metagRoot

F457176

General Info

Members	Datasets	Scaffolds	Average Seq Length
510	306	459	271

Family's Representative Sequence

Representative Sequence	3300037466\|Ga0395898_0296086\|Ga0395898_0296086_633_1523
Length	296
Sequence	VAYAAIEVTSVAMTEATGDRDRSRVLPVGALTARTILVGLMVVTLMPFVTMFSAALAPSGTYPPGLQWPANPQWQNFVDAFEAAHMDQLLLSSTIIALGVVPISVLIGTMAGFGIAKLAPKGSTVVYLLFVLGLTLPFEGIITPLYYEVKTFGILNTKLAIILPLIGLYMPFSVYWMRAHFVNVPDEMGEAASIDGASAWQQFWLVQVPIARPAILSLAILQFLWTWNQFLLPIVLVEVPLERTMAGALGAFQGQWGTNIPLLCAGALIIIAPTVVLFVIFQKQFVAALLQGAVKG

Samples

	Sample ID	Description	Type	Environment
1	2643221591	Devosia sp. Root685	Isolate	Unclassified
2	2643221629	Devosia sp. Root105	Isolate	Unclassified
3	2643221662	Devosia sp. Root413D1	Isolate	Unclassified
4	2675903060	Nonomuraea wenchangensis CGMCC 4.5598	Isolate	Rhizosphere
5	2731639228	Motilibacter peucedani DSM 45328	Isolate	Rhizosphere
6	2772190715	Micromonospora chokoriensis NRRL B-24750	Isolate	Unclassified
7	2773857759	Microbacterium sp. 1294	Isolate	Unclassified
8	2799112218	Motilibacter rhizosphaerae DSM 45622	Isolate	Rhizosphere
9	2808606306	Microbacterium sp. SLBN-146	Isolate	Unclassified
10	2808606447	Microbacterium sp. HAR-UPW-R2A-48	Isolate	Unclassified
11	2811994880	Cellulomonas sp. SLBN-39	Isolate	Unclassified
12	2831935698	Jishengella sp. AZ1-13	Isolate	Unclassified
13	2832004796	Micromonospora endophytica JCM 18317	Isolate	Unclassified
14	2852632344	Microbacterium sp. AK009	Isolate	Rhizosphere
15	2855670206	Micromonospora noduli Lupac 07	Isolate	Nodule
16	2855676851	Micromonospora saelicesensis GAR05	Isolate	Unclassified
17	2856741275	Microbispora triticiradicis NEAU-HRDPA2-9	Isolate	Unclassified
18	2857288857	Micromonospora noduli ONO23	Isolate	Unclassified
19	2857737099	Lysinimonas sp. R-73066	Isolate	Unclassified
20	2858848962	Micromonospora saelicesensis GAR06	Isolate	Unclassified
21	2858882152	Micromonospora noduli MED15	Isolate	Nodule
22	2858888857	Micromonospora saelicesensis Lupac 06	Isolate	Unclassified
23	2858895516	Micromonospora saelicesensis PSN13	Isolate	Unclassified
24	2866065130	Micromonospora endophytica DSM 45430	Isolate	Unclassified
25	2867428634	Streptomyces sp. RP5T	Isolate	Unclassified
26	2867507094	Micromonospora zingiberis PLAI 1-1	Isolate	Unclassified
27	2869048445	Micromonospora saelicesensis PSN01	Isolate	Unclassified
28	2869061728	Micromonospora noduli ONO86	Isolate	Unclassified
29	2869068681	Micromonospora noduli GUI43	Isolate	Unclassified
30	2880489317	Micromonospora ureilytica DSM 101692	Isolate	Unclassified
31	2880495981	Micromonospora vinacea DSM 101695	Isolate	Unclassified
32	2884693830	Nonomuraea phyllanthi WYY166	Isolate	Unclassified
33	2891395885	Microbispora catharanthi CR1-09	Isolate	Unclassified
34	2891554331	Microbispora sp. CL1-1	Isolate	Unclassified
35	2891562705	Microbispora tritici MT50	Isolate	Unclassified
36	2895442618	Nonomuraea phyllanthi PA1-10	Isolate	Unclassified
37	2929226422	Micromonospora sp. R-74116 Hybrid assembly	Isolate	Unclassified
38	2954711539	Streptomyces sp. SAI-090	Isolate	Rhizosphere
39	2954721474	Streptomyces sp. SAI-117	Isolate	Rhizosphere
40	2954731030	Streptomyces sp. SAI-133	Isolate	Rhizosphere
41	2954740390	Streptomyces sp. SAI-041	Isolate	Rhizosphere
42	2954749733	Streptomyces sp. SAI-135	Isolate	Rhizosphere
43	2954759201	Streptomyces sp. SAI-208	Isolate	Rhizosphere
44	2984580707	Microbacterium paludicola SORGH_AS919	Isolate	Aerial Root
45	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
46	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
47	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
48	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
49	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
50	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
51	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
52	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
53	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
54	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
55	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
56	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
57	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
58	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
59	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
60	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
61	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
62	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
63	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
64	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
65	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
66	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
67	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
68	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
69	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
70	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
71	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
72	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
73	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
74	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
75	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
76	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
77	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
78	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
79	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
80	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
81	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
82	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
83	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
84	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
85	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
86	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
87	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
88	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
89	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
90	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
91	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
92	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
93	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
94	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
95	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
96	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
97	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
98	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
99	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
100	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
101	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
102	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
103	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
104	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
105	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
106	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
107	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
108	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
109	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
110	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
111	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
112	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
113	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
114	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
115	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
116	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
117	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
118	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
119	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
120	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
121	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
122	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
164	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
165	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
166	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
167	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
168	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
169	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
170	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
171	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
172	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
173	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
174	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
175	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
176	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
177	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
178	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
179	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
180	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
181	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
182	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
183	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
184	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
185	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
186	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
187	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
188	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
189	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
190	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
191	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
192	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
193	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
194	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
195	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
196	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
197	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
198	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
199	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
200	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
201	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
202	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
203	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
204	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
205	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
206	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
207	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
208	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
209	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
210	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
211	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
212	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
213	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
214	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
215	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
216	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
217	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
218	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
219	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
220	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
221	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
222	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
223	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
224	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
225	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
226	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
227	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
228	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
229	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
230	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
231	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
232	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
233	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
234	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
235	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
236	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
237	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
238	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
239	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
240	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
241	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
242	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
243	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
244	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
245	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
246	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
247	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
248	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
249	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
250	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
251	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
252	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
253	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
254	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
255	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
256	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
257	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
258	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
259	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
260	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
261	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
262	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
263	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
264	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
265	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
266	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
267	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
268	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
269	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
270	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
271	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
272	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
273	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
274	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
275	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
276	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
277	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
278	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
279	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
280	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
281	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
282	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
283	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
284	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
285	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
286	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
287	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
288	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
289	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
290	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
291	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
292	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
293	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
294	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
295	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
296	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
297	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
298	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
299	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
300	8003314358	Amycolatopsis sp. MtRt-6	Isolate	Unclassified
301	8003830390	Micromonospora parastrephiae STR1_7	Isolate	Rhizosphere
302	8003870546	Micromonospora tarensis STR1s_6	Isolate	Rhizosphere
303	8054704163	Micromonospora trifolii NIE79	Isolate	Nodule
304	8054727385	Micromonospora alfalfae MED01	Isolate	Nodule
305	8054734606	Micromonospora hortensis NIE111	Isolate	Nodule
306	8055066027	Sphaerisporangium corydalis NEAU-YHS15	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	89.22
Metatranscriptomes	0.78
Isolates	10

Biome Distribution

Category	Percentage (%)
Aerial Root	0.2
Bulb	0
Endosphere	3.33
Nodule	0.98
Rhizoplane	5.1
Rhizosphere	78.43
Stem	0
Stem Tuber	0
Unclassified	11.96

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10004331	3300003203	Bacteria	6619
2	JGI25406J46586_10036417	3300003203	Bacteria	1785
3	JGI25165J46597_1002363	3300003214	Bacteria	6315
4	rootH1_10053068	3300003323	Bacteria	9548
5	Ga0070658_10000190	3300005327	Bacteria	54223
6	Ga0070658_10086066	3300005327	Bacteria	2585
7	Ga0070658_10152224	3300005327	Bacteria	1937
8	Ga0070658_10207053	3300005327	Bacteria	1656
9	Ga0070658_10265203	3300005327	Bacteria	1459
10	Ga0070658_10461520	3300005327	Bacteria	1095
11	Ga0070683_100002139	3300005329	Bacteria	15616
12	Ga0068869_100188112	3300005334	Bacteria	1622
13	Ga0070680_100165120	3300005336	Bacteria	1861
14	Ga0070682_100056092	3300005337	Bacteria	2477
15	Ga0068868_100014956	3300005338	Bacteria	5729
16	Ga0070660_100029597	3300005339	Bacteria	4105
17	Ga0070660_100491147	3300005339	Bacteria	1021
18	Ga0070661_100000540	3300005344	Bacteria	28990
19	Ga0070661_100014289	3300005344	Bacteria	5594
20	Ga0070661_100089977	3300005344	Bacteria	2273
21	Ga0070661_100111680	3300005344	Bacteria	2041
22	Ga0070668_100000364	3300005347	Bacteria	29898
23	Ga0070668_100069531	3300005347	Bacteria	2739
24	Ga0070669_100140239	3300005353	Bacteria	1863
25	Ga0070673_100271319	3300005364	Bacteria	1485
26	Ga0070659_100036755	3300005366	Bacteria	3818
27	Ga0070659_100131816	3300005366	Bacteria	2030
28	Ga0070659_100139290	3300005366	Bacteria	1975
29	Ga0070659_100292826	3300005366	Bacteria	1356
30	Ga0070714_100000333	3300005435	Bacteria	35502
31	Ga0070714_100067957	3300005435	Bacteria	3075
32	Ga0070714_100097351	3300005435	Bacteria	2586
33	Ga0070713_100042665	3300005436	Bacteria	3704
34	Ga0070713_100294717	3300005436	Bacteria	1492
35	Ga0070700_100057076	3300005441	Bacteria	2449
36	Ga0070663_100016589	3300005455	Bacteria	4789
37	Ga0070663_100178478	3300005455	Bacteria	1646
38	Ga0070678_100160688	3300005456	Bacteria	1820
39	Ga0070678_100403822	3300005456	Bacteria	1188
40	Ga0070662_100027759	3300005457	Bacteria	3934
41	Ga0070681_10018677	3300005458	Bacteria	6934
42	Ga0070707_100006979	3300005468	Bacteria	10470
43	Ga0070707_100008322	3300005468	Bacteria	9628
44	Ga0070699_100022343	3300005518	Bacteria	5451
45	Ga0070679_100030160	3300005530	Bacteria	5353
46	Ga0070679_100095145	3300005530	Bacteria	2966
47	Ga0070679_100139756	3300005530	Bacteria	2402
48	Ga0070679_100196765	3300005530	Bacteria	1983
49	Ga0070684_100019759	3300005535	Bacteria	5577
50	Ga0070684_100060843	3300005535	Bacteria	3304
51	Ga0070684_100322910	3300005535	Bacteria	1418
52	Ga0068853_100003075	3300005539	Bacteria	12746
53	Ga0068853_100004900	3300005539	Bacteria	10416
54	Ga0068853_100098088	3300005539	Bacteria	2588
55	Ga0070672_100242274	3300005543	Bacteria	1517
56	Ga0070693_100245108	3300005547	Bacteria	1185
57	Ga0070665_100007618	3300005548	Bacteria	11007
58	Ga0070665_100014954	3300005548	Bacteria	7790
59	Ga0070665_100032533	3300005548	Bacteria	5249
60	Ga0070665_100033672	3300005548	Bacteria	5155
61	Ga0070665_100041637	3300005548	Bacteria	4618
62	Ga0068855_100000400	3300005563	Bacteria	53569
63	Ga0068855_100009335	3300005563	Bacteria	11847
64	Ga0068855_100131620	3300005563	Bacteria	2856
65	Ga0068855_100412050	3300005563	Bacteria	1479
66	Ga0068857_100029417	3300005577	Bacteria	4848
67	Ga0068857_100031314	3300005577	Bacteria	4699
68	Ga0068857_100072681	3300005577	Bacteria	3065
69	Ga0068857_100224390	3300005577	Bacteria	1717
70	Ga0068854_100005496	3300005578	Bacteria	8005
71	Ga0068856_100110650	3300005614	Bacteria	2744
72	Ga0068856_100132296	3300005614	Bacteria	2499
73	Ga0068856_100179309	3300005614	Bacteria	2131
74	Ga0068856_100443720	3300005614	Bacteria	1318
75	Ga0068852_100000501	3300005616	Bacteria	25721
76	Ga0068852_100000952	3300005616	Bacteria	19050
77	Ga0068852_100003341	3300005616	Bacteria	11198
78	Ga0068852_100041211	3300005616	Bacteria	3901
79	Ga0068852_100187609	3300005616	Bacteria	1948
80	Ga0068852_100229103	3300005616	Bacteria	1770
81	Ga0068859_100305552	3300005617	Bacteria	1684
82	Ga0068864_100237766	3300005618	Bacteria	1687
83	Ga0068864_100529792	3300005618	Bacteria	1137
84	Ga0068851_10000929	3300005834	Bacteria	12645
85	Ga0068851_10053930	3300005834	Bacteria	2047
86	Ga0068851_10111876	3300005834	Bacteria	1458
87	Ga0068863_100019748	3300005841	Bacteria	6444
88	Ga0068862_100046608	3300005844	Bacteria	3698
89	Ga0081539_10000137	3300005985	Bacteria	171821
90	Ga0081539_10000527	3300005985	Bacteria	79552
91	Ga0081539_10007851	3300005985	Bacteria	9527
92	Ga0070717_10218316	3300006028	Bacteria	1675
93	Ga0075365_10043677	3300006038	Bacteria	2934
94	Ga0075365_10045722	3300006038	Bacteria	2873
95	Ga0075365_10055756	3300006038	Bacteria	2625
96	Ga0075365_10057195	3300006038	Bacteria	2594
97	Ga0075365_10163318	3300006038	Bacteria	1553
98	Ga0075364_10089924	3300006051	Bacteria	2036
99	Ga0070712_100296133	3300006175	Bacteria	1308
100	Ga0075367_10006004	3300006178	Bacteria	6100
101	Ga0075366_10096174	3300006195	Bacteria	1775
102	Ga0097621_100245822	3300006237	Bacteria	1565
103	Ga0075370_10163823	3300006353	Bacteria	1305
104	Ga0068871_100698747	3300006358	Bacteria	929
105	Ga0075434_100081877	3300006871	Bacteria	3225
106	Ga0068865_100215274	3300006881	Bacteria	1499
107	Ga0075436_100306320	3300006914	Bacteria	1139
108	Ga0097620_100305576	3300006931	Bacteria	1684
109	Ga0075435_100026980	3300007076	Bacteria	4488
110	Ga0105240_10034029	3300009093	Bacteria	6577
111	Ga0105240_10068852	3300009093	Bacteria	4383
112	Ga0105240_10146252	3300009093	Bacteria	2820
113	Ga0105240_10298464	3300009093	Bacteria	1844
114	Ga0105240_10505697	3300009093	Bacteria	1343
115	Ga0105245_10346979	3300009098	Bacteria	1470
116	Ga0105245_10380876	3300009098	Bacteria	1405
117	Ga0105247_10325274	3300009101	Bacteria	1074
118	Ga0114129_10114599	3300009147	Bacteria	3717
119	Ga0105243_10000331	3300009148	Bacteria	51618
120	Ga0105241_10047142	3300009174	Bacteria	3276
121	Ga0105241_10056843	3300009174	Bacteria	3000
122	Ga0105241_10515856	3300009174	Bacteria	1068
123	Ga0105241_10578960	3300009174	Bacteria	1012
124	Ga0105237_10001185	3300009545	Bacteria	34865
125	Ga0105238_10007395	3300009551	Bacteria	11003
126	Ga0105238_10033018	3300009551	Bacteria	5267
127	Ga0105238_10628963	3300009551	Bacteria	1083
128	Ga0105239_10001229	3300010375	Bacteria	34896
129	Ga0105239_10041407	3300010375	Bacteria	5049
130	Ga0105239_10041754	3300010375	Bacteria	5026
131	Ga0105239_10074285	3300010375	Bacteria	3738
132	Ga0105239_10153021	3300010375	Bacteria	2575
133	Ga0105239_10335937	3300010375	Bacteria	1705
134	Ga0105239_10490695	3300010375	Bacteria	1396
135	Ga0105239_10624013	3300010375	Bacteria	1230
136	Ga0157373_10285818	3300013100	Bacteria	1169
137	Ga0157371_10003687	3300013102	Bacteria	13751
138	Ga0157371_10273424	3300013102	Bacteria	1219
139	Ga0157370_10004358	3300013104	Bacteria	16255
140	Ga0157370_10009666	3300013104	Bacteria	10257
141	Ga0157370_10025616	3300013104	Bacteria	5837
142	Ga0157370_10066804	3300013104	Bacteria	3400
143	Ga0157370_10274360	3300013104	Bacteria	1558
144	Ga0157369_10016321	3300013105	Bacteria	8358
145	Ga0157369_10025640	3300013105	Bacteria	6543
146	Ga0157369_10035613	3300013105	Bacteria	5456
147	Ga0157374_10106405	3300013296	Bacteria	2695
148	Ga0157378_10240250	3300013297	Bacteria	1730
149	Ga0157372_10013631	3300013307	Bacteria	8688
150	Ga0157372_10408415	3300013307	Bacteria	1582
151	Ga0157372_10495415	3300013307	Bacteria	1425
152	Ga0157372_11001645	3300013307	Bacteria	968
153	Ga0157375_10114934	3300013308	Bacteria	2794
154	Ga0157375_10661737	3300013308	Bacteria	1200
155	Ga0163163_10245972	3300014325	Bacteria	1839
156	Ga0206356_10188722	3300020070	Bacteria	2170
157	Ga0206350_10584386	3300020080	Bacteria	1486
158	Ga0154015_1080299	3300020610	Bacteria	1613
159	Ga0224712_10041556	3300022467	Bacteria	1737
160	Ga0207427_102855	3300025231	Bacteria	4156
161	Ga0209233_1001557	3300025261	Bacteria	8964
162	Ga0207656_10000992	3300025321	Bacteria	9263
163	Ga0207705_10000001	3300025909	Bacteria	2061880
164	Ga0207705_10068717	3300025909	Bacteria	2565
165	Ga0207705_10172556	3300025909	Bacteria	1629
166	Ga0207705_10217766	3300025909	Bacteria	1449
167	Ga0207654_10081386	3300025911	Bacteria	1950
168	Ga0207707_10046206	3300025912	Bacteria	3792
169	Ga0207695_10038289	3300025913	Bacteria	5165
170	Ga0207695_10119393	3300025913	Bacteria	2607
171	Ga0207695_10193656	3300025913	Bacteria	1950
172	Ga0207671_10003785	3300025914	Bacteria	14859
173	Ga0207693_10131192	3300025915	Bacteria	1970
174	Ga0207660_10009320	3300025917	Bacteria	6355
175	Ga0207657_10006871	3300025919	Bacteria	11741
176	Ga0207657_10015594	3300025919	Bacteria	7353
177	Ga0207657_10059675	3300025919	Bacteria	3276
178	Ga0207657_10068043	3300025919	Bacteria	3026
179	Ga0207649_10047508	3300025920	Bacteria	2642
180	Ga0207649_10125983	3300025920	Bacteria	1733
181	Ga0207652_10007148	3300025921	Bacteria	9002
182	Ga0207652_10465873	3300025921	Bacteria	1139
183	Ga0207646_10003883	3300025922	Bacteria	16591
184	Ga0207646_10065424	3300025922	Bacteria	3246
185	Ga0207694_10047153	3300025924	Bacteria	3332
186	Ga0207694_10076506	3300025924	Bacteria	2621
187	Ga0207694_10403871	3300025924	Bacteria	1136
188	Ga0207659_10330131	3300025926	Bacteria	1261
189	Ga0207687_10526672	3300025927	Bacteria	989
190	Ga0207687_10631315	3300025927	Bacteria	905
191	Ga0207700_10090127	3300025928	Bacteria	2419
192	Ga0207664_10001237	3300025929	Bacteria	16918
193	Ga0207690_10010886	3300025932	Bacteria	5421
194	Ga0207690_10051357	3300025932	Bacteria	2757
195	Ga0207690_10056723	3300025932	Bacteria	2643
196	Ga0207706_10036433	3300025933	Bacteria	4370
197	Ga0207709_10001790	3300025935	Bacteria	14397
198	Ga0207704_10254110	3300025938	Bacteria	1321
199	Ga0207691_10128760	3300025940	Bacteria	2237
200	Ga0207661_10004731	3300025944	Bacteria	9534
201	Ga0207661_10011135	3300025944	Bacteria	6504
202	Ga0207667_10000437	3300025949	Bacteria	55848
203	Ga0207667_10000532	3300025949	Bacteria	50220
204	Ga0207667_10008673	3300025949	Bacteria	12051
205	Ga0207667_10021812	3300025949	Bacteria	7088
206	Ga0207667_10089820	3300025949	Bacteria	3175
207	Ga0207667_10394829	3300025949	Bacteria	1408
208	Ga0207651_10502047	3300025960	Bacteria	1049
209	Ga0207668_10000326	3300025972	Bacteria	30849
210	Ga0207668_10140276	3300025972	Bacteria	1857
211	Ga0207640_10186336	3300025981	Bacteria	1560
212	Ga0207639_10000588	3300026041	Bacteria	25039
213	Ga0207639_10015100	3300026041	Bacteria	5441
214	Ga0207639_10189139	3300026041	Bacteria	1757
215	Ga0207678_10000555	3300026067	Bacteria	34090
216	Ga0207678_10087398	3300026067	Bacteria	2664
217	Ga0207708_10081936	3300026075	Bacteria	2480
218	Ga0207702_10003356	3300026078	Bacteria	14683
219	Ga0207702_10072114	3300026078	Bacteria	2976
220	Ga0207641_10448442	3300026088	Bacteria	1246
221	Ga0207648_10034236	3300026089	Bacteria	4478
222	Ga0207676_10084052	3300026095	Bacteria	2594
223	Ga0207674_10003198	3300026116	Bacteria	20166
224	Ga0207674_10005405	3300026116	Bacteria	15189
225	Ga0207674_10057801	3300026116	Bacteria	3932
226	Ga0207674_10087562	3300026116	Bacteria	3108
227	Ga0207683_10201671	3300026121	Bacteria	1809
228	Ga0207683_10561121	3300026121	Bacteria	1056
229	Ga0207698_10000078	3300026142	Bacteria	65050
230	Ga0207698_10015926	3300026142	Bacteria	5055
231	Ga0207698_10271119	3300026142	Bacteria	1564
232	Ga0268266_10002120	3300028379	Bacteria	21911
233	Ga0268265_10031669	3300028380	Bacteria	3821
234	Ga0265318_10077008	3300028577	Bacteria	1233
235	Ga0307515_10176136	3300028794	Bacteria	2109
236	Ga0265338_10005493	3300028800	Bacteria	16522
237	Ga0265338_10034299	3300028800	Bacteria	4908
238	Ga0265324_10041117	3300029957	Bacteria	1600
239	Ga0307512_10017409	3300030522	Bacteria	6595
240	Ga0265330_10008802	3300031235	Bacteria	4834
241	Ga0265325_10001088	3300031241	Bacteria	19556
242	Ga0265329_10006576	3300031242	Bacteria	4601
243	Ga0265339_10003915	3300031249	Bacteria	10307
244	Ga0265316_10008148	3300031344	Bacteria	9752
245	Ga0307513_10052908	3300031456	Bacteria	4368
246	Ga0265313_10000586	3300031595	Bacteria	37862
247	Ga0307508_10227756	3300031616	Bacteria	1463
248	Ga0265314_10022606	3300031711	Bacteria	4816
249	Ga0265342_10045153	3300031712	Bacteria	2653
250	Ga0316576_10181589	3300031727	Bacteria	1587
251	Ga0307413_10152402	3300031824	Bacteria	1613
252	Ga0307413_10220383	3300031824	Bacteria	1385
253	Ga0307406_10039647	3300031901	Bacteria	2924
254	Ga0307406_10078938	3300031901	Bacteria	2182
255	Ga0307406_10434541	3300031901	Bacteria	1049
256	Ga0307407_10326487	3300031903	Bacteria	1079
257	Ga0307409_100147486	3300031995	Bacteria	2037
258	Ga0307416_100685134	3300032002	Bacteria	1113
259	Ga0307414_10028440	3300032004	Bacteria	3627
260	Ga0307415_100017439	3300032126	Bacteria	4306
261	Ga0307415_100035318	3300032126	Bacteria	3264
262	Ga0307415_100148484	3300032126	Bacteria	1801
263	Ga0307415_100254018	3300032126	Bacteria	1430
264	Ga0307507_10048094	3300033179	Bacteria	4155
265	Ga0373951_0000052	3300035091	Bacteria	46256
266	Ga0373955_0060643	3300035172	Bacteria	2087
267	Ga0373955_0093290	3300035172	Bacteria	1719
268	Ga0373942_0034146	3300035207	Bacteria	1360
269	Ga0373935_0095228	3300035692	Bacteria	1955
270	Ga0373933_0011363	3300035724	Bacteria	4904
271	Ga0373933_0023693	3300035724	Bacteria	3510
272	Ga0373937_0027357	3300036401	Bacteria	5156
273	Ga0373937_0363241	3300036401	Bacteria	1372
274	Ga0373937_0518574	3300036401	Bacteria	1132
275	Ga0373925_0005256	3300037068	Bacteria	9666
276	Ga0373925_0230820	3300037068	Bacteria	1480
277	Ga0395900_0008026	3300037418	Bacteria	10864
278	Ga0395900_0615986	3300037418	Bacteria	1025
279	Ga0395898_0004052	3300037466	Bacteria	16102
280	Ga0395898_0018602	3300037466	Bacteria	7083
281	Ga0395898_0296086	3300037466	Bacteria	1543
282	Ga0451789_0551925	3300041443	Bacteria	1309
283	Ga0451791_1211720	3300041451	Bacteria	1704
284	Ga0451793_0879711	3300041452	Bacteria	1602
285	Ga0451807_1930859	3300041486	Bacteria	1531
286	Ga0451807_2346010	3300041486	Bacteria	1083
287	Ga0451833_0988843	3300041491	Bacteria	1519
288	Ga0451577_0166631	3300042876	Bacteria	1985
289	Ga0466969_0010779	3300044656	Bacteria	4842
290	Ga0466969_0018672	3300044656	Bacteria	3611
291	Ga0466972_0078422	3300044658	Bacteria	1573
292	Ga0466965_0004879	3300044683	Bacteria	5989
293	Ga0466965_0007467	3300044683	Bacteria	5022
294	Ga0466963_0032795	3300044694	Bacteria	3366
295	Ga0466963_0041111	3300044694	Bacteria	3031
296	Ga0466963_0047475	3300044694	Bacteria	2834
297	Ga0466963_0134021	3300044694	Bacteria	1713
298	Ga0466964_0023378	3300044706	Bacteria	2403
299	Ga0453684_0642818	3300044712	Bacteria	1158
300	Ga0466970_0012851	3300044765	Bacteria	4287
301	Ga0466970_0070981	3300044765	Bacteria	1873
302	Ga0466957_0317202	3300044842	Bacteria	1051
303	Ga0466960_0039053	3300044901	Bacteria	2237
304	Ga0466959_0006932	3300045049	Bacteria	7913
305	Ga0466967_0006935	3300045976	Bacteria	8102
306	Ga0466967_0008576	3300045976	Bacteria	7510
307	Ga0466967_0042317	3300045976	Bacteria	3935
308	Ga0466967_0070341	3300045976	Bacteria	3131
309	Ga0495592_0072481	3300046454	Bacteria	2506
310	Ga0495592_0085610	3300046454	Bacteria	2272
311	Ga0495592_0127208	3300046454	Bacteria	1786
312	Ga0495592_0296740	3300046454	Bacteria	1052
313	Ga0495603_0072939	3300046455	Bacteria	2017
314	Ga0495641_0037196	3300046461	Bacteria	2283
315	Ga0495651_0034866	3300046462	Bacteria	3921
316	Ga0495651_0037123	3300046462	Bacteria	3794
317	Ga0495651_0157434	3300046462	Bacteria	1631
318	Ga0495653_0010115	3300046463	Bacteria	7719
319	Ga0495653_0126636	3300046463	Bacteria	1813
320	Ga0495582_0062993	3300046473	Bacteria	2049
321	Ga0495664_0024912	3300046477	Bacteria	3480
322	Ga0495594_0091935	3300046499	Bacteria	1701
323	Ga0495608_0025092	3300046511	Bacteria	4071
324	Ga0495608_0084199	3300046511	Bacteria	2063
325	Ga0495618_0083181	3300046514	Bacteria	2045
326	Ga0495618_0195560	3300046514	Bacteria	1281
327	Ga0495618_0228758	3300046514	Bacteria	1171
328	Ga0495630_0002316	3300046517	Bacteria	13237
329	Ga0495630_0005223	3300046517	Bacteria	9152
330	Ga0495630_0143299	3300046517	Bacteria	1817
331	Ga0495652_0072218	3300046529	Bacteria	2877
332	Ga0495640_0064707	3300046533	Bacteria	2471
333	Ga0495645_0071736	3300046543	Bacteria	2497
334	Ga0495667_0043834	3300046559	Bacteria	2964
335	Ga0495667_0054224	3300046559	Bacteria	2638
336	Ga0495667_0097249	3300046559	Bacteria	1906
337	Ga0495667_0242616	3300046559	Bacteria	1147
338	Ga0495634_0022589	3300046642	Bacteria	4432
339	Ga0495634_0022752	3300046642	Bacteria	4415
340	Ga0495634_0156240	3300046642	Bacteria	1440
341	Ga0495634_0172683	3300046642	Bacteria	1358
342	Ga0495635_0010873	3300046663	Bacteria	6378
343	Ga0495635_0106100	3300046663	Bacteria	1919
344	Ga0495657_0018766	3300046675	Bacteria	4999
345	Ga0495657_0026956	3300046675	Bacteria	4063
346	Ga0495599_0106970	3300046678	Bacteria	1743
347	Ga0495647_0022968	3300046681	Bacteria	2258
348	Ga0495613_0063517	3300046689	Bacteria	2702
349	Ga0495613_0422630	3300046689	Bacteria	907
350	Ga0495600_0122097	3300046809	Bacteria	1694
351	Ga0495674_0009094	3300047319	Bacteria	9437
352	Ga0495674_0026631	3300047319	Bacteria	5291
353	Ga0495676_0050481	3300047321	Bacteria	3336
354	Ga0495680_0003994	3300047322	Bacteria	14252
355	Ga0495680_0011021	3300047322	Bacteria	8032
356	Ga0495680_0214770	3300047322	Bacteria	1375
357	Ga0495684_0034599	3300047471	Bacteria	3876
358	Ga0495684_0118153	3300047471	Bacteria	1998
359	Ga0495686_0191499	3300047472	Bacteria	1179
360	Ga0496100_0201533	3300048903	Bacteria	1451
361	Ga0496102_0185637	3300048905	Bacteria	1960
362	Ga0496102_0506788	3300048905	Bacteria	1129
363	Ga0496104_0110219	3300048907	Bacteria	2639
364	Ga0496104_0391964	3300048907	Bacteria	1301
365	Ga0496105_0112027	3300048908	Bacteria	2252
366	Ga0496105_0205405	3300048908	Bacteria	1607
367	Ga0496108_0004832	3300048911	Bacteria	10872
368	Ga0496108_0132615	3300048911	Bacteria	2141
369	Ga0496108_0576188	3300048911	Bacteria	981
370	Ga0496109_0276218	3300048912	Bacteria	1583
371	Ga0496109_0676838	3300048912	Bacteria	969
372	Ga0496111_0013069	3300048914	Bacteria	5639
373	Ga0496112_0095637	3300048915	Bacteria	2941
374	Ga0496112_0166689	3300048915	Bacteria	2169
375	Ga0496112_0211481	3300048915	Bacteria	1896
376	Ga0496113_0138039	3300048916	Bacteria	1917
377	Ga0496114_0312608	3300048917	Bacteria	1388
378	Ga0496115_0000994	3300048918	Bacteria	20527
379	Ga0496115_0062429	3300048918	Bacteria	3005
380	Ga0496115_0414295	3300048918	Bacteria	1092
381	Ga0496117_0022169	3300048920	Bacteria	5100
382	Ga0496117_0084511	3300048920	Bacteria	2070
383	Ga0496118_0013288	3300048921	Bacteria	7803
384	Ga0496118_0131341	3300048921	Bacteria	1607
385	Ga0496119_0007381	3300048922	Bacteria	9924
386	Ga0496119_0078558	3300048922	Bacteria	1908
387	Ga0496120_0000929	3300048923	Bacteria	40563
388	Ga0496120_0002952	3300048923	Bacteria	16205
389	Ga0496121_0182787	3300048924	Bacteria	1511
390	Ga0496122_0002788	3300048925	Bacteria	24032
391	Ga0496122_0005141	3300048925	Bacteria	15782
392	Ga0496122_0006894	3300048925	Bacteria	12848
393	Ga0496123_0013067	3300048926	Bacteria	7008
394	Ga0496124_0015218	3300048927	Bacteria	7383
395	Ga0496125_0000047	3300048928	Bacteria	294084
396	Ga0496125_0000297	3300048928	Bacteria	97897
397	Ga0496125_0085106	3300048928	Bacteria	2397
398	Ga0496126_0031407	3300048929	Bacteria	5018
399	Ga0496126_0074636	3300048929	Bacteria	3011
400	Ga0496126_0121271	3300048929	Bacteria	2267
401	Ga0496126_0203827	3300048929	Bacteria	1669
402	Ga0501031_0004202	3300049568	Bacteria	9306
403	Ga0501031_0053093	3300049568	Bacteria	2640
404	Ga0501032_0022470	3300049569	Bacteria	4371
405	Ga0501033_0042552	3300049570	Bacteria	3386
406	Ga0501034_0018270	3300049571	Bacteria	7191
407	Ga0501036_0010012	3300049572	Bacteria	7810
408	Ga0501036_0024164	3300049572	Bacteria	5122
409	Ga0501037_0007992	3300049573	Bacteria	7752
410	Ga0501037_0081385	3300049573	Bacteria	2348
411	Ga0501038_0005241	3300049574	Bacteria	12048
412	Ga0501039_0025526	3300049575	Bacteria	4540
413	Ga0501039_0189512	3300049575	Bacteria	1617
414	Ga0501039_0228528	3300049575	Bacteria	1463
415	Ga0501042_0133966	3300049578	Bacteria	1786
416	Ga0501042_0278516	3300049578	Bacteria	1208
417	Ga0501043_0024260	3300049579	Bacteria	4759
418	Ga0501043_0409920	3300049579	Bacteria	1023
419	Ga0501046_0002711	3300049580	Bacteria	16484
420	Ga0501047_0292096	3300049581	Bacteria	1474
421	Ga0501047_0325692	3300049581	Bacteria	1375
422	Ga0501067_0015018	3300049583	Bacteria	4285
423	Ga0501068_0012730	3300049584	Bacteria	4775
424	Ga0501069_0087961	3300049585	Bacteria	1755
425	Ga0501070_0010197	3300049586	Bacteria	7949
426	Ga0501070_0023548	3300049586	Bacteria	5159
427	Ga0501070_0043990	3300049586	Bacteria	3716
428	Ga0501071_0086757	3300049587	Bacteria	2296
429	Ga0501072_0014658	3300049588	Bacteria	6009
430	Ga0501073_0020778	3300049589	Bacteria	4734
431	Ga0501074_0077737	3300049590	Bacteria	2382
432	Ga0501079_0061451	3300049741	Bacteria	2898
433	Ga0501080_0011068	3300049742	Bacteria	8256
434	Ga0501080_0237034	3300049742	Bacteria	1666
435	Ga0501083_0097534	3300049744	Bacteria	1939
436	Ga0501035_0023227	3300049822	Bacteria	5688
437	Ga0501035_0075991	3300049822	Bacteria	2970
438	Ga0501035_0265665	3300049822	Bacteria	1453
439	Ga0501044_0030531	3300049823	Bacteria	5679
440	Ga0501044_0117538	3300049823	Bacteria	2663
441	Ga0501044_0125045	3300049823	Bacteria	2569
442	Ga0501045_0234125	3300049824	Bacteria	1367
443	nmdc:mga0yw44_24100_c1	3300050492	Bacteria	3439
444	nmdc:mga0k408_199375_c1	3300050493	Bacteria	1195
445	nmdc:mga05p37_866815_c1	3300050507	Bacteria	978
446	nmdc:mga0n895_79309_c1	3300050512	Bacteria	3270
447	nmdc:mga0rr50_294086_c1	3300050513	Bacteria	1357
448	nmdc:mga08x19_216133_c1	3300050514	Bacteria	1316
449	nmdc:mga08x19_277485_c1	3300050514	Bacteria	1161
450	Ga0495601_0172021	3300053077	Bacteria	1416
451	Ga0495619_0157873	3300053085	Bacteria	1566
452	Ga0495619_0162443	3300053085	Bacteria	1543
453	Ga0495619_0176664	3300053085	Bacteria	1477
454	Ga0495619_0188464	3300053085	Bacteria	1428
455	Ga0500595_030729	3300053119	Bacteria	1807
456	Ga0500568_0011910	3300053139	Bacteria	4014
457	Ga0500589_153096	3300053147	Bacteria	936
458	Ga0501084_0027454	3300054114	Bacteria	4756
459	Ga0501082_0008347	3300060353	Bacteria	8933

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048920	Ga0496117_0084511	Ga0496117_0084511_1349_2041	221
2	3300053119	Ga0500595_030729	Ga0500595_030729_43_921	221
3	3300025926	Ga0207659_10330131	Ga0207659_103301312	234
4	3300005339	Ga0070660_100491147	Ga0070660_1004911471	240
5	3300005344	Ga0070661_100000540	Ga0070661_10000054026	240
6	3300005539	Ga0068853_100004900	Ga0068853_1000049008	240
7	3300005578	Ga0068854_100005496	Ga0068854_1000054964	240
8	3300005616	Ga0068852_100000952	Ga0068852_10000095215	240
9	3300005834	Ga0068851_10000929	Ga0068851_100009295	240
10	3300009093	Ga0105240_10034029	Ga0105240_100340293	240
11	3300009174	Ga0105241_10047142	Ga0105241_100471423	240
12	3300009551	Ga0105238_10033018	Ga0105238_100330183	240
13	3300025321	Ga0207656_10000992	Ga0207656_100009928	240
14	3300025911	Ga0207654_10081386	Ga0207654_100813861	240
15	3300025913	Ga0207695_10193656	Ga0207695_101936561	240
16	3300025924	Ga0207694_10047153	Ga0207694_100471533	240
17	3300026041	Ga0207639_10000588	Ga0207639_100005885	240
18	3300026142	Ga0207698_10015926	Ga0207698_100159263	240
19	3300010375	Ga0105239_10041754	Ga0105239_100417545	241
20	3300006038	Ga0075365_10043677	Ga0075365_100436773	242
21	3300049583	Ga0501067_0015018	Ga0501067_0015018_2475_3320	242
22	3300049742	Ga0501080_0011068	Ga0501080_0011068_4292_5137	242
23	3300005344	Ga0070661_100014289	Ga0070661_1000142892	243
24	3300006038	Ga0075365_10055756	Ga0075365_100557563	243
25	3300026089	Ga0207648_10034236	Ga0207648_100342363	243
26	3300025981	Ga0207640_10186336	Ga0207640_101863362	244
27	3300005327	Ga0070658_10207053	Ga0070658_102070532	245
28	3300005339	Ga0070660_100029597	Ga0070660_1000295971	245
29	3300005344	Ga0070661_100089977	Ga0070661_1000899772	245
30	3300005366	Ga0070659_100139290	Ga0070659_1001392901	245
31	3300005539	Ga0068853_100098088	Ga0068853_1000980882	245
32	3300005614	Ga0068856_100132296	Ga0068856_1001322963	245
33	3300005616	Ga0068852_100041211	Ga0068852_1000412113	245
34	3300009093	Ga0105240_10146252	Ga0105240_101462522	245
35	3300009551	Ga0105238_10007395	Ga0105238_100073956	245
36	3300010375	Ga0105239_10153021	Ga0105239_101530213	245
37	3300013104	Ga0157370_10066804	Ga0157370_100668043	245
38	3300013105	Ga0157369_10035613	Ga0157369_100356135	245
39	3300013307	Ga0157372_11001645	Ga0157372_110016451	245
40	3300025909	Ga0207705_10068717	Ga0207705_100687171	245
41	3300025913	Ga0207695_10038289	Ga0207695_100382894	245
42	3300025919	Ga0207657_10015594	Ga0207657_100155941	245
43	3300025920	Ga0207649_10125983	Ga0207649_101259832	245
44	3300025924	Ga0207694_10076506	Ga0207694_100765062	245
45	3300025932	Ga0207690_10056723	Ga0207690_100567232	245
46	3300025949	Ga0207667_10000532	Ga0207667_1000053210	245
47	3300026041	Ga0207639_10189139	Ga0207639_101891392	245
48	3300048921	Ga0496118_0131341	Ga0496118_0131341_456_1280	245
49	3300053085	Ga0495619_0162443	Ga0495619_0162443_16_756	246
50	3300006038	Ga0075365_10045722	Ga0075365_100457223	248
51	3300003203	JGI25406J46586_10036417	JGI25406J46586_100364172	249
52	3300005539	Ga0068853_100003075	Ga0068853_1000030759	249
53	3300005563	Ga0068855_100000400	Ga0068855_10000040017	249
54	3300005563	Ga0068855_100009335	Ga0068855_1000093352	249
55	3300005616	Ga0068852_100000501	Ga0068852_1000005017	249
56	3300005985	Ga0081539_10000527	Ga0081539_100005272	249
57	3300025949	Ga0207667_10000437	Ga0207667_100004375	249
58	3300025949	Ga0207667_10008673	Ga0207667_1000867314	249
59	3300026041	Ga0207639_10015100	Ga0207639_100151005	249
60	3300026142	Ga0207698_10000078	Ga0207698_1000007828	249
61	3300041452	Ga0451793_0879711	Ga0451793_0879711_436_1260	249
62	3300048920	Ga0496117_0022169	Ga0496117_0022169_3476_4300	249
63	3300048921	Ga0496118_0013288	Ga0496118_0013288_6121_6945	249
64	3300048922	Ga0496119_0007381	Ga0496119_0007381_8199_9023	249
65	3300048923	Ga0496120_0000929	Ga0496120_0000929_38834_39658	249
66	3300048923	Ga0496120_0002952	Ga0496120_0002952_14501_15325	249
67	3300048929	Ga0496126_0121271	Ga0496126_0121271_1404_2228	249
68	3300048925	Ga0496122_0006894	Ga0496122_0006894_3091_3915	250
69	3300048926	Ga0496123_0013067	Ga0496123_0013067_539_1363	250
70	3300009093	Ga0105240_10505697	Ga0105240_105056972	254
71	3300005364	Ga0070673_100271319	Ga0070673_1002713192	255
72	3300005456	Ga0070678_100403822	Ga0070678_1004038222	255
73	3300006237	Ga0097621_100245822	Ga0097621_1002458222	255
74	3300013308	Ga0157375_10661737	Ga0157375_106617371	255
75	3300014325	Ga0163163_10245972	Ga0163163_102459722	255
76	3300025940	Ga0207691_10128760	Ga0207691_101287602	255
77	3300025960	Ga0207651_10502047	Ga0207651_105020472	255
78	3300026121	Ga0207683_10561121	Ga0207683_105611211	255
79	3300013105	Ga0157369_10025640	Ga0157369_100256404	256
80	3300020080	Ga0206350_10584386	Ga0206350_105843862	256
81	3300046454	Ga0495592_0127208	Ga0495592_0127208_853_1623	256
82	3300046559	Ga0495667_0242616	Ga0495667_0242616_28_798	256
83	3300046642	Ga0495634_0172683	Ga0495634_0172683_67_837	256
84	3300046689	Ga0495613_0063517	Ga0495613_0063517_1439_2209	256
85	3300048907	Ga0496104_0391964	Ga0496104_0391964_409_1179	256
86	3300048918	Ga0496115_0062429	Ga0496115_0062429_942_1766	256
87	3300053085	Ga0495619_0176664	Ga0495619_0176664_399_1169	256
88	3300005327	Ga0070658_10000190	Ga0070658_1000019042	258
89	3300005327	Ga0070658_10265203	Ga0070658_102652033	258
90	3300005344	Ga0070661_100111680	Ga0070661_1001116802	258
91	3300005366	Ga0070659_100036755	Ga0070659_1000367554	258
92	3300005366	Ga0070659_100131816	Ga0070659_1001318162	258
93	3300005455	Ga0070663_100016589	Ga0070663_1000165894	258
94	3300005457	Ga0070662_100027759	Ga0070662_1000277594	258
95	3300005563	Ga0068855_100412050	Ga0068855_1004120502	258
96	3300005616	Ga0068852_100229103	Ga0068852_1002291032	258
97	3300005834	Ga0068851_10053930	Ga0068851_100539302	258
98	3300009174	Ga0105241_10056843	Ga0105241_100568432	258
99	3300009174	Ga0105241_10515856	Ga0105241_105158561	258
100	3300010375	Ga0105239_10074285	Ga0105239_100742852	258
101	3300013104	Ga0157370_10004358	Ga0157370_100043585	258
102	3300013297	Ga0157378_10240250	Ga0157378_102402502	258
103	3300025909	Ga0207705_10000001	Ga0207705_100000011172	258
104	3300025909	Ga0207705_10217766	Ga0207705_102177662	258
105	3300025919	Ga0207657_10068043	Ga0207657_100680433	258
106	3300025932	Ga0207690_10010886	Ga0207690_100108865	258
107	3300025933	Ga0207706_10036433	Ga0207706_100364332	258
108	3300025949	Ga0207667_10089820	Ga0207667_100898202	258
109	3300026116	Ga0207674_10005405	Ga0207674_1000540513	258
110	3300035207	Ga0373942_0034146	Ga0373942_0034146_100_969	258
111	3300044683	Ga0466965_0007467	Ga0466965_0007467_781_1605	258
112	3300005468	Ga0070707_100006979	Ga0070707_1000069795	259
113	3300005468	Ga0070707_100008322	Ga0070707_1000083226	259
114	3300005518	Ga0070699_100022343	Ga0070699_1000223434	259
115	3300005985	Ga0081539_10007851	Ga0081539_100078518	259
116	3300025915	Ga0207693_10131192	Ga0207693_101311922	259
117	3300025920	Ga0207649_10047508	Ga0207649_100475082	259
118	3300025922	Ga0207646_10003883	Ga0207646_1000388313	259
119	3300025922	Ga0207646_10065424	Ga0207646_100654242	259
120	3300026078	Ga0207702_10072114	Ga0207702_100721143	259
121	3300028800	Ga0265338_10034299	Ga0265338_100342993	259
122	3300048905	Ga0496102_0506788	Ga0496102_0506788_239_1018	259
123	3300048911	Ga0496108_0576188	Ga0496108_0576188_54_833	259
124	3300048912	Ga0496109_0676838	Ga0496109_0676838_86_865	259
125	3300048928	Ga0496125_0085106	Ga0496125_0085106_867_1691	259
126	3300049586	Ga0501070_0023548	Ga0501070_0023548_3985_4839	259
127	3300049822	Ga0501035_0023227	Ga0501035_0023227_671_1561	259
128	3300049823	Ga0501044_0030531	Ga0501044_0030531_641_1531	259
129	3300044694	Ga0466963_0032795	Ga0466963_0032795_20_802	260
130	3300037418	Ga0395900_0008026	Ga0395900_0008026_2011_2799	262
131	3300037466	Ga0395898_0004052	Ga0395898_0004052_9749_10537	262
132	3300046454	Ga0495592_0296740	Ga0495592_0296740_20_808	262
133	3300046663	Ga0495635_0106100	Ga0495635_0106100_11_799	262
134	3300025927	Ga0207687_10631315	Ga0207687_106313151	263
135	3300048929	Ga0496126_0203827	Ga0496126_0203827_767_1591	264
136	3300031456	Ga0307513_10052908	Ga0307513_100529081	265
137	3300047472	Ga0495686_0191499	Ga0495686_0191499_54_878	265
138	3300006353	Ga0075370_10163823	Ga0075370_101638232	266
139	iso_pu_bacteria	2643221591	2643964607	266
140	iso_pu_bacteria	2643221629	2644169598	266
141	iso_pu_bacteria	2643221662	2644350234	266
142	3300005530	Ga0070679_100095145	Ga0070679_1000951452	267
143	3300003214	JGI25165J46597_1002363	JGI25165J46597_10023636	268
144	3300025231	Ga0207427_102855	Ga0207427_1028553	268
145	3300025261	Ga0209233_1001557	Ga0209233_10015575	268
146	3300032126	Ga0307415_100254018	Ga0307415_1002540182	268
147	3300048925	Ga0496122_0002788	Ga0496122_0002788_10847_11671	268
148	3300031824	Ga0307413_10152402	Ga0307413_101524022	269
149	3300031995	Ga0307409_100147486	Ga0307409_1001474863	269
150	3300032004	Ga0307414_10028440	Ga0307414_100284403	270
151	3300048914	Ga0496111_0013069	Ga0496111_0013069_3338_4162	270
152	3300048924	Ga0496121_0182787	Ga0496121_0182787_506_1330	270
153	3300048928	Ga0496125_0000297	Ga0496125_0000297_2328_3152	270
154	3300049573	Ga0501037_0081385	Ga0501037_0081385_691_1515	270
155	3300049575	Ga0501039_0228528	Ga0501039_0228528_466_1290	270
156	iso_pu_bacteria	2675903060	2676495301	270
157	iso_pu_bacteria	2731639228	2731907517	270
158	iso_pu_bacteria	2772190715	2772647030	270
159	iso_pu_bacteria	2773857759	2774382891	270
160	iso_pu_bacteria	2799112218	2799183706	270
161	iso_pu_bacteria	2808606306	2808630190	270
162	iso_pu_bacteria	2808606447	2809228150	270
163	iso_pu_bacteria	2811994880	2812362985	270
164	iso_pu_bacteria	2852632344	2852634858	270
165	iso_pu_bacteria	2855670206	2855671995	270
166	iso_pu_bacteria	2855676851	2855678114	270
167	iso_pu_bacteria	2856741275	2856745039	270
168	iso_pu_bacteria	2857288857	2857291627	270
169	iso_pu_bacteria	2857737099	2857739697	270
170	iso_pu_bacteria	2858848962	2858849706	270
171	iso_pu_bacteria	2858882152	2858886154	270
172	iso_pu_bacteria	2858888857	2858889462	270
173	iso_pu_bacteria	2858895516	2858898086	270
174	iso_pu_bacteria	2867428634	2867433590	270
175	iso_pu_bacteria	2869048445	2869052239	270
176	iso_pu_bacteria	2869061728	2869065362	270
177	iso_pu_bacteria	2869068681	2869069896	270
178	iso_pu_bacteria	2880489317	2880492536	270
179	iso_pu_bacteria	2880495981	2880499750	270
180	iso_pu_bacteria	2884693830	2884696804	270
181	iso_pu_bacteria	2891395885	2891399194	270
182	iso_pu_bacteria	2891554331	2891555014	270
183	iso_pu_bacteria	2891562705	2891563424	270
184	iso_pu_bacteria	2895442618	2895451568	270
185	iso_pu_bacteria	2929226422	2929228328	270
186	iso_pu_bacteria	2954711539	2954711957	270
187	iso_pu_bacteria	2954721474	2954721895	270
188	iso_pu_bacteria	2954731030	2954739957	270
189	iso_pu_bacteria	2954740390	2954740790	270
190	iso_pu_bacteria	2954749733	2954758776	270
191	iso_pu_bacteria	2954759201	2954759798	270
192	iso_pu_bacteria	2984580707	2984583162	270
193	iso_pu_bacteria	8003314358	8003323772	270
194	iso_pu_bacteria	8003830390	8003833234	270
195	iso_pu_bacteria	8003870546	8003871210	270
196	iso_pu_bacteria	8054704163	8054710469	270
197	iso_pu_bacteria	8054727385	8054730514	270
198	iso_pu_bacteria	8054734606	8054738610	270
199	iso_pu_bacteria	8055066027	8055073733	270
200	3300003323	rootH1_10053068	rootH1_1005306810	271
201	3300005327	Ga0070658_10461520	Ga0070658_104615202	271
202	3300005338	Ga0068868_100014956	Ga0068868_1000149565	271
203	3300005366	Ga0070659_100292826	Ga0070659_1002928262	271
204	3300005548	Ga0070665_100007618	Ga0070665_1000076186	271
205	3300005548	Ga0070665_100032533	Ga0070665_1000325333	271
206	3300005563	Ga0068855_100131620	Ga0068855_1001316202	271
207	3300005577	Ga0068857_100224390	Ga0068857_1002243903	271
208	3300005616	Ga0068852_100003341	Ga0068852_1000033418	271
209	3300006881	Ga0068865_100215274	Ga0068865_1002152742	271
210	3300009174	Ga0105241_10578960	Ga0105241_105789602	271
211	3300009545	Ga0105237_10001185	Ga0105237_1000118520	271
212	3300010375	Ga0105239_10001229	Ga0105239_1000122920	271
213	3300013102	Ga0157371_10003687	Ga0157371_100036876	271
214	3300013104	Ga0157370_10009666	Ga0157370_100096663	271
215	3300013307	Ga0157372_10013631	Ga0157372_100136315	271
216	3300025909	Ga0207705_10172556	Ga0207705_101725562	271
217	3300025914	Ga0207671_10003785	Ga0207671_1000378511	271
218	3300025919	Ga0207657_10006871	Ga0207657_100068715	271
219	3300025938	Ga0207704_10254110	Ga0207704_102541102	271
220	3300025949	Ga0207667_10021812	Ga0207667_100218125	271
221	3300026067	Ga0207678_10000555	Ga0207678_1000055512	271
222	3300026078	Ga0207702_10003356	Ga0207702_100033564	271
223	3300026142	Ga0207698_10271119	Ga0207698_102711192	271
224	3300028379	Ga0268266_10002120	Ga0268266_1000212018	271
225	3300028800	Ga0265338_10005493	Ga0265338_100054933	271
226	3300029957	Ga0265324_10041117	Ga0265324_100411172	271
227	3300031235	Ga0265330_10008802	Ga0265330_100088024	271
228	3300031241	Ga0265325_10001088	Ga0265325_100010886	271
229	3300031242	Ga0265329_10006576	Ga0265329_100065763	271
230	3300031249	Ga0265339_10003915	Ga0265339_100039157	271
231	3300031344	Ga0265316_10008148	Ga0265316_100081482	271
232	3300031595	Ga0265313_10000586	Ga0265313_100005868	271
233	3300031711	Ga0265314_10022606	Ga0265314_100226063	271
234	3300031712	Ga0265342_10045153	Ga0265342_100451532	271
235	3300037466	Ga0395898_0296086	Ga0395898_0296086_633_1523	271
236	3300049568	Ga0501031_0053093	Ga0501031_0053093_899_1771	271
237	3300049570	Ga0501033_0042552	Ga0501033_0042552_1781_2653	271
238	3300049571	Ga0501034_0018270	Ga0501034_0018270_2421_3293	271
239	3300049572	Ga0501036_0010012	Ga0501036_0010012_2514_3386	271
240	3300049573	Ga0501037_0007992	Ga0501037_0007992_5211_6083	271
241	3300049574	Ga0501038_0005241	Ga0501038_0005241_3953_4825	271
242	3300049575	Ga0501039_0025526	Ga0501039_0025526_2587_3459	271
243	3300049579	Ga0501043_0409920	Ga0501043_0409920_112_966	271
244	3300049581	Ga0501047_0325692	Ga0501047_0325692_351_1223	271
245	3300049586	Ga0501070_0010197	Ga0501070_0010197_4810_5682	271
246	3300049822	Ga0501035_0075991	Ga0501035_0075991_1781_2653	271
247	3300049823	Ga0501044_0125045	Ga0501044_0125045_1191_2063	271
248	3300049824	Ga0501045_0234125	Ga0501045_0234125_147_1019	271
249	iso_pu_bacteria	2831935698	2831936801	271
250	iso_pu_bacteria	2832004796	2832005159	271
251	iso_pu_bacteria	2866065130	2866065744	271
252	iso_pu_bacteria	2867507094	2867507487	271
253	3300005441	Ga0070700_100057076	Ga0070700_1000570763	272
254	3300006051	Ga0075364_10089924	Ga0075364_100899242	272
255	3300006178	Ga0075367_10006004	Ga0075367_100060046	272
256	3300006195	Ga0075366_10096174	Ga0075366_100961742	272
257	3300026075	Ga0207708_10081936	Ga0207708_100819363	272
258	3300042876	Ga0451577_0166631	Ga0451577_0166631_168_986	272
259	3300044712	Ga0453684_0642818	Ga0453684_0642818_237_1055	272
260	3300050493	nmdc:mga0k408_199375_c1	nmdc:mga0k408_199375_c1_93_941	272
261	3300010375	Ga0105239_10335937	Ga0105239_103359372	273
262	3300037418	Ga0395900_0615986	Ga0395900_0615986_95_916	273
263	3300044765	Ga0466970_0070981	Ga0466970_0070981_58_888	273
264	3300046455	Ga0495603_0072939	Ga0495603_0072939_886_1707	273
265	3300046461	Ga0495641_0037196	Ga0495641_0037196_444_1268	273
266	3300046473	Ga0495582_0062993	Ga0495582_0062993_610_1434	273
267	3300046642	Ga0495634_0022752	Ga0495634_0022752_2030_2851	273
268	3300046681	Ga0495647_0022968	Ga0495647_0022968_512_1333	273
269	3300046689	Ga0495613_0422630	Ga0495613_0422630_33_857	273
270	3300047321	Ga0495676_0050481	Ga0495676_0050481_1967_2788	273
271	3300048907	Ga0496104_0110219	Ga0496104_0110219_707_1531	273
272	3300048908	Ga0496105_0205405	Ga0496105_0205405_601_1425	273
273	3300048911	Ga0496108_0132615	Ga0496108_0132615_145_969	273
274	3300048912	Ga0496109_0276218	Ga0496109_0276218_585_1409	273
275	3300003203	JGI25406J46586_10004331	JGI25406J46586_100043315	274
276	3300005327	Ga0070658_10086066	Ga0070658_100860663	274
277	3300005327	Ga0070658_10152224	Ga0070658_101522242	274
278	3300005329	Ga0070683_100002139	Ga0070683_1000021394	274
279	3300005334	Ga0068869_100188112	Ga0068869_1001881121	274
280	3300005336	Ga0070680_100165120	Ga0070680_1001651202	274
281	3300005337	Ga0070682_100056092	Ga0070682_1000560922	274
282	3300005347	Ga0070668_100000364	Ga0070668_10000036419	274
283	3300005347	Ga0070668_100069531	Ga0070668_1000695311	274
284	3300005353	Ga0070669_100140239	Ga0070669_1001402392	274
285	3300005435	Ga0070714_100000333	Ga0070714_10000033337	274
286	3300005435	Ga0070714_100067957	Ga0070714_1000679572	274
287	3300005435	Ga0070714_100097351	Ga0070714_1000973513	274
288	3300005436	Ga0070713_100042665	Ga0070713_1000426653	274
289	3300005436	Ga0070713_100294717	Ga0070713_1002947171	274
290	3300005455	Ga0070663_100178478	Ga0070663_1001784782	274
291	3300005456	Ga0070678_100160688	Ga0070678_1001606881	274
292	3300005458	Ga0070681_10018677	Ga0070681_100186777	274
293	3300005530	Ga0070679_100030160	Ga0070679_1000301603	274
294	3300005530	Ga0070679_100139756	Ga0070679_1001397562	274
295	3300005530	Ga0070679_100196765	Ga0070679_1001967653	274
296	3300005535	Ga0070684_100019759	Ga0070684_1000197597	274
297	3300005535	Ga0070684_100060843	Ga0070684_1000608433	274
298	3300005535	Ga0070684_100322910	Ga0070684_1003229102	274
299	3300005543	Ga0070672_100242274	Ga0070672_1002422742	274
300	3300005547	Ga0070693_100245108	Ga0070693_1002451082	274
301	3300005548	Ga0070665_100014954	Ga0070665_1000149544	274
302	3300005548	Ga0070665_100033672	Ga0070665_1000336724	274
303	3300005548	Ga0070665_100041637	Ga0070665_1000416373	274
304	3300005577	Ga0068857_100029417	Ga0068857_1000294175	274
305	3300005577	Ga0068857_100031314	Ga0068857_1000313142	274
306	3300005577	Ga0068857_100072681	Ga0068857_1000726814	274
307	3300005614	Ga0068856_100110650	Ga0068856_1001106503	274
308	3300005614	Ga0068856_100179309	Ga0068856_1001793092	274
309	3300005614	Ga0068856_100443720	Ga0068856_1004437202	274
310	3300005616	Ga0068852_100187609	Ga0068852_1001876092	274
311	3300005617	Ga0068859_100305552	Ga0068859_1003055522	274
312	3300005618	Ga0068864_100237766	Ga0068864_1002377662	274
313	3300005618	Ga0068864_100529792	Ga0068864_1005297921	274
314	3300005834	Ga0068851_10111876	Ga0068851_101118762	274
315	3300005841	Ga0068863_100019748	Ga0068863_1000197482	274
316	3300005844	Ga0068862_100046608	Ga0068862_1000466082	274
317	3300005985	Ga0081539_10000137	Ga0081539_10000137141	274
318	3300006028	Ga0070717_10218316	Ga0070717_102183162	274
319	3300006038	Ga0075365_10057195	Ga0075365_100571952	274
320	3300006038	Ga0075365_10163318	Ga0075365_101633181	274
321	3300006175	Ga0070712_100296133	Ga0070712_1002961331	274
322	3300006358	Ga0068871_100698747	Ga0068871_1006987471	274
323	3300006871	Ga0075434_100081877	Ga0075434_1000818773	274
324	3300006914	Ga0075436_100306320	Ga0075436_1003063202	274
325	3300006931	Ga0097620_100305576	Ga0097620_1003055762	274
326	3300007076	Ga0075435_100026980	Ga0075435_1000269803	274
327	3300009093	Ga0105240_10068852	Ga0105240_100688524	274
328	3300009093	Ga0105240_10298464	Ga0105240_102984642	274
329	3300009098	Ga0105245_10346979	Ga0105245_103469792	274
330	3300009098	Ga0105245_10380876	Ga0105245_103808761	274
331	3300009101	Ga0105247_10325274	Ga0105247_103252741	274
332	3300009147	Ga0114129_10114599	Ga0114129_101145993	274
333	3300009148	Ga0105243_10000331	Ga0105243_1000033139	274
334	3300009551	Ga0105238_10628963	Ga0105238_106289631	274
335	3300010375	Ga0105239_10041407	Ga0105239_100414073	274
336	3300010375	Ga0105239_10490695	Ga0105239_104906952	274
337	3300010375	Ga0105239_10624013	Ga0105239_106240132	274
338	3300013100	Ga0157373_10285818	Ga0157373_102858181	274
339	3300013102	Ga0157371_10273424	Ga0157371_102734242	274
340	3300013104	Ga0157370_10025616	Ga0157370_100256164	274
341	3300013104	Ga0157370_10274360	Ga0157370_102743602	274
342	3300013105	Ga0157369_10016321	Ga0157369_100163214	274
343	3300013296	Ga0157374_10106405	Ga0157374_101064052	274
344	3300013307	Ga0157372_10408415	Ga0157372_104084151	274
345	3300013307	Ga0157372_10495415	Ga0157372_104954151	274
346	3300013308	Ga0157375_10114934	Ga0157375_101149342	274
347	3300020070	Ga0206356_10188722	Ga0206356_101887222	274
348	3300020610	Ga0154015_1080299	Ga0154015_10802992	274
349	3300022467	Ga0224712_10041556	Ga0224712_100415562	274
350	3300025912	Ga0207707_10046206	Ga0207707_100462063	274
351	3300025913	Ga0207695_10119393	Ga0207695_101193933	274
352	3300025917	Ga0207660_10009320	Ga0207660_100093204	274
353	3300025919	Ga0207657_10059675	Ga0207657_100596753	274
354	3300025921	Ga0207652_10007148	Ga0207652_100071486	274
355	3300025921	Ga0207652_10465873	Ga0207652_104658732	274
356	3300025924	Ga0207694_10403871	Ga0207694_104038712	274
357	3300025927	Ga0207687_10526672	Ga0207687_105266721	274
358	3300025928	Ga0207700_10090127	Ga0207700_100901271	274
359	3300025929	Ga0207664_10001237	Ga0207664_100012378	274
360	3300025932	Ga0207690_10051357	Ga0207690_100513572	274
361	3300025935	Ga0207709_10001790	Ga0207709_1000179012	274
362	3300025944	Ga0207661_10004731	Ga0207661_100047314	274
363	3300025944	Ga0207661_10011135	Ga0207661_100111355	274
364	3300025949	Ga0207667_10394829	Ga0207667_103948292	274
365	3300025972	Ga0207668_10000326	Ga0207668_100003267	274
366	3300025972	Ga0207668_10140276	Ga0207668_101402762	274
367	3300026067	Ga0207678_10087398	Ga0207678_100873982	274
368	3300026088	Ga0207641_10448442	Ga0207641_104484422	274
369	3300026095	Ga0207676_10084052	Ga0207676_100840522	274
370	3300026116	Ga0207674_10003198	Ga0207674_1000319810	274
371	3300026116	Ga0207674_10057801	Ga0207674_100578013	274
372	3300026116	Ga0207674_10087562	Ga0207674_100875623	274
373	3300026121	Ga0207683_10201671	Ga0207683_102016712	274
374	3300028380	Ga0268265_10031669	Ga0268265_100316694	274
375	3300028577	Ga0265318_10077008	Ga0265318_100770082	274
376	3300028794	Ga0307515_10176136	Ga0307515_101761362	274
377	3300030522	Ga0307512_10017409	Ga0307512_100174094	274
378	3300031616	Ga0307508_10227756	Ga0307508_102277563	274
379	3300031727	Ga0316576_10181589	Ga0316576_101815892	274
380	3300031824	Ga0307413_10220383	Ga0307413_102203832	274
381	3300031901	Ga0307406_10039647	Ga0307406_100396473	274
382	3300031901	Ga0307406_10078938	Ga0307406_100789382	274
383	3300031901	Ga0307406_10434541	Ga0307406_104345412	274
384	3300031903	Ga0307407_10326487	Ga0307407_103264872	274
385	3300032002	Ga0307416_100685134	Ga0307416_1006851341	274
386	3300032126	Ga0307415_100017439	Ga0307415_1000174393	274
387	3300032126	Ga0307415_100035318	Ga0307415_1000353183	274
388	3300032126	Ga0307415_100148484	Ga0307415_1001484842	274
389	3300033179	Ga0307507_10048094	Ga0307507_100480944	274
390	3300035091	Ga0373951_0000052	Ga0373951_0000052_36734_37558	274
391	3300035172	Ga0373955_0060643	Ga0373955_0060643_771_1595	274
392	3300035172	Ga0373955_0093290	Ga0373955_0093290_133_957	274
393	3300035692	Ga0373935_0095228	Ga0373935_0095228_122_970	274
394	3300035724	Ga0373933_0011363	Ga0373933_0011363_218_1066	274
395	3300035724	Ga0373933_0023693	Ga0373933_0023693_1771_2595	274
396	3300036401	Ga0373937_0027357	Ga0373937_0027357_336_1184	274
397	3300036401	Ga0373937_0363241	Ga0373937_0363241_528_1352	274
398	3300036401	Ga0373937_0518574	Ga0373937_0518574_244_1068	274
399	3300037068	Ga0373925_0005256	Ga0373925_0005256_7764_8588	274
400	3300037068	Ga0373925_0230820	Ga0373925_0230820_19_843	274
401	3300037466	Ga0395898_0018602	Ga0395898_0018602_1374_2198	274
402	3300041443	Ga0451789_0551925	Ga0451789_0551925_193_1017	274
403	3300041451	Ga0451791_1211720	Ga0451791_1211720_388_1212	274
404	3300041486	Ga0451807_1930859	Ga0451807_1930859_22_846	274
405	3300041486	Ga0451807_2346010	Ga0451807_2346010_46_870	274
406	3300041491	Ga0451833_0988843	Ga0451833_0988843_219_1043	274
407	3300044656	Ga0466969_0010779	Ga0466969_0010779_2162_2986	274
408	3300044656	Ga0466969_0018672	Ga0466969_0018672_2437_3261	274
409	3300044658	Ga0466972_0078422	Ga0466972_0078422_638_1462	274
410	3300044683	Ga0466965_0004879	Ga0466965_0004879_5120_5944	274
411	3300044694	Ga0466963_0041111	Ga0466963_0041111_1077_1901	274
412	3300044694	Ga0466963_0047475	Ga0466963_0047475_1134_1958	274
413	3300044694	Ga0466963_0134021	Ga0466963_0134021_415_1239	274
414	3300044706	Ga0466964_0023378	Ga0466964_0023378_1130_1954	274
415	3300044765	Ga0466970_0012851	Ga0466970_0012851_2607_3431	274
416	3300044842	Ga0466957_0317202	Ga0466957_0317202_79_903	274
417	3300044901	Ga0466960_0039053	Ga0466960_0039053_866_1690	274
418	3300045049	Ga0466959_0006932	Ga0466959_0006932_1708_2532	274
419	3300045976	Ga0466967_0006935	Ga0466967_0006935_6420_7244	274
420	3300045976	Ga0466967_0008576	Ga0466967_0008576_5900_6724	274
421	3300045976	Ga0466967_0042317	Ga0466967_0042317_1713_2537	274
422	3300045976	Ga0466967_0070341	Ga0466967_0070341_920_1744	274
423	3300046454	Ga0495592_0072481	Ga0495592_0072481_800_1648	274
424	3300046454	Ga0495592_0085610	Ga0495592_0085610_892_1716	274
425	3300046462	Ga0495651_0034866	Ga0495651_0034866_862_1710	274
426	3300046462	Ga0495651_0037123	Ga0495651_0037123_2419_3243	274
427	3300046462	Ga0495651_0157434	Ga0495651_0157434_150_974	274
428	3300046463	Ga0495653_0010115	Ga0495653_0010115_860_1708	274
429	3300046463	Ga0495653_0126636	Ga0495653_0126636_99_923	274
430	3300046477	Ga0495664_0024912	Ga0495664_0024912_852_1676	274
431	3300046499	Ga0495594_0091935	Ga0495594_0091935_187_1011	274
432	3300046511	Ga0495608_0025092	Ga0495608_0025092_2433_3281	274
433	3300046511	Ga0495608_0084199	Ga0495608_0084199_500_1324	274
434	3300046514	Ga0495618_0083181	Ga0495618_0083181_1137_1961	274
435	3300046514	Ga0495618_0195560	Ga0495618_0195560_424_1260	274
436	3300046514	Ga0495618_0228758	Ga0495618_0228758_260_1108	274
437	3300046517	Ga0495630_0002316	Ga0495630_0002316_6109_6933	274
438	3300046517	Ga0495630_0005223	Ga0495630_0005223_4523_5347	274
439	3300046517	Ga0495630_0143299	Ga0495630_0143299_309_1133	274
440	3300046529	Ga0495652_0072218	Ga0495652_0072218_1841_2665	274
441	3300046533	Ga0495640_0064707	Ga0495640_0064707_1499_2323	274
442	3300046543	Ga0495645_0071736	Ga0495645_0071736_292_1116	274
443	3300046559	Ga0495667_0043834	Ga0495667_0043834_541_1365	274
444	3300046559	Ga0495667_0054224	Ga0495667_0054224_868_1716	274
445	3300046559	Ga0495667_0097249	Ga0495667_0097249_877_1701	274
446	3300046642	Ga0495634_0022589	Ga0495634_0022589_580_1404	274
447	3300046642	Ga0495634_0156240	Ga0495634_0156240_283_1107	274
448	3300046663	Ga0495635_0010873	Ga0495635_0010873_4713_5561	274
449	3300046675	Ga0495657_0018766	Ga0495657_0018766_337_1185	274
450	3300046675	Ga0495657_0026956	Ga0495657_0026956_1488_2312	274
451	3300046678	Ga0495599_0106970	Ga0495599_0106970_889_1713	274
452	3300046809	Ga0495600_0122097	Ga0495600_0122097_761_1609	274
453	3300047319	Ga0495674_0009094	Ga0495674_0009094_604_1428	274
454	3300047319	Ga0495674_0026631	Ga0495674_0026631_114_950	274
455	3300047322	Ga0495680_0003994	Ga0495680_0003994_7723_8571	274
456	3300047322	Ga0495680_0011021	Ga0495680_0011021_6348_7172	274
457	3300047322	Ga0495680_0214770	Ga0495680_0214770_27_851	274
458	3300047471	Ga0495684_0034599	Ga0495684_0034599_2126_2950	274
459	3300047471	Ga0495684_0118153	Ga0495684_0118153_336_1184	274
460	3300048903	Ga0496100_0201533	Ga0496100_0201533_72_896	274
461	3300048905	Ga0496102_0185637	Ga0496102_0185637_816_1640	274
462	3300048908	Ga0496105_0112027	Ga0496105_0112027_647_1471	274
463	3300048911	Ga0496108_0004832	Ga0496108_0004832_4995_5819	274
464	3300048915	Ga0496112_0095637	Ga0496112_0095637_1321_2145	274
465	3300048915	Ga0496112_0166689	Ga0496112_0166689_447_1271	274
466	3300048915	Ga0496112_0211481	Ga0496112_0211481_364_1188	274
467	3300048916	Ga0496113_0138039	Ga0496113_0138039_936_1760	274
468	3300048917	Ga0496114_0312608	Ga0496114_0312608_498_1322	274
469	3300048918	Ga0496115_0000994	Ga0496115_0000994_2603_3427	274
470	3300048918	Ga0496115_0414295	Ga0496115_0414295_222_1046	274
471	3300048922	Ga0496119_0078558	Ga0496119_0078558_414_1238	274
472	3300048925	Ga0496122_0005141	Ga0496122_0005141_2627_3451	274
473	3300048927	Ga0496124_0015218	Ga0496124_0015218_4044_4868	274
474	3300048928	Ga0496125_0000047	Ga0496125_0000047_217901_218725	274
475	3300048929	Ga0496126_0031407	Ga0496126_0031407_3901_4725	274
476	3300048929	Ga0496126_0074636	Ga0496126_0074636_1882_2706	274
477	3300049568	Ga0501031_0004202	Ga0501031_0004202_3145_3969	274
478	3300049569	Ga0501032_0022470	Ga0501032_0022470_3470_4294	274
479	3300049572	Ga0501036_0024164	Ga0501036_0024164_695_1519	274
480	3300049575	Ga0501039_0189512	Ga0501039_0189512_662_1486	274
481	3300049578	Ga0501042_0133966	Ga0501042_0133966_649_1473	274
482	3300049578	Ga0501042_0278516	Ga0501042_0278516_124_948	274
483	3300049579	Ga0501043_0024260	Ga0501043_0024260_206_1030	274
484	3300049580	Ga0501046_0002711	Ga0501046_0002711_1186_2010	274
485	3300049581	Ga0501047_0292096	Ga0501047_0292096_228_1052	274
486	3300049584	Ga0501068_0012730	Ga0501068_0012730_434_1258	274
487	3300049585	Ga0501069_0087961	Ga0501069_0087961_520_1344	274
488	3300049586	Ga0501070_0043990	Ga0501070_0043990_891_1715	274
489	3300049587	Ga0501071_0086757	Ga0501071_0086757_953_1777	274
490	3300049588	Ga0501072_0014658	Ga0501072_0014658_4714_5538	274
491	3300049589	Ga0501073_0020778	Ga0501073_0020778_3047_3871	274
492	3300049590	Ga0501074_0077737	Ga0501074_0077737_574_1398	274
493	3300049741	Ga0501079_0061451	Ga0501079_0061451_1810_2634	274
494	3300049742	Ga0501080_0237034	Ga0501080_0237034_350_1174	274
495	3300049744	Ga0501083_0097534	Ga0501083_0097534_797_1621	274
496	3300049822	Ga0501035_0265665	Ga0501035_0265665_530_1354	274
497	3300049823	Ga0501044_0117538	Ga0501044_0117538_526_1350	274
498	3300050492	nmdc:mga0yw44_24100_c1	nmdc:mga0yw44_24100_c1_428_1252	274
499	3300050507	nmdc:mga05p37_866815_c1	nmdc:mga05p37_866815_c1_94_918	274
500	3300050512	nmdc:mga0n895_79309_c1	nmdc:mga0n895_79309_c1_1201_2025	274
501	3300050513	nmdc:mga0rr50_294086_c1	nmdc:mga0rr50_294086_c1_107_931	274
502	3300050514	nmdc:mga08x19_216133_c1	nmdc:mga08x19_216133_c1_176_1000	274
503	3300050514	nmdc:mga08x19_277485_c1	nmdc:mga08x19_277485_c1_268_1092	274
504	3300053077	Ga0495601_0172021	Ga0495601_0172021_218_1042	274
505	3300053085	Ga0495619_0157873	Ga0495619_0157873_383_1219	274
506	3300053085	Ga0495619_0188464	Ga0495619_0188464_511_1335	274
507	3300053139	Ga0500568_0011910	Ga0500568_0011910_985_1809	274
508	3300053147	Ga0500589_153096	Ga0500589_153096_36_860	274
509	3300054114	Ga0501084_0027454	Ga0501084_0027454_1125_1949	274
510	3300060353	Ga0501082_0008347	Ga0501082_0008347_3123_3947	274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

104

291

0.84 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8ja7-assembly1.cif.gz_B	cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose	0.854	6	270
8hpn-assembly1.cif.gz_B	lpqy-sugabc in state 3	0.852	4	265
8hpr-assembly1.cif.gz_B	lpqy-sugabc in state 4	0.848	4	259
4jbw-assembly2.cif.gz_I	crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc	0.8421	6	262
8hpr-assembly1.cif.gz_B	lpqy-sugabc in state 4	0.842	4	259

ID	Description	Score	Start	End	Superfamily
af_I6Y1U3_2_266_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.915	4	264	1.10.3720.10
af_Q2G1E7_1_266_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.9119	4	260	1.10.3720.10
af_P9WG01_5_265_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.9	8	264	1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.8987	4	264	1.10.3720.10
af_O53483_6_271_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.8928	1	264	1.10.3720.10

ID	Description	Score	Start	End	GO Terms
AF-A0A6G4V9U2-F1-model_v4	Carbohydrate ABC transporter permease	0.9626	20	274	GO:0005886 GO:0055085
AF-A0A6G4V9U2-F1-model_v4	Carbohydrate ABC transporter permease	0.9553	20	274	GO:0005886 GO:0055085
AF-A0A3N0EBN8-F1-model_v4	Carbohydrate ABC transporter permease	0.9526	7	274	GO:0005886 GO:0055085
AF-A0A3N1KWT1-F1-model_v4	deleted	0.9478	10	274
AF-A0A850DDP7-F1-model_v4	deleted	0.9472	1	256

Feature Viewer

pLDDT	pTM	Quality
76.89	0.74	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F457176

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

104

291

0.84

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map