F457463

General Info

Members Datasets Scaffolds Average Seq Length
512 247 495 157

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0006325|Ga0466967_0006325_864_1373
Length 169
Sequence MLSGGAQGAILSKPEDYLALAVQLALDNVLIRKGRPFGALLVKDGQIVASAVNNVLASHDPTAHAELEAIRLAARAQQNPRLDGHVMYASGHPCPMCLAAMYLVGIPQVYYAYSNEDGEPVGLSTSSLYAELTKPLSMQAMQLEHRPVRPAGMDLYEAWKRLNDDPPKE

Samples

Sample ID Description Type Environment
1 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
2 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
3 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
4 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
5 2643221734 Bosea sp. Root670 Isolate Unclassified
6 2643221736 Bosea sp. Root483D1 Isolate Unclassified
7 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
8 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
9 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
10 2928058823 Ralstonia sp. 1138 Isolate Unclassified
11 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
12 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
13 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
14 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
41 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
144 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
145 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
146 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
147 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
148 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
152 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
165 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
246 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
247 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 0.2
Isolates 3.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.85
Nodule 0.98
Rhizoplane 2.34
Rhizosphere 65.82
Stem 0
Stem Tuber 0
Unclassified 8.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000165 3300001979 Bacteria 26307
2 JGI25162J39368_1000111 3300002737 Bacteria 89317
3 JGI25154J39366_1000536 3300002738 Bacteria 18958
4 JGI25159J45721_1006237 3300002987 Bacteria 3603
5 JGI25151J46595_10000846 3300003187 Bacteria 24391
6 JGI25151J46595_10001459 3300003187 Bacteria 16043
7 JGI25151J46595_10015852 3300003187 Bacteria 3309
8 JGI25151J46595_10021024 3300003187 Bacteria 2738
9 JGI25165J46597_1001440 3300003214 Bacteria 12658
10 JGI25165J46597_1035630 3300003214 Bacteria 640
11 JGI25153J46596_10056366 3300003215 Bacteria 1094
12 rootL2_10174794 3300003322 Bacteria 3022
13 rootH1_10242536 3300003323 Bacteria 3288
14 Ga0055538_1002615 3300003751 Bacteria 2565
15 Ga0055539_1000201 3300003752 Bacteria 47514
16 Ga0055533_1000937 3300003756 Bacteria 8647
17 Ga0055532_1000073 3300003758 Bacteria 131021
18 Ga0055525_1000366 3300003759 Bacteria 30305
19 Ga0055525_1005504 3300003759 Bacteria 1075
20 Ga0055535_1000055 3300003761 Bacteria 131021
21 Ga0055542_1000721 3300003762 Bacteria 25885
22 Ga0055529_1000149 3300003763 Bacteria 100620
23 Ga0055526_1003295 3300003771 Bacteria 10350
24 Ga0055526_1004820 3300003771 Bacteria 7973
25 Ga0055526_1022147 3300003771 Bacteria 2176
26 Ga0055526_1024545 3300003771 Bacteria 1967
27 Ga0055526_1027604 3300003771 Bacteria 1748
28 Ga0055537_1000057 3300003773 Bacteria 81507
29 Ga0055524_1000066 3300003775 Bacteria 131691
30 Ga0055524_1015029 3300003775 Bacteria 2840
31 Ga0055524_1018659 3300003775 Bacteria 2400
32 Ga0055524_1022085 3300003775 Bacteria 2089
33 Ga0055536_1000339 3300003781 Bacteria 34551
34 Ga0055536_1007488 3300003781 Bacteria 4871
35 Ga0055536_1010363 3300003781 Bacteria 3712
36 Ga0055536_1084748 3300003781 Bacteria 594
37 Ga0055534_1000175 3300003784 Bacteria 47703
38 Ga0055534_1000247 3300003784 Bacteria 38231
39 Ga0055534_1002727 3300003784 Bacteria 5942
40 Ga0055528_1000023 3300003790 Bacteria 131856
41 Ga0055530_10004258 3300003791 Bacteria 7490
42 Ga0055531_10009885 3300003794 Bacteria 4824
43 Ga0055531_10023298 3300003794 Bacteria 2328
44 Ga0055531_10023925 3300003794 Bacteria 2272
45 Ga0055531_10041843 3300003794 Bacteria 1320
46 Ga0055541_1000336 3300003841 Bacteria 14777
47 Ga0055541_1008961 3300003841 Bacteria 1570
48 Ga0055543_1072670 3300004625 Bacteria 538
49 Ga0065165_1000119 3300005262 Bacteria 134464
50 Ga0065165_1000545 3300005262 Bacteria 56973
51 Ga0065165_1097193 3300005262 Bacteria 742
52 Ga0070680_100268598 3300005336 Bacteria 1444
53 Ga0070680_100349743 3300005336 Bacteria 1257
54 Ga0070682_100014762 3300005337 Bacteria 4518
55 Ga0070661_100000061 3300005344 Bacteria 86581
56 Ga0070659_100002481 3300005366 Bacteria 13107
57 Ga0070659_100170551 3300005366 Bacteria 1782
58 Ga0070714_100553614 3300005435 Bacteria 1101
59 Ga0070663_100000009 3300005455 Bacteria 187718
60 Ga0070663_100013889 3300005455 Bacteria 5152
61 Ga0070663_100068421 3300005455 Bacteria 2578
62 Ga0070663_100144834 3300005455 Bacteria 1817
63 Ga0070663_100279202 3300005455 Bacteria 1331
64 Ga0070681_10067174 3300005458 Bacteria 3554
65 Ga0070681_10321866 3300005458 Bacteria 1456
66 Ga0070679_100035873 3300005530 Bacteria 4920
67 Ga0070684_100017185 3300005535 Bacteria 5930
68 Ga0068853_100013529 3300005539 Bacteria 6666
69 Ga0068855_100752393 3300005563 Bacteria 1039
70 Ga0070664_100000010 3300005564 Bacteria 165664
71 Ga0068857_101052441 3300005577 Bacteria 784
72 Ga0068854_100028644 3300005578 Bacteria 3851
73 Ga0068856_100000045 3300005614 Bacteria 110625
74 Ga0068852_100231301 3300005616 Bacteria 1762
75 Ga0075428_100003085 3300006844 Bacteria 18177
76 Ga0075430_100281184 3300006846 Bacteria 1377
77 Ga0075431_100026710 3300006847 Bacteria 5921
78 Ga0075429_100008248 3300006880 Bacteria 9058
79 Ga0105251_10032244 3300009011 Bacteria 2613
80 Ga0105251_10159556 3300009011 Bacteria 1017
81 Ga0105240_10000739 3300009093 Bacteria 59740
82 Ga0105240_10120343 3300009093 Bacteria 3162
83 Ga0105240_10139498 3300009093 Bacteria 2899
84 Ga0105240_10336432 3300009093 Bacteria 1716
85 Ga0114129_10018969 3300009147 Bacteria 9798
86 Ga0105241_10221252 3300009174 Bacteria 1591
87 Ga0105237_10002121 3300009545 Bacteria 25037
88 Ga0105238_10004352 3300009551 Bacteria 14054
89 Ga0105238_10061034 3300009551 Bacteria 3774
90 Ga0105239_10000454 3300010375 Bacteria 59740
91 Ga0157327_1006626 3300012512 Bacteria 981
92 Ga0157373_10004941 3300013100 Bacteria 10027
93 Ga0157373_10018501 3300013100 Bacteria 5072
94 Ga0157371_10000088 3300013102 Bacteria 145526
95 Ga0157371_10017730 3300013102 Bacteria 5283
96 Ga0157371_10705839 3300013102 Bacteria 755
97 Ga0157370_10000041 3300013104 Bacteria 133912
98 Ga0157370_10008961 3300013104 Bacteria 10742
99 Ga0157370_10495702 3300013104 Bacteria 1122
100 Ga0157370_10660278 3300013104 Bacteria 955
101 Ga0157369_10265362 3300013105 Bacteria 1790
102 Ga0157369_10435994 3300013105 Bacteria 1357
103 Ga0171462_1015 3300013250 Bacteria 169578
104 Ga0157372_10000097 3300013307 Bacteria 90742
105 Ga0157372_10171824 3300013307 Bacteria 2508
106 Ga0182008_10022898 3300014497 Bacteria 3197
107 Ga0182006_1003196 3300015261 Bacteria 8528
108 Ga0182006_1016828 3300015261 Bacteria 3116
109 Ga0182007_10002998 3300015262 Bacteria 8175
110 Ga0183360_10001 3300015689 Bacteria 3943671
111 Ga0197907_10007993 3300020069 Bacteria 783
112 Ga0209760_100795 3300025207 Bacteria 4333
113 Ga0209784_100008 3300025224 Bacteria 740293
114 Ga0209784_100262 3300025224 Bacteria 31953
115 Ga0209566_100006 3300025225 Bacteria 789272
116 Ga0209566_100407 3300025225 Bacteria 34223
117 Ga0209566_100636 3300025225 Bacteria 21451
118 Ga0209674_100045 3300025226 Bacteria 362387
119 Ga0209674_100114 3300025226 Bacteria 139197
120 Ga0209147_100005 3300025229 Bacteria 1036530
121 Ga0209563_100016 3300025230 Bacteria 802091
122 Ga0209563_111699 3300025230 Bacteria 1230
123 Ga0209437_100064 3300025233 Bacteria 334360
124 Ga0209258_100007 3300025242 Bacteria 1036530
125 Ga0209646_1000027 3300025246 Bacteria 395141
126 Ga0209026_1003785 3300025250 Bacteria 4791
127 Ga0209677_100008 3300025253 Bacteria 802091
128 Ga0209677_105391 3300025253 Bacteria 3349
129 Ga0209148_1000019 3300025254 Bacteria 748518
130 Ga0209759_1004768 3300025256 Bacteria 4956
131 Ga0209759_1045859 3300025256 Bacteria 711
132 Ga0209233_1000081 3300025261 Bacteria 336832
133 Ga0209233_1004045 3300025261 Bacteria 5074
134 Ga0209565_1000005 3300025263 Bacteria 947317
135 Ga0209565_1000094 3300025263 Bacteria 134853
136 Ga0209455_1000011 3300025272 Bacteria 947242
137 Ga0209673_1000027 3300025273 Bacteria 360561
138 Ga0209673_1007856 3300025273 Bacteria 4831
139 Ga0209673_1007992 3300025273 Bacteria 4770
140 Ga0209130_1000244 3300025284 Bacteria 68915
141 Ga0209130_1000702 3300025284 Bacteria 29997
142 Ga0209130_1015852 3300025284 Bacteria 1843
143 Ga0209675_1000004 3300025291 Bacteria 947166
144 Ga0209675_1000079 3300025291 Bacteria 155554
145 Ga0209675_1002258 3300025291 Bacteria 10059
146 Ga0209675_1010617 3300025291 Bacteria 3127
147 Ga0209675_1021220 3300025291 Bacteria 1736
148 Ga0209676_1000176 3300025292 Bacteria 152347
149 Ga0209676_1001097 3300025292 Bacteria 30146
150 Ga0209676_1005557 3300025292 Bacteria 6527
151 Ga0209676_1006363 3300025292 Bacteria 5852
152 Ga0209676_1030419 3300025292 Bacteria 1651
153 Ga0209676_1039738 3300025292 Bacteria 1333
154 Ga0209676_1040147 3300025292 Bacteria 1321
155 Ga0209025_1000046 3300025294 Bacteria 348962
156 Ga0209025_1000224 3300025294 Bacteria 133328
157 Ga0209025_1002162 3300025294 Bacteria 21902
158 Ga0209025_1007268 3300025294 Bacteria 8321
159 Ga0209025_1015187 3300025294 Bacteria 4667
160 Ga0209025_1077870 3300025294 Unclassified 1141
161 Ga0209564_1000050 3300025295 Bacteria 360560
162 Ga0209564_1000166 3300025295 Bacteria 160208
163 Ga0209564_1000308 3300025295 Bacteria 96489
164 Ga0209564_1000509 3300025295 Bacteria 63951
165 Ga0209564_1005648 3300025295 Bacteria 7026
166 Ga0209564_1047058 3300025295 Bacteria 1091
167 Ga0209758_1002177 3300025297 Bacteria 20570
168 Ga0209050_1001060 3300025298 Bacteria 33818
169 Ga0209050_1006506 3300025298 Bacteria 6888
170 Ga0209050_1046019 3300025298 Bacteria 1150
171 Ga0209256_1000031 3300025299 Bacteria 410189
172 Ga0209256_1000960 3300025299 Bacteria 34857
173 Ga0209256_1001956 3300025299 Bacteria 18677
174 Ga0209256_1008858 3300025299 Bacteria 4549
175 Ga0209256_1008871 3300025299 Bacteria 4545
176 Ga0207426_1000151 3300025302 Bacteria 185103
177 Ga0207426_1000215 3300025302 Bacteria 136757
178 Ga0207426_1035838 3300025302 Bacteria 1581
179 Ga0207426_1079226 3300025302 Bacteria 895
180 Ga0209051_1070857 3300025303 Bacteria 1050
181 Ga0209257_1000255 3300025304 Bacteria 123098
182 Ga0209257_1000283 3300025304 Bacteria 113507
183 Ga0209257_1006338 3300025304 Bacteria 7690
184 Ga0209257_1007543 3300025304 Bacteria 6532
185 Ga0209257_1035848 3300025304 Bacteria 1530
186 Ga0207696_1007558 3300025711 Bacteria 4240
187 Ga0207655_1014101 3300025728 Bacteria 4539
188 Ga0207713_1020832 3300025735 Bacteria 3162
189 Ga0207705_10977475 3300025909 Bacteria 654
190 Ga0207654_11179577 3300025911 Bacteria 558
191 Ga0207707_10094144 3300025912 Bacteria 2617
192 Ga0207695_10000788 3300025913 Bacteria 59670
193 Ga0207695_10006520 3300025913 Bacteria 15107
194 Ga0207695_10296570 3300025913 Bacteria 1508
195 Ga0207695_10565390 3300025913 Bacteria 1018
196 Ga0207671_10000411 3300025914 Bacteria 59718
197 Ga0207671_10137651 3300025914 Bacteria 1879
198 Ga0207649_10000605 3300025920 Bacteria 24240
199 Ga0207652_10049707 3300025921 Bacteria 3591
200 Ga0207652_10974597 3300025921 Bacteria 746
201 Ga0207694_10118163 3300025924 Bacteria 2115
202 Ga0207664_10154990 3300025929 Bacteria 1949
203 Ga0207690_10063206 3300025932 Bacteria 2523
204 Ga0207690_10137932 3300025932 Bacteria 1793
205 Ga0207661_10000109 3300025944 Bacteria 52179
206 Ga0207679_10000002 3300025945 Bacteria 634491
207 Ga0207640_10009624 3300025981 Bacteria 5419
208 Ga0207639_10002690 3300026041 Bacteria 11929
209 Ga0207678_10000018 3300026067 Bacteria 135549
210 Ga0207678_10045408 3300026067 Bacteria 3799
211 Ga0207678_10078794 3300026067 Bacteria 2822
212 Ga0207702_10000053 3300026078 Bacteria 137538
213 Ga0207674_10001653 3300026116 Bacteria 28692
214 Ga0207698_11607399 3300026142 Bacteria 665
215 Ga0209371_1000006 3300027312 Bacteria 1055642
216 Ga0209282_1000019 3300027666 Bacteria 184034
217 Ga0268265_10176603 3300028380 Bacteria 1831
218 Ga0307515_10000029 3300028794 Bacteria 365410
219 Ga0307515_10009918 3300028794 Bacteria 18339
220 Ga0268256_1000007 3300030500 Bacteria 1055326
221 Ga0307513_10010270 3300031456 Bacteria 11754
222 Ga0307406_10297576 3300031901 Bacteria 1238
223 Ga0307406_10619919 3300031901 Bacteria 894
224 Ga0395899_0002516 3300037312 Bacteria 14851
225 Ga0395899_0008931 3300037312 Bacteria 7714
226 Ga0395899_0139154 3300037312 Bacteria 1728
227 Ga0395899_0176000 3300037312 Bacteria 1504
228 Ga0395899_0212784 3300037312 Bacteria 1342
229 Ga0395899_0326895 3300037312 Bacteria 1031
230 Ga0395899_0334003 3300037312 Bacteria 1018
231 Ga0395900_0000006 3300037418 Bacteria 495364
232 Ga0395900_0005617 3300037418 Bacteria 13113
233 Ga0395900_0054526 3300037418 Bacteria 4116
234 Ga0395900_0118521 3300037418 Bacteria 2716
235 Ga0395900_0171384 3300037418 Bacteria 2209
236 Ga0395900_0542173 3300037418 Bacteria 1109
237 Ga0395898_0012851 3300037466 Bacteria 8637
238 Ga0395898_0098108 3300037466 Bacteria 2813
239 Ga0395898_0114289 3300037466 Bacteria 2586
240 Ga0395898_0141682 3300037466 Bacteria 2302
241 Ga0395898_0206248 3300037466 Bacteria 1875
242 Ga0395898_0432874 3300037466 Bacteria 1253
243 Ga0395898_0763789 3300037466 Bacteria 908
244 Ga0395905_0034107 3300037471 Bacteria 4778
245 Ga0395905_0147200 3300037471 Bacteria 2216
246 Ga0395901_0000001 3300038443 Bacteria 800383
247 Ga0395901_0035004 3300038443 Bacteria 5189
248 Ga0395901_0037019 3300038443 Bacteria 5046
249 Ga0395901_0290340 3300038443 Bacteria 1697
250 Ga0395901_0397832 3300038443 Bacteria 1415
251 Ga0395901_0843535 3300038443 Bacteria 902
252 Ga0395901_1811127 3300038443 Bacteria 559
253 Ga0439439_0121575 3300041406 Bacteria 728
254 Ga0439465_0005898 3300041413 Bacteria 3895
255 Ga0439432_017466 3300042006 Bacteria 2407
256 Ga0439449_0013888 3300042007 Bacteria 3028
257 Ga0439452_017109 3300042010 Bacteria 1957
258 Ga0450904_000366 3300042139 Bacteria 9499
259 Ga0466969_0008077 3300044656 Bacteria 5589
260 Ga0466972_0001290 3300044658 Bacteria 12101
261 Ga0466978_0006655 3300044671 Bacteria 5915
262 Ga0466982_0094720 3300044672 Bacteria 1850
263 Ga0466965_0002975 3300044683 Bacteria 7344
264 Ga0466961_0000200 3300044693 Bacteria 40374
265 Ga0466963_0021800 3300044694 Bacteria 4047
266 Ga0466964_0178833 3300044706 Bacteria 1004
267 Ga0466971_0038113 3300044719 Bacteria 2156
268 Ga0466968_0016833 3300044735 Bacteria 2914
269 Ga0466970_0001061 3300044765 Bacteria 13303
270 Ga0466960_0085652 3300044901 Bacteria 1596
271 Ga0466959_0000415 3300045049 Bacteria 24900
272 Ga0466958_0335632 3300045836 Bacteria 972
273 Ga0466967_0006325 3300045976 Bacteria 8362
274 Ga0495627_013868 3300046453 Bacteria 2828
275 Ga0495591_081478 3300046458 Bacteria 824
276 Ga0495580_0315167 3300046472 Bacteria 1063
277 Ga0495580_0735408 3300046472 Bacteria 643
278 Ga0495605_0003211 3300046474 Bacteria 9805
279 Ga0495605_0032403 3300046474 Bacteria 2660
280 Ga0495584_0159253 3300046491 Bacteria 1147
281 Ga0495584_0179618 3300046491 Bacteria 1076
282 Ga0495596_0000086 3300046500 Bacteria 64736
283 Ga0495607_0017794 3300046501 Bacteria 4550
284 Ga0495607_0104383 3300046501 Bacteria 1512
285 Ga0495583_0005337 3300046506 Bacteria 8766
286 Ga0495610_0000221 3300046512 Bacteria 61150
287 Ga0495610_0011438 3300046512 Bacteria 5426
288 Ga0495616_0007103 3300046513 Bacteria 6725
289 Ga0495616_0046048 3300046513 Bacteria 2204
290 Ga0495632_0012840 3300046519 Bacteria 4805
291 Ga0495643_0008500 3300046522 Bacteria 6492
292 Ga0495648_0101533 3300046524 Bacteria 1586
293 Ga0495648_0175328 3300046524 Bacteria 1095
294 Ga0495663_0003532 3300046525 Bacteria 4501
295 Ga0495654_0020142 3300046530 Bacteria 3479
296 Ga0495665_0083648 3300046531 Bacteria 1678
297 Ga0495609_0004101 3300046538 Bacteria 8104
298 Ga0495597_0000065 3300046542 Bacteria 90745
299 Ga0495597_0075972 3300046542 Bacteria 1441
300 Ga0495622_0091789 3300046557 Bacteria 1395
301 Ga0495633_0040885 3300046558 Bacteria 2207
302 Ga0495661_0021165 3300046665 Bacteria 4242
303 Ga0495661_0070625 3300046665 Bacteria 2043
304 Ga0495670_0051545 3300046691 Bacteria 2060
305 Ga0495671_0003443 3300046692 Bacteria 9716
306 Ga0495671_0112300 3300046692 Bacteria 1331
307 Ga0495649_0022167 3300046694 Bacteria 3554
308 Ga0495589_0015514 3300046794 Bacteria 3919
309 Ga0495674_0000977 3300047319 Bacteria 27450
310 Ga0495672_0005503 3300047320 Bacteria 10034
311 Ga0495672_0101382 3300047320 Bacteria 1560
312 Ga0495683_0195698 3300047323 Bacteria 914
313 Ga0495687_041758 3300047443 Bacteria 2009
314 Ga0495673_0069340 3300047469 Bacteria 1487
315 Ga0495681_0010942 3300047470 Bacteria 5448
316 Ga0495626_0081388 3300048091 Bacteria 1438
317 Ga0496100_0000617 3300048903 Bacteria 16844
318 Ga0496101_0000987 3300048904 Bacteria 16825
319 Ga0496101_0033944 3300048904 Bacteria 3602
320 Ga0496102_0000165 3300048905 Bacteria 89141
321 Ga0496103_0000728 3300048906 Bacteria 24278
322 Ga0496104_0425026 3300048907 Bacteria 1240
323 Ga0496104_1377212 3300048907 Bacteria 608
324 Ga0496105_0933244 3300048908 Bacteria 652
325 Ga0496106_0043212 3300048909 Bacteria 3381
326 Ga0496107_1016545 3300048910 Bacteria 601
327 Ga0496112_0193458 3300048915 Bacteria 1995
328 Ga0496114_0200421 3300048917 Bacteria 1748
329 Ga0496116_0007050 3300048919 Bacteria 10064
330 Ga0496116_0042730 3300048919 Bacteria 3095
331 Ga0496116_0057197 3300048919 Bacteria 2551
332 Ga0496116_0074697 3300048919 Bacteria 2131
333 Ga0496117_0001246 3300048920 Bacteria 38001
334 Ga0496117_0287960 3300048920 Bacteria 876
335 Ga0496118_0000283 3300048921 Bacteria 89206
336 Ga0496118_0238760 3300048921 Bacteria 1042
337 Ga0496119_0000011 3300048922 Bacteria 438315
338 Ga0496119_0045652 3300048922 Bacteria 2744
339 Ga0496119_0194325 3300048922 Bacteria 1055
340 Ga0496120_0002123 3300048923 Bacteria 21185
341 Ga0496121_0001382 3300048924 Bacteria 41101
342 Ga0496121_0006825 3300048924 Bacteria 13967
343 Ga0496121_0010364 3300048924 Bacteria 10527
344 Ga0496121_0015295 3300048924 Bacteria 8057
345 Ga0496122_0002013 3300048925 Bacteria 30221
346 Ga0496122_0045811 3300048925 Bacteria 3394
347 Ga0496122_0123247 3300048925 Bacteria 1666
348 Ga0496123_0000493 3300048926 Bacteria 68308
349 Ga0496123_0052369 3300048926 Bacteria 2709
350 Ga0496125_0024579 3300048928 Bacteria 5537
351 Ga0496126_0156201 3300048929 Bacteria 1952
352 Ga0495682_0231346 3300049460 Bacteria 654
353 Ga0501031_0012439 3300049568 Bacteria 5552
354 Ga0501031_0172932 3300049568 Bacteria 1411
355 Ga0501031_0262202 3300049568 Bacteria 1123
356 Ga0501032_0022038 3300049569 Bacteria 4422
357 Ga0501032_0030996 3300049569 Bacteria 3668
358 Ga0501032_0044529 3300049569 Bacteria 3003
359 Ga0501032_0090851 3300049569 Bacteria 2026
360 Ga0501032_0124280 3300049569 Bacteria 1705
361 Ga0501032_0199542 3300049569 Bacteria 1306
362 Ga0501032_0278274 3300049569 Bacteria 1083
363 Ga0501032_0680491 3300049569 Bacteria 653
364 Ga0501033_0000446 3300049570 Bacteria 39481
365 Ga0501033_0019827 3300049570 Bacteria 5083
366 Ga0501033_0022737 3300049570 Bacteria 4727
367 Ga0501033_0029784 3300049570 Bacteria 4102
368 Ga0501033_0048131 3300049570 Bacteria 3167
369 Ga0501033_0053457 3300049570 Bacteria 2991
370 Ga0501033_0083288 3300049570 Bacteria 2345
371 Ga0501033_0126924 3300049570 Bacteria 1849
372 Ga0501033_0176588 3300049570 Bacteria 1532
373 Ga0501033_0236737 3300049570 Bacteria 1296
374 Ga0501034_0004324 3300049571 Bacteria 15844
375 Ga0501034_0185096 3300049571 Bacteria 2047
376 Ga0501034_0318546 3300049571 Bacteria 1488
377 Ga0501034_0375448 3300049571 Bacteria 1347
378 Ga0501034_0388659 3300049571 Bacteria 1319
379 Ga0501034_0399774 3300049571 Bacteria 1297
380 Ga0501034_0520976 3300049571 Bacteria 1101
381 Ga0501034_0538518 3300049571 Bacteria 1078
382 Ga0501034_0544357 3300049571 Bacteria 1071
383 Ga0501034_0662850 3300049571 Bacteria 944
384 Ga0501036_0005424 3300049572 Bacteria 10334
385 Ga0501036_0029074 3300049572 Bacteria 4672
386 Ga0501036_0095573 3300049572 Bacteria 2512
387 Ga0501036_0181086 3300049572 Bacteria 1774
388 Ga0501036_0216566 3300049572 Bacteria 1608
389 Ga0501036_0545303 3300049572 Bacteria 964
390 Ga0501036_0803996 3300049572 Bacteria 774
391 Ga0501037_0000179 3300049573 Bacteria 58767
392 Ga0501037_0001481 3300049573 Bacteria 17182
393 Ga0501037_0058510 3300049573 Bacteria 2812
394 Ga0501037_0107945 3300049573 Bacteria 2006
395 Ga0501037_0230112 3300049573 Bacteria 1302
396 Ga0501037_0242597 3300049573 Bacteria 1263
397 Ga0501037_0423386 3300049573 Bacteria 911
398 Ga0501037_0430329 3300049573 Bacteria 902
399 Ga0501038_0008730 3300049574 Bacteria 9300
400 Ga0501038_0016736 3300049574 Bacteria 6642
401 Ga0501038_0080825 3300049574 Bacteria 2739
402 Ga0501038_0174718 3300049574 Bacteria 1737
403 Ga0501038_0238033 3300049574 Bacteria 1446
404 Ga0501038_0306094 3300049574 Bacteria 1246
405 Ga0501039_0001884 3300049575 Bacteria 15509
406 Ga0501039_0105688 3300049575 Bacteria 2198
407 Ga0501039_0980498 3300049575 Bacteria 657
408 Ga0501042_0011846 3300049578 Bacteria 5889
409 Ga0501042_0168464 3300049578 Bacteria 1581
410 Ga0501043_0000005 3300049579 Bacteria 254466
411 Ga0501043_0005191 3300049579 Bacteria 10540
412 Ga0501043_0007432 3300049579 Bacteria 8698
413 Ga0501043_0036224 3300049579 Bacteria 3881
414 Ga0501043_0043005 3300049579 Bacteria 3551
415 Ga0501043_0122225 3300049579 Bacteria 2042
416 Ga0501043_0200972 3300049579 Bacteria 1547
417 Ga0501043_0275677 3300049579 Bacteria 1290
418 Ga0501043_0285858 3300049579 Bacteria 1263
419 Ga0501043_0539030 3300049579 Bacteria 868
420 Ga0501046_0000376 3300049580 Bacteria 45083
421 Ga0501046_0021898 3300049580 Bacteria 5269
422 Ga0501046_0071918 3300049580 Bacteria 2686
423 Ga0501046_0246319 3300049580 Bacteria 1317
424 Ga0501046_0354414 3300049580 Bacteria 1065
425 Ga0501046_0704145 3300049580 Bacteria 711
426 Ga0501046_0910026 3300049580 Bacteria 613
427 Ga0501047_0022956 3300049581 Bacteria 5989
428 Ga0501047_0055387 3300049581 Bacteria 3835
429 Ga0501047_0070774 3300049581 Bacteria 3358
430 Ga0501047_0074428 3300049581 Bacteria 3270
431 Ga0501047_0088937 3300049581 Bacteria 2966
432 Ga0501047_0121847 3300049581 Bacteria 2489
433 Ga0501047_0154601 3300049581 Bacteria 2168
434 Ga0501047_0170493 3300049581 Bacteria 2045
435 Ga0501047_0277327 3300049581 Bacteria 1522
436 Ga0501047_0809349 3300049581 Bacteria 752
437 Ga0501048_0168532 3300049582 Bacteria 1551
438 Ga0501048_0408100 3300049582 Bacteria 971
439 Ga0501068_0047823 3300049584 Bacteria 2581
440 Ga0501068_0608383 3300049584 Bacteria 712
441 Ga0501069_0000011 3300049585 Bacteria 153214
442 Ga0501069_0205867 3300049585 Bacteria 1141
443 Ga0501070_0001424 3300049586 Bacteria 21419
444 Ga0501070_0013988 3300049586 Bacteria 6756
445 Ga0501070_0032558 3300049586 Bacteria 4363
446 Ga0501070_0046609 3300049586 Bacteria 3604
447 Ga0501070_0047624 3300049586 Bacteria 3562
448 Ga0501070_0059996 3300049586 Bacteria 3153
449 Ga0501070_0134414 3300049586 Bacteria 2042
450 Ga0501070_0140286 3300049586 Bacteria 1995
451 Ga0501070_1064001 3300049586 Bacteria 625
452 Ga0501071_0059243 3300049587 Bacteria 2770
453 Ga0501073_0078435 3300049589 Bacteria 2298
454 Ga0501074_0000336 3300049590 Bacteria 27389
455 Ga0501080_0001369 3300049742 Bacteria 20402
456 Ga0501080_0904887 3300049742 Bacteria 769
457 Ga0501081_0114796 3300049743 Bacteria 1914
458 Ga0501083_0000805 3300049744 Bacteria 20562
459 Ga0501035_0000107 3300049822 Bacteria 103130
460 Ga0501035_0007869 3300049822 Bacteria 9961
461 Ga0501035_0013853 3300049822 Bacteria 7443
462 Ga0501035_0015836 3300049822 Bacteria 6958
463 Ga0501035_0039263 3300049822 Bacteria 4284
464 Ga0501035_0060690 3300049822 Bacteria 3366
465 Ga0501035_0062852 3300049822 Bacteria 3303
466 Ga0501035_0063985 3300049822 Bacteria 3270
467 Ga0501035_0107961 3300049822 Bacteria 2440
468 Ga0501035_0115867 3300049822 Bacteria 2345
469 Ga0501035_0206022 3300049822 Bacteria 1685
470 Ga0501035_0268985 3300049822 Bacteria 1443
471 Ga0501035_1005676 3300049822 Bacteria 655
472 Ga0501044_0000077 3300049823 Bacteria 119196
473 Ga0501044_0000154 3300049823 Bacteria 85407
474 Ga0501044_0005777 3300049823 Bacteria 13696
475 Ga0501044_0009552 3300049823 Bacteria 10560
476 Ga0501044_0026244 3300049823 Bacteria 6168
477 Ga0501044_0055808 3300049823 Bacteria 4056
478 Ga0501044_0064444 3300049823 Bacteria 3741
479 Ga0501044_0101420 3300049823 Bacteria 2895
480 Ga0501044_0133295 3300049823 Bacteria 2477
481 Ga0501044_0157858 3300049823 Bacteria 2247
482 Ga0501044_0366195 3300049823 Bacteria 1359
483 Ga0501044_0366330 3300049823 Bacteria 1358
484 Ga0501044_0541164 3300049823 Bacteria 1062
485 Ga0501044_0564691 3300049823 Bacteria 1034
486 Ga0501044_0588697 3300049823 Bacteria 1006
487 Ga0501044_0756750 3300049823 Bacteria 853
488 Ga0501044_0835310 3300049823 Bacteria 799
489 Ga0501044_1364424 3300049823 Bacteria 575
490 nmdc:mga09592_9834_c1 3300050508 Bacteria 7775
491 nmdc:mga06r32_233866_c1 3300050510 Bacteria 1826
492 Ga0501082_0015310 3300060353 Bacteria 6603
493 Ga0501082_0215324 3300060353 Bacteria 1671
494 Ga0501082_0380269 3300060353 Bacteria 1232
495 Ga0466962_0011043 3300061719 Bacteria 4348

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025292 Ga0209676_1039738 Ga0209676_10397383 145
2 iso_pu_bacteria 8003014200 8003016238 146
3 iso_pu_bacteria 2928058823 2928059548 147
4 iso_pu_bacteria 2939631187 2939631236 147
5 iso_pu_bacteria 2941489479 2941493695 147
6 iso_pu_bacteria 2995948881 2995952358 147
7 3300003187 JGI25151J46595_10000846 JGI25151J46595_100008468 148
8 3300003215 JGI25153J46596_10056366 JGI25153J46596_100563662 148
9 3300025292 Ga0209676_1040147 Ga0209676_10401473 148
10 3300025294 Ga0209025_1000224 Ga0209025_100022416 148
11 3300025297 Ga0209758_1002177 Ga0209758_100217715 148
12 3300046512 Ga0495610_0011438 Ga0495610_0011438_4586_5053 148
13 3300048917 Ga0496114_0200421 Ga0496114_0200421_1143_1607 148
14 3300049568 Ga0501031_0172932 Ga0501031_0172932_522_992 148
15 3300049569 Ga0501032_0044529 Ga0501032_0044529_1152_1622 148
16 3300049569 Ga0501032_0278274 Ga0501032_0278274_158_625 148
17 3300049570 Ga0501033_0029784 Ga0501033_0029784_738_1205 148
18 3300049570 Ga0501033_0048131 Ga0501033_0048131_467_937 148
19 3300049571 Ga0501034_0185096 Ga0501034_0185096_323_790 148
20 3300049571 Ga0501034_0662850 Ga0501034_0662850_326_796 148
21 3300049572 Ga0501036_0029074 Ga0501036_0029074_1396_1866 148
22 3300049573 Ga0501037_0058510 Ga0501037_0058510_1982_2452 148
23 3300049573 Ga0501037_0423386 Ga0501037_0423386_45_506 148
24 3300049574 Ga0501038_0008730 Ga0501038_0008730_285_752 148
25 3300049574 Ga0501038_0174718 Ga0501038_0174718_112_582 148
26 3300049575 Ga0501039_0105688 Ga0501039_0105688_994_1464 148
27 3300049579 Ga0501043_0122225 Ga0501043_0122225_1547_2014 148
28 3300049580 Ga0501046_0071918 Ga0501046_0071918_2024_2494 148
29 3300049580 Ga0501046_0354414 Ga0501046_0354414_12_479 148
30 3300049581 Ga0501047_0070774 Ga0501047_0070774_909_1379 148
31 3300049581 Ga0501047_0121847 Ga0501047_0121847_1463_1930 148
32 3300049582 Ga0501048_0408100 Ga0501048_0408100_87_557 148
33 3300049586 Ga0501070_0059996 Ga0501070_0059996_352_813 148
34 3300049822 Ga0501035_0039263 Ga0501035_0039263_2095_2565 148
35 3300049823 Ga0501044_0026244 Ga0501044_0026244_2296_2766 148
36 3300049823 Ga0501044_0541164 Ga0501044_0541164_27_494 148
37 3300049823 Ga0501044_0588697 Ga0501044_0588697_450_920 148
38 iso_pu_bacteria 2582581306 2585264773 148
39 iso_pu_bacteria 2582581865 2585386158 148
40 iso_pu_bacteria 2617270742 2617381089 148
41 iso_pu_bacteria 2643221550 2643772219 148
42 iso_pu_bacteria 2643221734 2644734034 148
43 iso_pu_bacteria 2643221736 2644747361 148
44 iso_pu_bacteria 2728368998 2728749167 148
45 iso_pu_bacteria 2842482326 2842484266 148
46 iso_pu_bacteria 2917699015 2917701851 148
47 iso_pu_bacteria 2996336353 2996338875 148
48 3300003781 Ga0055536_1010363 Ga0055536_10103632 149
49 3300003794 Ga0055531_10009885 Ga0055531_100098852 149
50 3300006844 Ga0075428_100003085 Ga0075428_1000030856 149
51 3300006846 Ga0075430_100281184 Ga0075430_1002811842 149
52 3300006847 Ga0075431_100026710 Ga0075431_1000267103 149
53 3300006880 Ga0075429_100008248 Ga0075429_1000082482 149
54 3300009147 Ga0114129_10018969 Ga0114129_100189697 149
55 3300025291 Ga0209675_1010617 Ga0209675_10106174 149
56 3300025292 Ga0209676_1005557 Ga0209676_10055572 149
57 3300025292 Ga0209676_1006363 Ga0209676_10063636 149
58 3300025298 Ga0209050_1006506 Ga0209050_10065062 149
59 3300025299 Ga0209256_1001956 Ga0209256_10019562 149
60 3300025304 Ga0209257_1000255 Ga0209257_100025579 149
61 3300028380 Ga0268265_10176603 Ga0268265_101766032 149
62 3300037418 Ga0395900_0171384 Ga0395900_0171384_870_1337 149
63 3300038443 Ga0395901_0290340 Ga0395901_0290340_659_1126 149
64 3300041406 Ga0439439_0121575 Ga0439439_0121575_63_578 149
65 3300041413 Ga0439465_0005898 Ga0439465_0005898_874_1332 149
66 3300042007 Ga0439449_0013888 Ga0439449_0013888_532_1047 149
67 3300042010 Ga0439452_017109 Ga0439452_017109_1226_1684 149
68 3300049569 Ga0501032_0199542 Ga0501032_0199542_122_583 149
69 3300049570 Ga0501033_0126924 Ga0501033_0126924_57_518 149
70 3300049571 Ga0501034_0399774 Ga0501034_0399774_507_968 149
71 3300049573 Ga0501037_0242597 Ga0501037_0242597_407_868 149
72 3300049574 Ga0501038_0080825 Ga0501038_0080825_2037_2498 149
73 3300049579 Ga0501043_0007432 Ga0501043_0007432_5173_5631 149
74 3300049579 Ga0501043_0043005 Ga0501043_0043005_1416_1877 149
75 3300049579 Ga0501043_0285858 Ga0501043_0285858_792_1250 149
76 3300049581 Ga0501047_0074428 Ga0501047_0074428_575_1036 149
77 3300049823 Ga0501044_0055808 Ga0501044_0055808_305_766 149
78 3300050508 nmdc:mga09592_9834_c1 nmdc:mga09592_9834_c1_3080_3547 149
79 3300050510 nmdc:mga06r32_233866_c1 nmdc:mga06r32_233866_c1_768_1235 149
80 iso_pu_bacteria 643692032 643827892 149
81 3300003323 rootH1_10242536 rootH1_102425364 150
82 3300003773 Ga0055537_1000057 Ga0055537_100005713 150
83 3300003775 Ga0055524_1000066 Ga0055524_100006688 150
84 3300003784 Ga0055534_1000175 Ga0055534_10001756 150
85 3300003790 Ga0055528_1000023 Ga0055528_100002387 150
86 3300005262 Ga0065165_1097193 Ga0065165_10971932 150
87 3300005435 Ga0070714_100553614 Ga0070714_1005536142 150
88 3300013102 Ga0157371_10705839 Ga0157371_107058391 150
89 3300015689 Ga0183360_10001 Ga0183360_10001888 150
90 3300025263 Ga0209565_1000005 Ga0209565_1000005253 150
91 3300025273 Ga0209673_1000027 Ga0209673_1000027254 150
92 3300025284 Ga0209130_1000244 Ga0209130_100024456 150
93 3300025291 Ga0209675_1000004 Ga0209675_1000004253 150
94 3300025295 Ga0209564_1000050 Ga0209564_1000050254 150
95 3300025299 Ga0209256_1000031 Ga0209256_1000031254 150
96 3300025302 Ga0207426_1000151 Ga0207426_100015156 150
97 3300025929 Ga0207664_10154990 Ga0207664_101549903 150
98 3300028794 Ga0307515_10000029 Ga0307515_10000029164 150
99 3300031456 Ga0307513_10010270 Ga0307513_100102703 150
100 3300037312 Ga0395899_0002516 Ga0395899_0002516_6357_6833 150
101 3300037312 Ga0395899_0176000 Ga0395899_0176000_254_721 150
102 3300037312 Ga0395899_0212784 Ga0395899_0212784_197_664 150
103 3300037312 Ga0395899_0326895 Ga0395899_0326895_186_650 150
104 3300037418 Ga0395900_0000006 Ga0395900_0000006_384504_384980 150
105 3300037418 Ga0395900_0005617 Ga0395900_0005617_6936_7403 150
106 3300037418 Ga0395900_0054526 Ga0395900_0054526_1095_1559 150
107 3300037466 Ga0395898_0012851 Ga0395898_0012851_1635_2102 150
108 3300037466 Ga0395898_0114289 Ga0395898_0114289_1812_2279 150
109 3300037466 Ga0395898_0141682 Ga0395898_0141682_951_1415 150
110 3300037466 Ga0395898_0206248 Ga0395898_0206248_1009_1485 150
111 3300037471 Ga0395905_0034107 Ga0395905_0034107_1541_2017 150
112 3300038443 Ga0395901_0000001 Ga0395901_0000001_427752_428228 150
113 3300038443 Ga0395901_0037019 Ga0395901_0037019_2391_2855 150
114 3300038443 Ga0395901_0843535 Ga0395901_0843535_143_610 150
115 3300038443 Ga0395901_1811127 Ga0395901_1811127_77_544 150
116 3300045976 Ga0466967_0006325 Ga0466967_0006325_864_1373 150
117 3300046474 Ga0495605_0032403 Ga0495605_0032403_1686_2153 150
118 3300046542 Ga0495597_0000065 Ga0495597_0000065_34081_34539 150
119 3300048924 Ga0496121_0010364 Ga0496121_0010364_5462_5935 150
120 3300049570 Ga0501033_0022737 Ga0501033_0022737_350_829 150
121 3300049571 Ga0501034_0318546 Ga0501034_0318546_147_611 150
122 3300049571 Ga0501034_0544357 Ga0501034_0544357_492_971 150
123 3300049572 Ga0501036_0095573 Ga0501036_0095573_430_909 150
124 3300049572 Ga0501036_0216566 Ga0501036_0216566_957_1421 150
125 3300049573 Ga0501037_0107945 Ga0501037_0107945_658_1122 150
126 3300049574 Ga0501038_0016736 Ga0501038_0016736_64_528 150
127 3300049578 Ga0501042_0168464 Ga0501042_0168464_971_1435 150
128 3300049579 Ga0501043_0539030 Ga0501043_0539030_120_584 150
129 3300049580 Ga0501046_0246319 Ga0501046_0246319_311_790 150
130 3300049580 Ga0501046_0704145 Ga0501046_0704145_195_659 150
131 3300049581 Ga0501047_0055387 Ga0501047_0055387_1964_2428 150
132 3300049581 Ga0501047_0170493 Ga0501047_0170493_204_683 150
133 3300049582 Ga0501048_0168532 Ga0501048_0168532_946_1410 150
134 3300049743 Ga0501081_0114796 Ga0501081_0114796_928_1401 150
135 3300049822 Ga0501035_0063985 Ga0501035_0063985_454_933 150
136 3300049823 Ga0501044_0133295 Ga0501044_0133295_684_1148 150
137 iso_pu_bacteria 8057101203 8057101968 150
138 3300001979 JGI24740J21852_10000165 JGI24740J21852_100001653 151
139 3300002737 JGI25162J39368_1000111 JGI25162J39368_10001119 151
140 3300002738 JGI25154J39366_1000536 JGI25154J39366_100053615 151
141 3300002987 JGI25159J45721_1006237 JGI25159J45721_10062373 151
142 3300003187 JGI25151J46595_10001459 JGI25151J46595_100014594 151
143 3300003187 JGI25151J46595_10015852 JGI25151J46595_100158521 151
144 3300003187 JGI25151J46595_10021024 JGI25151J46595_100210242 151
145 3300003214 JGI25165J46597_1001440 JGI25165J46597_10014402 151
146 3300003214 JGI25165J46597_1035630 JGI25165J46597_10356301 151
147 3300003322 rootL2_10174794 rootL2_101747941 151
148 3300003751 Ga0055538_1002615 Ga0055538_10026152 151
149 3300003752 Ga0055539_1000201 Ga0055539_10002018 151
150 3300003756 Ga0055533_1000937 Ga0055533_100093710 151
151 3300003758 Ga0055532_1000073 Ga0055532_100007329 151
152 3300003759 Ga0055525_1000366 Ga0055525_10003668 151
153 3300003759 Ga0055525_1005504 Ga0055525_10055042 151
154 3300003761 Ga0055535_1000055 Ga0055535_100005529 151
155 3300003762 Ga0055542_1000721 Ga0055542_100072125 151
156 3300003763 Ga0055529_1000149 Ga0055529_10001492 151
157 3300003771 Ga0055526_1003295 Ga0055526_100329512 151
158 3300003771 Ga0055526_1004820 Ga0055526_10048208 151
159 3300003771 Ga0055526_1022147 Ga0055526_10221473 151
160 3300003771 Ga0055526_1024545 Ga0055526_10245452 151
161 3300003771 Ga0055526_1027604 Ga0055526_10276043 151
162 3300003775 Ga0055524_1015029 Ga0055524_10150293 151
163 3300003775 Ga0055524_1018659 Ga0055524_10186593 151
164 3300003775 Ga0055524_1022085 Ga0055524_10220853 151
165 3300003781 Ga0055536_1000339 Ga0055536_100033924 151
166 3300003781 Ga0055536_1007488 Ga0055536_10074882 151
167 3300003781 Ga0055536_1084748 Ga0055536_10847481 151
168 3300003784 Ga0055534_1000247 Ga0055534_100024712 151
169 3300003784 Ga0055534_1002727 Ga0055534_10027271 151
170 3300003791 Ga0055530_10004258 Ga0055530_100042588 151
171 3300003794 Ga0055531_10023298 Ga0055531_100232983 151
172 3300003794 Ga0055531_10023925 Ga0055531_100239253 151
173 3300003794 Ga0055531_10041843 Ga0055531_100418432 151
174 3300003841 Ga0055541_1000336 Ga0055541_100033611 151
175 3300003841 Ga0055541_1008961 Ga0055541_10089612 151
176 3300004625 Ga0055543_1072670 Ga0055543_10726701 151
177 3300005262 Ga0065165_1000119 Ga0065165_1000119119 151
178 3300005262 Ga0065165_1000545 Ga0065165_100054514 151
179 3300005336 Ga0070680_100268598 Ga0070680_1002685982 151
180 3300005336 Ga0070680_100349743 Ga0070680_1003497434 151
181 3300005337 Ga0070682_100014762 Ga0070682_1000147624 151
182 3300005344 Ga0070661_100000061 Ga0070661_10000006144 151
183 3300005366 Ga0070659_100002481 Ga0070659_1000024816 151
184 3300005366 Ga0070659_100170551 Ga0070659_1001705512 151
185 3300005455 Ga0070663_100000009 Ga0070663_10000000922 151
186 3300005455 Ga0070663_100013889 Ga0070663_1000138892 151
187 3300005455 Ga0070663_100068421 Ga0070663_1000684213 151
188 3300005455 Ga0070663_100144834 Ga0070663_1001448344 151
189 3300005455 Ga0070663_100279202 Ga0070663_1002792022 151
190 3300005458 Ga0070681_10067174 Ga0070681_100671741 151
191 3300005458 Ga0070681_10321866 Ga0070681_103218662 151
192 3300005530 Ga0070679_100035873 Ga0070679_1000358736 151
193 3300005535 Ga0070684_100017185 Ga0070684_1000171854 151
194 3300005539 Ga0068853_100013529 Ga0068853_1000135299 151
195 3300005563 Ga0068855_100752393 Ga0068855_1007523932 151
196 3300005564 Ga0070664_100000010 Ga0070664_10000001052 151
197 3300005577 Ga0068857_101052441 Ga0068857_1010524412 151
198 3300005578 Ga0068854_100028644 Ga0068854_1000286442 151
199 3300005614 Ga0068856_100000045 Ga0068856_1000000458 151
200 3300005616 Ga0068852_100231301 Ga0068852_1002313011 151
201 3300009011 Ga0105251_10032244 Ga0105251_100322442 151
202 3300009011 Ga0105251_10159556 Ga0105251_101595562 151
203 3300009093 Ga0105240_10000739 Ga0105240_1000073950 151
204 3300009093 Ga0105240_10120343 Ga0105240_101203432 151
205 3300009093 Ga0105240_10139498 Ga0105240_101394983 151
206 3300009093 Ga0105240_10336432 Ga0105240_103364323 151
207 3300009174 Ga0105241_10221252 Ga0105241_102212522 151
208 3300009545 Ga0105237_10002121 Ga0105237_100021212 151
209 3300009551 Ga0105238_10004352 Ga0105238_1000435210 151
210 3300009551 Ga0105238_10061034 Ga0105238_100610342 151
211 3300010375 Ga0105239_10000454 Ga0105239_1000045450 151
212 3300012512 Ga0157327_1006626 Ga0157327_10066262 151
213 3300013100 Ga0157373_10004941 Ga0157373_100049415 151
214 3300013100 Ga0157373_10018501 Ga0157373_100185014 151
215 3300013102 Ga0157371_10000088 Ga0157371_1000008895 151
216 3300013102 Ga0157371_10017730 Ga0157371_100177304 151
217 3300013104 Ga0157370_10000041 Ga0157370_1000004195 151
218 3300013104 Ga0157370_10008961 Ga0157370_1000896110 151
219 3300013104 Ga0157370_10495702 Ga0157370_104957022 151
220 3300013104 Ga0157370_10660278 Ga0157370_106602782 151
221 3300013105 Ga0157369_10265362 Ga0157369_102653623 151
222 3300013105 Ga0157369_10435994 Ga0157369_104359943 151
223 3300013250 Ga0171462_1015 Ga0171462_1015119 151
224 3300013307 Ga0157372_10000097 Ga0157372_1000009728 151
225 3300013307 Ga0157372_10171824 Ga0157372_101718245 151
226 3300014497 Ga0182008_10022898 Ga0182008_100228982 151
227 3300015261 Ga0182006_1003196 Ga0182006_10031966 151
228 3300015261 Ga0182006_1016828 Ga0182006_10168282 151
229 3300015262 Ga0182007_10002998 Ga0182007_100029988 151
230 3300020069 Ga0197907_10007993 Ga0197907_100079931 151
231 3300025207 Ga0209760_100795 Ga0209760_1007953 151
232 3300025224 Ga0209784_100008 Ga0209784_100008196 151
233 3300025224 Ga0209784_100262 Ga0209784_10026229 151
234 3300025225 Ga0209566_100006 Ga0209566_100006196 151
235 3300025225 Ga0209566_100407 Ga0209566_10040715 151
236 3300025225 Ga0209566_100636 Ga0209566_1006369 151
237 3300025226 Ga0209674_100045 Ga0209674_100045115 151
238 3300025226 Ga0209674_100114 Ga0209674_1001143 151
239 3300025229 Ga0209147_100005 Ga0209147_100005189 151
240 3300025230 Ga0209563_100016 Ga0209563_100016196 151
241 3300025230 Ga0209563_111699 Ga0209563_1116992 151
242 3300025233 Ga0209437_100064 Ga0209437_10006477 151
243 3300025242 Ga0209258_100007 Ga0209258_100007189 151
244 3300025246 Ga0209646_1000027 Ga0209646_100002771 151
245 3300025250 Ga0209026_1003785 Ga0209026_10037857 151
246 3300025253 Ga0209677_100008 Ga0209677_100008496 151
247 3300025253 Ga0209677_105391 Ga0209677_1053912 151
248 3300025254 Ga0209148_1000019 Ga0209148_1000019165 151
249 3300025256 Ga0209759_1004768 Ga0209759_10047682 151
250 3300025256 Ga0209759_1045859 Ga0209759_10458591 151
251 3300025261 Ga0209233_1000081 Ga0209233_1000081225 151
252 3300025261 Ga0209233_1004045 Ga0209233_10040455 151
253 3300025263 Ga0209565_1000094 Ga0209565_1000094102 151
254 3300025272 Ga0209455_1000011 Ga0209455_1000011114 151
255 3300025273 Ga0209673_1007856 Ga0209673_10078562 151
256 3300025273 Ga0209673_1007992 Ga0209673_10079925 151
257 3300025284 Ga0209130_1000702 Ga0209130_10007028 151
258 3300025284 Ga0209130_1015852 Ga0209130_10158521 151
259 3300025291 Ga0209675_1000079 Ga0209675_100007918 151
260 3300025291 Ga0209675_1002258 Ga0209675_100225811 151
261 3300025291 Ga0209675_1021220 Ga0209675_10212201 151
262 3300025292 Ga0209676_1000176 Ga0209676_1000176100 151
263 3300025292 Ga0209676_1001097 Ga0209676_10010972 151
264 3300025292 Ga0209676_1030419 Ga0209676_10304192 151
265 3300025294 Ga0209025_1000046 Ga0209025_100004671 151
266 3300025294 Ga0209025_1002162 Ga0209025_10021627 151
267 3300025294 Ga0209025_1007268 Ga0209025_10072688 151
268 3300025294 Ga0209025_1015187 Ga0209025_10151874 151
269 3300025294 Ga0209025_1077870 Ga0209025_10778702 151
270 3300025295 Ga0209564_1000166 Ga0209564_100016693 151
271 3300025295 Ga0209564_1000308 Ga0209564_100030818 151
272 3300025295 Ga0209564_1000509 Ga0209564_100050915 151
273 3300025295 Ga0209564_1005648 Ga0209564_10056485 151
274 3300025295 Ga0209564_1047058 Ga0209564_10470583 151
275 3300025298 Ga0209050_1001060 Ga0209050_100106028 151
276 3300025298 Ga0209050_1046019 Ga0209050_10460192 151
277 3300025299 Ga0209256_1000960 Ga0209256_10009602 151
278 3300025299 Ga0209256_1008858 Ga0209256_10088582 151
279 3300025299 Ga0209256_1008871 Ga0209256_10088712 151
280 3300025302 Ga0207426_1000215 Ga0207426_1000215119 151
281 3300025302 Ga0207426_1035838 Ga0207426_10358382 151
282 3300025302 Ga0207426_1079226 Ga0207426_10792261 151
283 3300025303 Ga0209051_1070857 Ga0209051_10708573 151
284 3300025304 Ga0209257_1000283 Ga0209257_100028349 151
285 3300025304 Ga0209257_1006338 Ga0209257_10063388 151
286 3300025304 Ga0209257_1007543 Ga0209257_10075437 151
287 3300025304 Ga0209257_1035848 Ga0209257_10358482 151
288 3300025711 Ga0207696_1007558 Ga0207696_10075583 151
289 3300025728 Ga0207655_1014101 Ga0207655_10141014 151
290 3300025735 Ga0207713_1020832 Ga0207713_10208322 151
291 3300025909 Ga0207705_10977475 Ga0207705_109774752 151
292 3300025911 Ga0207654_11179577 Ga0207654_111795771 151
293 3300025912 Ga0207707_10094144 Ga0207707_100941443 151
294 3300025913 Ga0207695_10000788 Ga0207695_1000078837 151
295 3300025913 Ga0207695_10006520 Ga0207695_100065207 151
296 3300025913 Ga0207695_10296570 Ga0207695_102965702 151
297 3300025913 Ga0207695_10565390 Ga0207695_105653902 151
298 3300025914 Ga0207671_10000411 Ga0207671_1000041150 151
299 3300025914 Ga0207671_10137651 Ga0207671_101376512 151
300 3300025920 Ga0207649_10000605 Ga0207649_100006057 151
301 3300025921 Ga0207652_10049707 Ga0207652_100497074 151
302 3300025921 Ga0207652_10974597 Ga0207652_109745972 151
303 3300025924 Ga0207694_10118163 Ga0207694_101181632 151
304 3300025932 Ga0207690_10063206 Ga0207690_100632062 151
305 3300025932 Ga0207690_10137932 Ga0207690_101379323 151
306 3300025944 Ga0207661_10000109 Ga0207661_1000010915 151
307 3300025945 Ga0207679_10000002 Ga0207679_10000002523 151
308 3300025981 Ga0207640_10009624 Ga0207640_100096244 151
309 3300026041 Ga0207639_10002690 Ga0207639_100026906 151
310 3300026067 Ga0207678_10000018 Ga0207678_1000001892 151
311 3300026067 Ga0207678_10045408 Ga0207678_100454084 151
312 3300026067 Ga0207678_10078794 Ga0207678_100787943 151
313 3300026078 Ga0207702_10000053 Ga0207702_1000005366 151
314 3300026116 Ga0207674_10001653 Ga0207674_100016536 151
315 3300026142 Ga0207698_11607399 Ga0207698_116073992 151
316 3300027312 Ga0209371_1000006 Ga0209371_1000006651 151
317 3300027666 Ga0209282_1000019 Ga0209282_100001966 151
318 3300028794 Ga0307515_10009918 Ga0307515_100099187 151
319 3300030500 Ga0268256_1000007 Ga0268256_1000007651 151
320 3300031901 Ga0307406_10297576 Ga0307406_102975762 151
321 3300031901 Ga0307406_10619919 Ga0307406_106199192 151
322 3300037312 Ga0395899_0008931 Ga0395899_0008931_6551_7024 151
323 3300037312 Ga0395899_0139154 Ga0395899_0139154_630_1109 151
324 3300037312 Ga0395899_0334003 Ga0395899_0334003_115_570 151
325 3300037418 Ga0395900_0118521 Ga0395900_0118521_2090_2569 151
326 3300037418 Ga0395900_0542173 Ga0395900_0542173_149_622 151
327 3300037466 Ga0395898_0098108 Ga0395898_0098108_567_1040 151
328 3300037466 Ga0395898_0432874 Ga0395898_0432874_120_599 151
329 3300037466 Ga0395898_0763789 Ga0395898_0763789_206_676 151
330 3300037471 Ga0395905_0147200 Ga0395905_0147200_1144_1614 151
331 3300038443 Ga0395901_0035004 Ga0395901_0035004_4583_5056 151
332 3300038443 Ga0395901_0397832 Ga0395901_0397832_812_1285 151
333 3300042006 Ga0439432_017466 Ga0439432_017466_1419_1907 151
334 3300042139 Ga0450904_000366 Ga0450904_000366_1570_2043 151
335 3300044656 Ga0466969_0008077 Ga0466969_0008077_2236_2691 151
336 3300044658 Ga0466972_0001290 Ga0466972_0001290_2640_3095 151
337 3300044671 Ga0466978_0006655 Ga0466978_0006655_2234_2689 151
338 3300044672 Ga0466982_0094720 Ga0466982_0094720_757_1212 151
339 3300044683 Ga0466965_0002975 Ga0466965_0002975_2199_2654 151
340 3300044693 Ga0466961_0000200 Ga0466961_0000200_2419_2874 151
341 3300044694 Ga0466963_0021800 Ga0466963_0021800_1188_1643 151
342 3300044706 Ga0466964_0178833 Ga0466964_0178833_500_955 151
343 3300044719 Ga0466971_0038113 Ga0466971_0038113_117_572 151
344 3300044735 Ga0466968_0016833 Ga0466968_0016833_1684_2139 151
345 3300044765 Ga0466970_0001061 Ga0466970_0001061_10342_10797 151
346 3300044901 Ga0466960_0085652 Ga0466960_0085652_678_1133 151
347 3300045049 Ga0466959_0000415 Ga0466959_0000415_22408_22863 151
348 3300045836 Ga0466958_0335632 Ga0466958_0335632_146_601 151
349 3300046453 Ga0495627_013868 Ga0495627_013868_1793_2275 151
350 3300046458 Ga0495591_081478 Ga0495591_081478_310_786 151
351 3300046472 Ga0495580_0315167 Ga0495580_0315167_429_899 151
352 3300046472 Ga0495580_0735408 Ga0495580_0735408_132_599 151
353 3300046474 Ga0495605_0003211 Ga0495605_0003211_1929_2405 151
354 3300046491 Ga0495584_0159253 Ga0495584_0159253_453_929 151
355 3300046491 Ga0495584_0179618 Ga0495584_0179618_136_606 151
356 3300046500 Ga0495596_0000086 Ga0495596_0000086_49840_50316 151
357 3300046501 Ga0495607_0017794 Ga0495607_0017794_1762_2244 151
358 3300046501 Ga0495607_0104383 Ga0495607_0104383_85_561 151
359 3300046506 Ga0495583_0005337 Ga0495583_0005337_4292_4759 151
360 3300046512 Ga0495610_0000221 Ga0495610_0000221_1426_1902 151
361 3300046513 Ga0495616_0007103 Ga0495616_0007103_962_1438 151
362 3300046513 Ga0495616_0046048 Ga0495616_0046048_743_1213 151
363 3300046519 Ga0495632_0012840 Ga0495632_0012840_2823_3305 151
364 3300046522 Ga0495643_0008500 Ga0495643_0008500_1857_2339 151
365 3300046524 Ga0495648_0101533 Ga0495648_0101533_730_1197 151
366 3300046524 Ga0495648_0175328 Ga0495648_0175328_14_490 151
367 3300046525 Ga0495663_0003532 Ga0495663_0003532_1845_2327 151
368 3300046530 Ga0495654_0020142 Ga0495654_0020142_1548_2030 151
369 3300046531 Ga0495665_0083648 Ga0495665_0083648_23_490 151
370 3300046538 Ga0495609_0004101 Ga0495609_0004101_7510_7986 151
371 3300046542 Ga0495597_0075972 Ga0495597_0075972_872_1348 151
372 3300046557 Ga0495622_0091789 Ga0495622_0091789_765_1232 151
373 3300046558 Ga0495633_0040885 Ga0495633_0040885_1301_1768 151
374 3300046665 Ga0495661_0021165 Ga0495661_0021165_1747_2229 151
375 3300046665 Ga0495661_0070625 Ga0495661_0070625_1436_1912 151
376 3300046691 Ga0495670_0051545 Ga0495670_0051545_933_1409 151
377 3300046692 Ga0495671_0003443 Ga0495671_0003443_3815_4291 151
378 3300046692 Ga0495671_0112300 Ga0495671_0112300_462_929 151
379 3300046694 Ga0495649_0022167 Ga0495649_0022167_1059_1535 151
380 3300046794 Ga0495589_0015514 Ga0495589_0015514_1478_1948 151
381 3300047319 Ga0495674_0000977 Ga0495674_0000977_4603_5073 151
382 3300047320 Ga0495672_0005503 Ga0495672_0005503_1601_2077 151
383 3300047320 Ga0495672_0101382 Ga0495672_0101382_156_623 151
384 3300047323 Ga0495683_0195698 Ga0495683_0195698_279_749 151
385 3300047443 Ga0495687_041758 Ga0495687_041758_86_556 151
386 3300047469 Ga0495673_0069340 Ga0495673_0069340_55_522 151
387 3300047470 Ga0495681_0010942 Ga0495681_0010942_2844_3326 151
388 3300048091 Ga0495626_0081388 Ga0495626_0081388_143_610 151
389 3300048903 Ga0496100_0000617 Ga0496100_0000617_2829_3299 151
390 3300048904 Ga0496101_0000987 Ga0496101_0000987_2829_3299 151
391 3300048904 Ga0496101_0033944 Ga0496101_0033944_1711_2181 151
392 3300048905 Ga0496102_0000165 Ga0496102_0000165_74959_75429 151
393 3300048906 Ga0496103_0000728 Ga0496103_0000728_976_1446 151
394 3300048907 Ga0496104_0425026 Ga0496104_0425026_223_693 151
395 3300048907 Ga0496104_1377212 Ga0496104_1377212_46_516 151
396 3300048908 Ga0496105_0933244 Ga0496105_0933244_35_505 151
397 3300048909 Ga0496106_0043212 Ga0496106_0043212_1805_2275 151
398 3300048910 Ga0496107_1016545 Ga0496107_1016545_31_501 151
399 3300048915 Ga0496112_0193458 Ga0496112_0193458_587_1057 151
400 3300048919 Ga0496116_0007050 Ga0496116_0007050_1958_2434 151
401 3300048919 Ga0496116_0042730 Ga0496116_0042730_2048_2503 151
402 3300048919 Ga0496116_0057197 Ga0496116_0057197_745_1221 151
403 3300048919 Ga0496116_0074697 Ga0496116_0074697_171_641 151
404 3300048920 Ga0496117_0001246 Ga0496117_0001246_15348_15818 151
405 3300048920 Ga0496117_0287960 Ga0496117_0287960_47_502 151
406 3300048921 Ga0496118_0000283 Ga0496118_0000283_13791_14261 151
407 3300048921 Ga0496118_0238760 Ga0496118_0238760_252_707 151
408 3300048922 Ga0496119_0000011 Ga0496119_0000011_12102_12560 151
409 3300048922 Ga0496119_0045652 Ga0496119_0045652_360_830 151
410 3300048922 Ga0496119_0194325 Ga0496119_0194325_303_773 151
411 3300048923 Ga0496120_0002123 Ga0496120_0002123_11917_12375 151
412 3300048924 Ga0496121_0001382 Ga0496121_0001382_26918_27388 151
413 3300048924 Ga0496121_0006825 Ga0496121_0006825_702_1172 151
414 3300048924 Ga0496121_0015295 Ga0496121_0015295_548_1024 151
415 3300048925 Ga0496122_0002013 Ga0496122_0002013_14396_14872 151
416 3300048925 Ga0496122_0045811 Ga0496122_0045811_1558_2040 151
417 3300048925 Ga0496122_0123247 Ga0496122_0123247_779_1249 151
418 3300048926 Ga0496123_0000493 Ga0496123_0000493_16489_16965 151
419 3300048926 Ga0496123_0052369 Ga0496123_0052369_521_1003 151
420 3300048928 Ga0496125_0024579 Ga0496125_0024579_3638_4093 151
421 3300048929 Ga0496126_0156201 Ga0496126_0156201_1469_1939 151
422 3300049460 Ga0495682_0231346 Ga0495682_0231346_167_637 151
423 3300049568 Ga0501031_0012439 Ga0501031_0012439_719_1228 151
424 3300049568 Ga0501031_0262202 Ga0501031_0262202_186_674 151
425 3300049569 Ga0501032_0022038 Ga0501032_0022038_2295_2804 151
426 3300049569 Ga0501032_0030996 Ga0501032_0030996_608_1096 151
427 3300049569 Ga0501032_0090851 Ga0501032_0090851_1520_2014 151
428 3300049569 Ga0501032_0124280 Ga0501032_0124280_1122_1610 151
429 3300049569 Ga0501032_0680491 Ga0501032_0680491_66_539 151
430 3300049570 Ga0501033_0000446 Ga0501033_0000446_8749_9243 151
431 3300049570 Ga0501033_0019827 Ga0501033_0019827_767_1255 151
432 3300049570 Ga0501033_0053457 Ga0501033_0053457_1556_2023 151
433 3300049570 Ga0501033_0083288 Ga0501033_0083288_466_954 151
434 3300049570 Ga0501033_0176588 Ga0501033_0176588_716_1195 151
435 3300049570 Ga0501033_0236737 Ga0501033_0236737_620_1087 151
436 3300049571 Ga0501034_0004324 Ga0501034_0004324_14993_15466 151
437 3300049571 Ga0501034_0375448 Ga0501034_0375448_500_973 151
438 3300049571 Ga0501034_0388659 Ga0501034_0388659_312_800 151
439 3300049571 Ga0501034_0520976 Ga0501034_0520976_241_714 151
440 3300049571 Ga0501034_0538518 Ga0501034_0538518_32_517 151
441 3300049572 Ga0501036_0005424 Ga0501036_0005424_7153_7647 151
442 3300049572 Ga0501036_0181086 Ga0501036_0181086_865_1356 151
443 3300049572 Ga0501036_0545303 Ga0501036_0545303_296_769 151
444 3300049572 Ga0501036_0803996 Ga0501036_0803996_216_689 151
445 3300049573 Ga0501037_0000179 Ga0501037_0000179_51407_51901 151
446 3300049573 Ga0501037_0001481 Ga0501037_0001481_8112_8684 151
447 3300049573 Ga0501037_0230112 Ga0501037_0230112_117_611 151
448 3300049573 Ga0501037_0430329 Ga0501037_0430329_247_720 151
449 3300049574 Ga0501038_0238033 Ga0501038_0238033_653_1162 151
450 3300049574 Ga0501038_0306094 Ga0501038_0306094_361_828 151
451 3300049575 Ga0501039_0001884 Ga0501039_0001884_9483_9977 151
452 3300049575 Ga0501039_0980498 Ga0501039_0980498_96_569 151
453 3300049578 Ga0501042_0011846 Ga0501042_0011846_1581_2075 151
454 3300049579 Ga0501043_0000005 Ga0501043_0000005_94361_94870 151
455 3300049579 Ga0501043_0005191 Ga0501043_0005191_6876_7370 151
456 3300049579 Ga0501043_0036224 Ga0501043_0036224_2276_2755 151
457 3300049579 Ga0501043_0200972 Ga0501043_0200972_239_718 151
458 3300049579 Ga0501043_0275677 Ga0501043_0275677_18_509 151
459 3300049580 Ga0501046_0000376 Ga0501046_0000376_7682_8146 151
460 3300049580 Ga0501046_0021898 Ga0501046_0021898_474_968 151
461 3300049580 Ga0501046_0910026 Ga0501046_0910026_109_588 151
462 3300049581 Ga0501047_0022956 Ga0501047_0022956_1095_1586 151
463 3300049581 Ga0501047_0088937 Ga0501047_0088937_2174_2647 151
464 3300049581 Ga0501047_0154601 Ga0501047_0154601_686_1174 151
465 3300049581 Ga0501047_0277327 Ga0501047_0277327_996_1463 151
466 3300049581 Ga0501047_0809349 Ga0501047_0809349_208_681 151
467 3300049584 Ga0501068_0047823 Ga0501068_0047823_105_599 151
468 3300049584 Ga0501068_0608383 Ga0501068_0608383_20_529 151
469 3300049585 Ga0501069_0000011 Ga0501069_0000011_89672_90181 151
470 3300049585 Ga0501069_0205867 Ga0501069_0205867_25_498 151
471 3300049586 Ga0501070_0001424 Ga0501070_0001424_12355_12927 151
472 3300049586 Ga0501070_0013988 Ga0501070_0013988_4042_4530 151
473 3300049586 Ga0501070_0032558 Ga0501070_0032558_2923_3396 151
474 3300049586 Ga0501070_0046609 Ga0501070_0046609_3103_3576 151
475 3300049586 Ga0501070_0047624 Ga0501070_0047624_32_520 151
476 3300049586 Ga0501070_0134414 Ga0501070_0134414_639_1130 151
477 3300049586 Ga0501070_0140286 Ga0501070_0140286_983_1471 151
478 3300049586 Ga0501070_1064001 Ga0501070_1064001_120_614 151
479 3300049587 Ga0501071_0059243 Ga0501071_0059243_1822_2331 151
480 3300049589 Ga0501073_0078435 Ga0501073_0078435_476_1048 151
481 3300049590 Ga0501074_0000336 Ga0501074_0000336_8484_8993 151
482 3300049742 Ga0501080_0001369 Ga0501080_0001369_8217_8789 151
483 3300049742 Ga0501080_0904887 Ga0501080_0904887_242_736 151
484 3300049744 Ga0501083_0000805 Ga0501083_0000805_8554_9063 151
485 3300049822 Ga0501035_0000107 Ga0501035_0000107_90569_91078 151
486 3300049822 Ga0501035_0007869 Ga0501035_0007869_6624_7118 151
487 3300049822 Ga0501035_0013853 Ga0501035_0013853_2668_3144 151
488 3300049822 Ga0501035_0015836 Ga0501035_0015836_4818_5306 151
489 3300049822 Ga0501035_0060690 Ga0501035_0060690_637_1125 151
490 3300049822 Ga0501035_0062852 Ga0501035_0062852_2401_2889 151
491 3300049822 Ga0501035_0107961 Ga0501035_0107961_231_704 151
492 3300049822 Ga0501035_0115867 Ga0501035_0115867_1473_1964 151
493 3300049822 Ga0501035_0206022 Ga0501035_0206022_323_790 151
494 3300049822 Ga0501035_0268985 Ga0501035_0268985_662_1135 151
495 3300049822 Ga0501035_1005676 Ga0501035_1005676_145_618 151
496 3300049823 Ga0501044_0000077 Ga0501044_0000077_43137_43625 151
497 3300049823 Ga0501044_0000154 Ga0501044_0000154_14878_15450 151
498 3300049823 Ga0501044_0005777 Ga0501044_0005777_2927_3421 151
499 3300049823 Ga0501044_0009552 Ga0501044_0009552_4722_5192 151
500 3300049823 Ga0501044_0064444 Ga0501044_0064444_357_830 151
501 3300049823 Ga0501044_0101420 Ga0501044_0101420_1771_2262 151
502 3300049823 Ga0501044_0157858 Ga0501044_0157858_206_679 151
503 3300049823 Ga0501044_0366195 Ga0501044_0366195_816_1292 151
504 3300049823 Ga0501044_0366330 Ga0501044_0366330_846_1334 151
505 3300049823 Ga0501044_0564691 Ga0501044_0564691_180_668 151
506 3300049823 Ga0501044_0756750 Ga0501044_0756750_169_654 151
507 3300049823 Ga0501044_0835310 Ga0501044_0835310_231_701 151
508 3300049823 Ga0501044_1364424 Ga0501044_1364424_80_553 151
509 3300060353 Ga0501082_0015310 Ga0501082_0015310_1811_2320 151
510 3300060353 Ga0501082_0215324 Ga0501082_0215324_975_1448 151
511 3300060353 Ga0501082_0380269 Ga0501082_0380269_157_630 151
512 3300061719 Ga0466962_0011043 Ga0466962_0011043_390_845 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

11

113

0.95

PF14437

MafB19-deam

MafB19-like deaminase

16

146

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vpc-assembly1.cif.gz_F structure of the spcas9 dna adenine base editor - abe8e 0.9764 2 103
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9761 2 102
3v0f-assembly2.cif.gz_B crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 241-576(c363s), form ii 0.9732 25 39
1wwr-assembly1.cif.gz_A crystal structure of trna adenosine deaminase tada from aquifex aeolicus 0.9721 1 102
8e2q-assembly2.cif.gz_C crystal structure of tadac-1.17 in a complex with ssdna 0.9708 1 102
ID Description Score Start End Superfamily
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9771 5 102 3.40.140.10
1wwrD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9729 1 102 3.40.140.10
af_K7K815_1119_1301_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9706 3 104 3.40.140.10
1z3aA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9703 1 102 3.40.140.10
2nx8A00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9636 5 102 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A3B0LWC0-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9943 1 113 GO:0002100
GO:0006152
GO:0008892
GO:0047974
GO:0052717
AF-A0A533YHZ7-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9867 5 102 GO:0002100
GO:0008270
GO:0052717
AF-A0A1K1XT98-F1-model_v4 deleted 0.9862 5 102
AF-A0A3B0LWC0-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9857 1 113 GO:0002100
GO:0006152
GO:0008892
GO:0047974
GO:0052717
AF-A0A2V2EFH9-F1-model_v4 deleted 0.9855 3 102

Feature Viewer

pLDDT pTM Quality
95.83 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map