280 | Ga0501032_0124280_1122_1610 | 151 |
| 429 | 3300049569 | Ga0501032_0680491 | Ga0501032_0680491_66_539 | 151 |
| 430 | 3300049570 | Ga0501033_0000446 | Ga0501033_0000446_8749_9243 | 151 |
| 431 | 3300049570 | Ga0501033_0019827 | Ga0501033_0019827_767_1255 | 151 |
| 432 | 3300049570 | Ga0501033_0053457 | Ga0501033_0053457_1556_2023 | 151 |
| 433 | 3300049570 | Ga0501033_0083288 | Ga0501033_0083288_466_954 | 151 |
| 434 | 3300049570 | Ga0501033_0176588 | Ga0501033_0176588_716_1195 | 151 |
| 435 | 3300049570 | Ga0501033_0236737 | Ga0501033_0236737_620_1087 | 151 |
| 436 | 3300049571 | Ga0501034_0004324 | Ga0501034_0004324_14993_15466 | 151 |
| 437 | 3300049571 | Ga0501034_0375448 | Ga0501034_0375448_500_973 | 151 |
| 438 | 3300049571 | Ga0501034_0388659 | Ga0501034_0388659_312_800 | 151 |
| 439 | 3300049571 | Ga0501034_0520976 | Ga0501034_0520976_241_714 | 151 |
| 440 | 3300049571 | Ga0501034_0538518 | Ga0501034_0538518_32_517 | 151 |
| 441 | 3300049572 | Ga0501036_0005424 | Ga0501036_0005424_7153_7647 | 151 |
| 442 | 3300049572 | Ga0501036_0181086 | Ga0501036_0181086_865_1356 | 151 |
| 443 | 3300049572 | Ga0501036_0545303 | Ga0501036_0545303_296_769 | 151 |
| 444 | 3300049572 | Ga0501036_0803996 | Ga0501036_0803996_216_689 | 151 |
| 445 | 3300049573 | Ga0501037_0000179 | Ga0501037_0000179_51407_51901 | 151 |
| 446 | 3300049573 | Ga0501037_0001481 | Ga0501037_0001481_8112_8684 | 151 |
| 447 | 3300049573 | Ga0501037_0230112 | Ga0501037_0230112_117_611 | 151 |
| 448 | 3300049573 | Ga0501037_0430329 | Ga0501037_0430329_247_720 | 151 |
| 449 | 3300049574 | Ga0501038_0238033 | Ga0501038_0238033_653_1162 | 151 |
| 450 | 3300049574 | Ga0501038_0306094 | Ga0501038_0306094_361_828 | 151 |
| 451 | 3300049575 | Ga0501039_0001884 | Ga0501039_0001884_9483_9977 | 151 |
| 452 | 3300049575 | Ga0501039_0980498 | Ga0501039_0980498_96_569 | 151 |
| 453 | 3300049578 | Ga0501042_0011846 | Ga0501042_0011846_1581_2075 | 151 |
| 454 | 3300049579 | Ga0501043_0000005 | Ga0501043_0000005_94361_94870 | 151 |
| 455 | 3300049579 | Ga0501043_0005191 | Ga0501043_0005191_6876_7370 | 151 |
| 456 | 3300049579 | Ga0501043_0036224 | Ga0501043_0036224_2276_2755 | 151 |
| 457 | 3300049579 | Ga0501043_0200972 | Ga0501043_0200972_239_718 | 151 |
| 458 | 3300049579 | Ga0501043_0275677 | Ga0501043_0275677_18_509 | 151 |
| 459 | 3300049580 | Ga0501046_0000376 | Ga0501046_0000376_7682_8146 | 151 |
| 460 | 3300049580 | Ga0501046_0021898 | Ga0501046_0021898_474_968 | 151 |
| 461 | 3300049580 | Ga0501046_0910026 | Ga0501046_0910026_109_588 | 151 |
| 462 | 3300049581 | Ga0501047_0022956 | Ga0501047_0022956_1095_1586 | 151 |
| 463 | 3300049581 | Ga0501047_0088937 | Ga0501047_0088937_2174_2647 | 151 |
| 464 | 3300049581 | Ga0501047_0154601 | Ga0501047_0154601_686_1174 | 151 |
| 465 | 3300049581 | Ga0501047_0277327 | Ga0501047_0277327_996_1463 | 151 |
| 466 | 3300049581 | Ga0501047_0809349 | Ga0501047_0809349_208_681 | 151 |
| 467 | 3300049584 | Ga0501068_0047823 | Ga0501068_0047823_105_599 | 151 |
| 468 | 3300049584 | Ga0501068_0608383 | Ga0501068_0608383_20_529 | 151 |
| 469 | 3300049585 | Ga0501069_0000011 | Ga0501069_0000011_89672_90181 | 151 |
| 470 | 3300049585 | Ga0501069_0205867 | Ga0501069_0205867_25_498 | 151 |
| 471 | 3300049586 | Ga0501070_0001424 | Ga0501070_0001424_12355_12927 | 151 |
| 472 | 3300049586 | Ga0501070_0013988 | Ga0501070_0013988_4042_4530 | 151 |
| 473 | 3300049586 | Ga0501070_0032558 | Ga0501070_0032558_2923_3396 | 151 |
| 474 | 3300049586 | Ga0501070_0046609 | Ga0501070_0046609_3103_3576 | 151 |
| 475 | 3300049586 | Ga0501070_0047624 | Ga0501070_0047624_32_520 | 151 |
| 476 | 3300049586 | Ga0501070_0134414 | Ga0501070_0134414_639_1130 | 151 |
| 477 | 3300049586 | Ga0501070_0140286 | Ga0501070_0140286_983_1471 | 151 |
| 478 | 3300049586 | Ga0501070_1064001 | Ga0501070_1064001_120_614 | 151 |
| 479 | 3300049587 | Ga0501071_0059243 | Ga0501071_0059243_1822_2331 | 151 |
| 480 | 3300049589 | Ga0501073_0078435 | Ga0501073_0078435_476_1048 | 151 |
| 481 | 3300049590 | Ga0501074_0000336 | Ga0501074_0000336_8484_8993 | 151 |
| 482 | 3300049742 | Ga0501080_0001369 | Ga0501080_0001369_8217_8789 | 151 |
| 483 | 3300049742 | Ga0501080_0904887 | Ga0501080_0904887_242_736 | 151 |
| 484 | 3300049744 | Ga0501083_0000805 | Ga0501083_0000805_8554_9063 | 151 |
| 485 | 3300049822 | Ga0501035_0000107 | Ga0501035_0000107_90569_91078 | 151 |
| 486 | 3300049822 | Ga0501035_0007869 | Ga0501035_0007869_6624_7118 | 151 |
| 487 | 3300049822 | Ga0501035_0013853 | Ga0501035_0013853_2668_3144 | 151 |
| 488 | 3300049822 | Ga0501035_0015836 | Ga0501035_0015836_4818_5306 | 151 |
| 489 | 3300049822 | Ga0501035_0060690 | Ga0501035_0060690_637_1125 | 151 |
| 490 | 3300049822 | Ga0501035_0062852 | Ga0501035_0062852_2401_2889 | 151 |
| 491 | 3300049822 | Ga0501035_0107961 | Ga0501035_0107961_231_704 | 151 |
| 492 | 3300049822 | Ga0501035_0115867 | Ga0501035_0115867_1473_1964 | 151 |
| 493 | 3300049822 | Ga0501035_0206022 | Ga0501035_0206022_323_790 | 151 |
| 494 | 3300049822 | Ga0501035_0268985 | Ga0501035_0268985_662_1135 | 151 |
| 495 | 3300049822 | Ga0501035_1005676 | Ga0501035_1005676_145_618 | 151 |
| 496 | 3300049823 | Ga0501044_0000077 | Ga0501044_0000077_43137_43625 | 151 |
| 497 | 3300049823 | Ga0501044_0000154 | Ga0501044_0000154_14878_15450 | 151 |
| 498 | 3300049823 | Ga0501044_0005777 | Ga0501044_0005777_2927_3421 | 151 |
| 499 | 3300049823 | Ga0501044_0009552 | Ga0501044_0009552_4722_5192 | 151 |
| 500 | 3300049823 | Ga0501044_0064444 | Ga0501044_0064444_357_830 | 151 |
| 501 | 3300049823 | Ga0501044_0101420 | Ga0501044_0101420_1771_2262 | 151 |
| 502 | 3300049823 | Ga0501044_0157858 | Ga0501044_0157858_206_679 | 151 |
| 503 | 3300049823 | Ga0501044_0366195 | Ga0501044_0366195_816_1292 | 151 |
| 504 | 3300049823 | Ga0501044_0366330 | Ga0501044_0366330_846_1334 | 151 |
| 505 | 3300049823 | Ga0501044_0564691 | Ga0501044_0564691_180_668 | 151 |
| 506 | 3300049823 | Ga0501044_0756750 | Ga0501044_0756750_169_654 | 151 |
| 507 | 3300049823 | Ga0501044_0835310 | Ga0501044_0835310_231_701 | 151 |
| 508 | 3300049823 | Ga0501044_1364424 | Ga0501044_1364424_80_553 | 151 |
| 509 | 3300060353 | Ga0501082_0015310 | Ga0501082_0015310_1811_2320 | 151 |
| 510 | 3300060353 | Ga0501082_0215324 | Ga0501082_0215324_975_1448 | 151 |
| 511 | 3300060353 | Ga0501082_0380269 | Ga0501082_0380269_157_630 | 151 |
| 512 | 3300061719 | Ga0466962_0011043 | Ga0466962_0011043_390_845 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vpc-assembly1.cif.gz_F | structure of the spcas9 dna adenine base editor - abe8e | 0.9764 | 2 | 103 |
| 2b3j-assembly2.cif.gz_D | crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna | 0.9761 | 2 | 102 |
| 3v0f-assembly2.cif.gz_B | crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 241-576(c363s), form ii | 0.9732 | 25 | 39 |
| 1wwr-assembly1.cif.gz_A | crystal structure of trna adenosine deaminase tada from aquifex aeolicus | 0.9721 | 1 | 102 |
| 8e2q-assembly2.cif.gz_C | crystal structure of tadac-1.17 in a complex with ssdna | 0.9708 | 1 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2b3jA00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9771 | 5 | 102 | 3.40.140.10 |
| 1wwrD00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9729 | 1 | 102 | 3.40.140.10 |
| af_K7K815_1119_1301_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9706 | 3 | 104 | 3.40.140.10 |
| 1z3aA00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9703 | 1 | 102 | 3.40.140.10 |
| 2nx8A00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9636 | 5 | 102 | 3.40.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B0LWC0-F1-model_v4 | tRNA(adenine(34)) deaminase (EC 3.5.4.33) | 0.9943 | 1 | 113 |
GO:0002100
GO:0006152 GO:0008892 GO:0047974 GO:0052717 |
| AF-A0A533YHZ7-F1-model_v4 | tRNA-specific adenosine deaminase (EC 3.5.4.33) | 0.9867 | 5 | 102 |
GO:0002100
GO:0008270 GO:0052717 |
| AF-A0A1K1XT98-F1-model_v4 | deleted | 0.9862 | 5 | 102 |
|
| AF-A0A3B0LWC0-F1-model_v4 | tRNA(adenine(34)) deaminase (EC 3.5.4.33) | 0.9857 | 1 | 113 |
GO:0002100
GO:0006152 GO:0008892 GO:0047974 GO:0052717 |
| AF-A0A2V2EFH9-F1-model_v4 | deleted | 0.9855 | 3 | 102 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar