F456898

General Info

Members Datasets Scaffolds Average Seq Length
508 453 163 298

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154107|2515607383
Length 361
Sequence SGRRPLTLSPQGGDSAACPLLPARGEKMPQADEGPHCGILGAPKTKLRTDCPEQTTQQKAKHMIRYGTNPIAWSNDDDHSIGAHLTLEDCLSDCKKIGFDGIEKGHKMPSDPEALKQKLSSYDLVFVSGWHSTNLLTHDVEAEKKAIQPHLDLLKHNGCRVAIVCETSNAIHGDDSKSLVKDKPVLPADKWEKFGADLEAIAQYCAGQGIDLVYHHHMGTIVQTGEEIDLLMRNTGPATKLLLDTGHAWFGGSDPADVARRYMDRVRHIHCKNVRPAVRAVVESEGLSFLEGVRRGVFTVPGDAEGGVDFLPVLKIAAQHGYDGWLVIEAEQDSAVRNPFEYQSLGLKSLKAFAKEAGLDA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
6 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
7 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
8 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
9 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
10 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
11 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
14 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
15 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
16 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
17 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
18 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
19 2516143018 Ensifer sp. BR816 Isolate Nodule
20 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
21 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
22 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
23 2534681786 Brucella suis 92/29 Isolate Unclassified
24 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
25 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
26 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
27 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
28 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
29 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
30 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
31 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
32 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
33 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
34 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
35 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
36 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
37 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
38 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
39 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
40 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
41 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
42 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
43 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
44 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
45 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
46 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
47 2643221557 Ensifer sp. Root558 Isolate Unclassified
48 2643221558 Rhizobium sp. Root149 Isolate Unclassified
49 2643221568 Rhizobium sp. Root564 Isolate Unclassified
50 2643221582 Rhizobium sp. Root651 Isolate Unclassified
51 2643221610 Ensifer sp. Root74 Isolate Unclassified
52 2643221618 Ensifer sp. Root231 Isolate Unclassified
53 2643221626 Ensifer sp. Root31 Isolate Unclassified
54 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
55 2643221655 Ensifer sp. Root1252 Isolate Unclassified
56 2643221659 Ensifer sp. Root127 Isolate Unclassified
57 2643221668 Ensifer sp. Root423 Isolate Unclassified
58 2643221675 Ensifer sp. Root1298 Isolate Unclassified
59 2643221680 Ensifer sp. Root1312 Isolate Unclassified
60 2643221688 Rhizobium sp. Root482 Isolate Unclassified
61 2643221693 Rhizobium sp. Root491 Isolate Unclassified
62 2643221698 Ensifer sp. Root142 Isolate Unclassified
63 2643221712 Ensifer sp. Root258 Isolate Unclassified
64 2643221719 Rhizobium sp. Root274 Isolate Unclassified
65 2643221723 Ensifer sp. Root278 Isolate Unclassified
66 2643221726 Ensifer sp. Root954 Isolate Unclassified
67 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
68 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
69 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
70 2751185800 Brucella pituitosa AA2 Isolate Unclassified
71 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
72 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
73 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
74 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
75 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
76 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
77 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
78 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
79 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
80 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
81 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
82 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
83 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
84 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
85 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
86 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
87 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
88 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
89 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
90 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
91 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
92 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
93 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
94 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
95 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
96 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
97 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
98 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
99 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
100 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
101 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
102 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
103 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
104 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
105 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
106 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
107 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
108 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
109 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
110 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
111 2844163670 Ensifer sp. 1H6 Isolate Unclassified
112 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
113 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
114 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
115 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
116 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
117 2854911287 Brucella lupini LUP21 Isolate Unclassified
118 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
119 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
120 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
121 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
122 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
123 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
124 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
125 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
126 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
127 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
128 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
129 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
130 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
131 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
132 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
133 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
134 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
135 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
136 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
137 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
138 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
139 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
140 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
141 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
142 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
143 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
144 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
145 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
146 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
147 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
148 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
149 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
150 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
151 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
152 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
153 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
154 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
155 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
156 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
157 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
158 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
159 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
160 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
161 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
162 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
163 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
164 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
165 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
166 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
167 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
168 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
169 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
170 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
171 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
172 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
173 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
174 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
175 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
176 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
177 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
178 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
179 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
180 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
181 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
182 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
183 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
184 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
185 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
186 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
187 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
188 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
189 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
190 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
191 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
192 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
193 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
194 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
195 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
196 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
197 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
198 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
199 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
200 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
201 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
202 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
203 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
204 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
205 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
206 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
207 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
208 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
209 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
210 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
211 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
212 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
213 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
214 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
215 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
216 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
217 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
218 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
219 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
220 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
221 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
222 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
223 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
224 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
225 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
226 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
227 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
228 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
229 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
230 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
231 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
232 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
233 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
234 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
235 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
236 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
237 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
238 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
239 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
240 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
241 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
242 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
243 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
244 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
245 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
246 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
247 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
248 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
249 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
250 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
251 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
252 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
253 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
254 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
255 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
256 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
257 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
258 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
259 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
260 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
261 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
262 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
263 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
264 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
265 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
266 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
267 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
268 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
269 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
270 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
271 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
272 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
273 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
274 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
275 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
276 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
277 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
278 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
279 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
280 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
281 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
282 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
283 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
284 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
285 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
286 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
287 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
288 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
289 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
290 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
291 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
292 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
293 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
294 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
295 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
296 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
297 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
298 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
299 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
300 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
301 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
302 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
303 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
304 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
305 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
306 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
307 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
308 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
309 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
310 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
311 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
312 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
313 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
314 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
315 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
316 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
317 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
318 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
319 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
320 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
321 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
322 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
323 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
324 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
325 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
326 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
327 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
328 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
329 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
330 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
331 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
332 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
333 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
334 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
335 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
336 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
337 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
338 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
339 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
340 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
341 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
342 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
343 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
344 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
345 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
346 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
347 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
348 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
349 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
350 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
351 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
352 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
353 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
354 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
355 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
356 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
357 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
358 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
359 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
360 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
361 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
362 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
363 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
364 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
365 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
366 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
367 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
368 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
369 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
370 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
371 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
372 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
373 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
374 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
375 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
376 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
377 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
380 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
381 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
382 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
383 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
385 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
386 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
387 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
388 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
389 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
390 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
391 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
392 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
393 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
394 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
395 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
396 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
397 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
398 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
399 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
400 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
401 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
402 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
403 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
404 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
405 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
406 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
407 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
408 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
409 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
410 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
411 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
412 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
413 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
416 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
417 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
418 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
419 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
420 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
421 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
422 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
423 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
424 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
425 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
426 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
427 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
428 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
429 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
430 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
431 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
432 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
433 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
434 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
435 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
436 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
437 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
438 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
439 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
440 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
441 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
442 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
443 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
444 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
445 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
446 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
447 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
448 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
449 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
450 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
451 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
452 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
453 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 32.09
Metatranscriptomes 0.2
Isolates 67.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.98
Bulb 0
Endosphere 11.61
Nodule 50.59
Rhizoplane 1.77
Rhizosphere 13.58
Stem 0
Stem Tuber 0
Unclassified 21.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000015 3300002987 Bacteria 142431
2 JGI25151J46595_10014369 3300003187 Bacteria 3529
3 JGI25151J46595_10036865 3300003187 Bacteria 1840
4 JGI25160J50197_1000003 3300003354 Bacteria 482719
5 JGI25161J50226_1010749 3300003374 Bacteria 1199
6 Ga0006562J51391_1025412 3300003578 Bacteria 1835
7 Ga0055526_1000639 3300003771 Bacteria 27197
8 Ga0055524_1009869 3300003775 Bacteria 3844
9 Ga0055536_1002504 3300003781 Bacteria 10308
10 Ga0055530_10016286 3300003791 Bacteria 2382
11 Ga0055530_10024331 3300003791 Bacteria 1719
12 Ga0055540_1016226 3300003792 Bacteria 2129
13 Ga0055531_10011659 3300003794 Bacteria 4211
14 Ga0055531_10023196 3300003794 Bacteria 2336
15 Ga0058692_1002395 3300003856 Bacteria 6294
16 Ga0058692_1006334 3300003856 Bacteria 3269
17 Ga0058692_1009689 3300003856 Bacteria 2414
18 Ga0055543_1000223 3300004625 Bacteria 45570
19 Ga0065165_1000025 3300005262 Bacteria 246909
20 Ga0065165_1003404 3300005262 Bacteria 11229
21 Ga0070665_100017919 3300005548 Bacteria 7111
22 Ga0070665_100532773 3300005548 Bacteria 1186
23 Ga0081455_10182131 3300005937 Bacteria 1589
24 Ga0075368_10024199 3300006042 Bacteria 2324
25 Ga0075363_100194610 3300006048 Bacteria 1157
26 Ga0075364_10000024 3300006051 Bacteria 51969
27 Ga0075364_10000126 3300006051 Bacteria 31821
28 Ga0075364_10005078 3300006051 Bacteria 7631
29 Ga0075362_10048384 3300006177 Bacteria 1897
30 Ga0075369_10021244 3300006186 Bacteria 2665
31 Ga0075366_10014039 3300006195 Bacteria 4569
32 Ga0079104_1000563 3300006946 Bacteria 37845
33 Ga0079104_1000993 3300006946 Bacteria 21991
34 Ga0099826_10000151 3300006948 Bacteria 29495
35 Ga0099826_10077051 3300006948 Bacteria 2093
36 Ga0099794_10005691 3300007265 Bacteria 5021
37 Ga0105243_10004159 3300009148 Bacteria 11483
38 Ga0157373_10050586 3300013100 Bacteria 2959
39 Ga0157373_10052862 3300013100 Bacteria 2889
40 Ga0157371_10000005 3300013102 Bacteria 416456
41 Ga0157371_10002763 3300013102 Bacteria 16489
42 Ga0157370_10000036 3300013104 Bacteria 136933
43 Ga0157369_10115946 3300013105 Bacteria 2845
44 Ga0171463_1001 3300013249 Bacteria 1406070
45 Ga0183363_1135 3300015690 Bacteria 18828
46 Ga0214544_1002513 3300021320 Bacteria 38572
47 Ga0214542_1000029 3300021321 Bacteria 174097
48 Ga0214543_1000040 3300021327 Bacteria 174142
49 Ga0214543_1000049 3300021327 Bacteria 149506
50 Ga0213872_10086812 3300021361 Bacteria 1402
51 Ga0213875_10004084 3300021388 Bacteria 8120
52 Ga0228711_1000013 3300022739 Bacteria 132585
53 Ga0228710_1000008 3300022740 Bacteria 174306
54 Ga0209565_1023313 3300025263 Bacteria 1272
55 Ga0209130_1000005 3300025284 Bacteria 599620
56 Ga0209676_1001942 3300025292 Bacteria 16657
57 Ga0209025_1000105 3300025294 Bacteria 224157
58 Ga0209025_1000478 3300025294 Bacteria 77516
59 Ga0209564_1000217 3300025295 Bacteria 131090
60 Ga0209758_1001220 3300025297 Bacteria 32262
61 Ga0209050_1000773 3300025298 Bacteria 45942
62 Ga0209256_1000027 3300025299 Bacteria 423283
63 Ga0209256_1001301 3300025299 Bacteria 26880
64 Ga0207426_1000015 3300025302 Bacteria 599316
65 Ga0209051_1001459 3300025303 Bacteria 20047
66 Ga0209051_1008214 3300025303 Bacteria 5561
67 Ga0209257_1002498 3300025304 Bacteria 18159
68 Ga0209257_1003036 3300025304 Bacteria 15160
69 Ga0207681_10106149 3300025923 Bacteria 2035
70 Ga0207709_10022053 3300025935 Bacteria 3610
71 Ga0209281_1000032 3300027111 Bacteria 401727
72 Ga0209281_1000134 3300027111 Bacteria 185406
73 Ga0209281_1000319 3300027111 Bacteria 84764
74 Ga0209371_1000003 3300027312 Bacteria 1122971
75 Ga0209371_1006839 3300027312 Bacteria 4123
76 Ga0209282_1000029 3300027666 Bacteria 157883
77 Ga0209282_1000339 3300027666 Bacteria 23222
78 Ga0209282_1071066 3300027666 Bacteria 1895
79 Ga0209813_10088492 3300027866 Bacteria 1035
80 Ga0268266_10013966 3300028379 Bacteria 6915
81 Ga0268266_10461738 3300028379 Bacteria 1208
82 Ga0265319_1023451 3300028563 Bacteria 2237
83 Ga0265334_10027991 3300028573 Bacteria 2267
84 Ga0265323_10003830 3300028653 Bacteria 6554
85 Ga0265336_10000362 3300028666 Bacteria 29324
86 Ga0265338_10001385 3300028800 Bacteria 39441
87 Ga0268256_1000004 3300030500 Bacteria 1122967
88 Ga0268256_1005821 3300030500 Bacteria 4739
89 Ga0268256_1007016 3300030500 Bacteria 4090
90 Ga0307408_100264992 3300031548 Bacteria 1424
91 Ga0307405_10221940 3300031731 Bacteria 1387
92 Ga0315914_1000021 3300031967 Bacteria 119592
93 Ga0307411_10195071 3300032005 Bacteria 1550
94 Ga0315913_1000014 3300033430 Bacteria 120114
95 Ga0315915_1000003 3300033464 Bacteria 407996
96 Ga0395899_0000044 3300037312 Bacteria 248735
97 Ga0395900_0000042 3300037418 Bacteria 242667
98 Ga0395898_0000080 3300037466 Bacteria 242667
99 Ga0395905_0000044 3300037471 Bacteria 242916
100 Ga0436364_1189831 3300037853 Bacteria 8264
101 Ga0395901_0000027 3300038443 Bacteria 244204
102 Ga0400484_32435 3300038725 Bacteria 7628
103 Ga0400490_38094 3300038726 Bacteria 26956
104 Ga0400488_31474 3300038741 Bacteria 2685
105 Ga0400488_51429 3300038741 Bacteria 4778
106 Ga0400483_247668 3300039062 Bacteria 26775
107 Ga0400487_13197 3300039110 Bacteria 19734
108 Ga0400487_42531 3300039110 Bacteria 1333
109 Ga0436361_0515516 3300039447 Bacteria 1490
110 Ga0439436_0004755 3300041404 Bacteria 4165
111 Ga0439465_0012896 3300041413 Bacteria 2612
112 Ga0466960_0060278 3300044901 Bacteria 1859
113 Ga0451576_0029552 3300045051 Bacteria 5864
114 Ga0495588_0001539 3300046674 Bacteria 9865
115 Ga0495681_0003093 3300047470 Bacteria 11666
116 Ga0496113_0043474 3300048916 Bacteria 3325
117 Ga0496116_0000026 3300048919 Bacteria 450803
118 Ga0496116_0049343 3300048919 Bacteria 2816
119 Ga0496116_0081122 3300048919 Bacteria 2012
120 Ga0496117_0000030 3300048920 Bacteria 389141
121 Ga0496117_0024986 3300048920 Bacteria 4706
122 Ga0496117_0036202 3300048920 Bacteria 3696
123 Ga0496118_0040388 3300048921 Bacteria 3711
124 Ga0496118_0052432 3300048921 Bacteria 3111
125 Ga0496119_0030142 3300048922 Bacteria 3663
126 Ga0496119_0042728 3300048922 Bacteria 2872
127 Ga0496120_0000148 3300048923 Bacteria 116605
128 Ga0496121_0000005 3300048924 Bacteria 1034486
129 Ga0496121_0000337 3300048924 Bacteria 97711
130 Ga0496122_0000050 3300048925 Bacteria 267874
131 Ga0496122_0000172 3300048925 Bacteria 153862
132 Ga0496122_0006423 3300048925 Bacteria 13499
133 Ga0496122_0040255 3300048925 Bacteria 3717
134 Ga0496122_0052093 3300048925 Bacteria 3103
135 Ga0496123_0000023 3300048926 Bacteria 346894
136 Ga0496123_0000132 3300048926 Bacteria 153568
137 Ga0496124_0000091 3300048927 Bacteria 189706
138 Ga0496124_0007933 3300048927 Bacteria 11176
139 Ga0496124_0128092 3300048927 Bacteria 2020
140 Ga0496125_0000107 3300048928 Bacteria 197483
141 Ga0496125_0025520 3300048928 Bacteria 5409
142 Ga0496125_0054214 3300048928 Bacteria 3279
143 Ga0496126_0000069 3300048929 Bacteria 246935
144 Ga0501238_002793 3300049671 Bacteria 2114
145 nmdc:mga03683_11389_c1 3300050489 Bacteria 3220
146 nmdc:mga03n38_19375_c1 3300050490 Bacteria 2704
147 nmdc:mga00v17_168_c1 3300050491 Bacteria 38334
148 nmdc:mga00v17_29377_c1 3300050491 Bacteria 3226
149 nmdc:mga00v17_36_c1 3300050491 Bacteria 85171
150 nmdc:mga00v17_755_c1 3300050491 Bacteria 17551
151 nmdc:mga0yw44_1184_c1 3300050492 Bacteria 10182
152 nmdc:mga0k408_13892_c1 3300050493 Bacteria 4426
153 nmdc:mga0sz30_16163_c1 3300050516 Bacteria 2958
154 nmdc:mga0sz30_74_c1 3300050516 Bacteria 15880
155 Ga0500572_001498 3300053111 Bacteria 6308
156 Ga0500618_000244 3300053125 Bacteria 43257
157 Ga0500573_0024322 3300053140 Bacteria 3482
158 Ga0500616_0000771 3300053153 Bacteria 36893
159 Ga0500624_000609 3300053157 Bacteria 9780
160 Ga0500634_0024557 3300053161 Bacteria 3277
161 Ga0500634_0081711 3300053161 Bacteria 1663
162 Ga0500636_0000009 3300053177 Bacteria 155504
163 Ga0500636_0000262 3300053177 Bacteria 29181

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0052093 Ga0496122_0052093_44_946 283
2 3300048928 Ga0496125_0025520 Ga0496125_0025520_1375_2277 283
3 3300005937 Ga0081455_10182131 Ga0081455_101821312 287
4 iso_pu_bacteria 2894817345 2894817632 290
5 3300021361 Ga0213872_10086812 Ga0213872_100868122 291
6 3300039447 Ga0436361_0515516 Ga0436361_0515516_432_1313 291
7 3300006186 Ga0075369_10021244 Ga0075369_100212443 292
8 3300007265 Ga0099794_10005691 Ga0099794_100056913 292
9 3300050516 nmdc:mga0sz30_16163_c1 nmdc:mga0sz30_16163_c1_1525_2409 292
10 iso_pu_bacteria 2599185236 2599722770 292
11 iso_pu_bacteria 2818991461 2819687905 292
12 iso_pu_bacteria 2821123053 2821129669 292
13 iso_pu_bacteria 2857531043 2857536019 292
14 iso_pu_bacteria 2929138655 2929143504 292
15 iso_pu_bacteria 3000017691 3000021166 292
16 3300032005 Ga0307411_10195071 Ga0307411_101950712 293
17 iso_pu_bacteria 2510461069 2510842178 293
18 iso_pu_bacteria 2513237104 2513718996 293
19 iso_pu_bacteria 2643221558 2643813448 293
20 iso_pu_bacteria 2643221653 2644299415 293
21 iso_pu_bacteria 2643221719 2644657643 293
22 iso_pu_bacteria 2757320392 2757572253 293
23 iso_pu_bacteria 2818991272 2819243988 293
24 iso_pu_bacteria 2854681122 2854681322 293
25 iso_pu_bacteria 2891048133 2891051649 293
26 iso_pu_bacteria 2989776772 2989780527 293
27 iso_pu_bacteria 8005246636 8005250315 293
28 iso_pu_bacteria 8018150411 8018150966 293
29 3300021388 Ga0213875_10004084 Ga0213875_100040848 294
30 3300037853 Ga0436364_1189831 Ga0436364_1189831_5720_6637 294
31 iso_pu_bacteria 2510917026 2511172366 294
32 iso_pu_bacteria 2513237146 2513925642 294
33 iso_pu_bacteria 2534681786 2535486671 294
34 iso_pu_bacteria 2537561587 2537873158 294
35 iso_pu_bacteria 2554235003 2554244507 294
36 iso_pu_bacteria 2558860242 2559297650 294
37 iso_pu_bacteria 2585427633 2585993738 294
38 iso_pu_bacteria 2585427634 2586004587 294
39 iso_pu_bacteria 2599185156 2599336405 294
40 iso_pu_bacteria 2599185170 2599418659 294
41 iso_pu_bacteria 2599185210 2599606600 294
42 iso_pu_bacteria 2600255279 2601612444 294
43 iso_pu_bacteria 2600255308 2601748985 294
44 iso_pu_bacteria 2643221568 2643853843 294
45 iso_pu_bacteria 2643221582 2643917522 294
46 iso_pu_bacteria 2643221693 2644522696 294
47 iso_pu_bacteria 2738541317 2738944695 294
48 iso_pu_bacteria 2751185800 2753358094 294
49 iso_pu_bacteria 2758568016 2758639128 294
50 iso_pu_bacteria 2775507049 2776910363 294
51 iso_pu_bacteria 2808606387 2808989160 294
52 iso_pu_bacteria 2818991439 2819557698 294
53 iso_pu_bacteria 2838035591 2838037651 294
54 iso_pu_bacteria 2838661181 2838662400 294
55 iso_pu_bacteria 2838661181 2838662658 294
56 iso_pu_bacteria 2838675328 2838679918 294
57 iso_pu_bacteria 2838714209 2838717715 294
58 iso_pu_bacteria 2838719591 2838724489 294
59 iso_pu_bacteria 2838724970 2838729569 294
60 iso_pu_bacteria 2841846520 2841850007 294
61 iso_pu_bacteria 2841859092 2841861205 294
62 iso_pu_bacteria 2842124991 2842128479 294
63 iso_pu_bacteria 2842130223 2842134600 294
64 iso_pu_bacteria 2842152218 2842156568 294
65 iso_pu_bacteria 2842170452 2842173960 294
66 iso_pu_bacteria 2842175837 2842180189 294
67 iso_pu_bacteria 2842187318 2842192188 294
68 iso_pu_bacteria 2842211629 2842216532 294
69 iso_pu_bacteria 2842224351 2842229224 294
70 iso_pu_bacteria 2842515876 2842518528 294
71 iso_pu_bacteria 2842922631 2842927479 294
72 iso_pu_bacteria 2854896431 2854898981 294
73 iso_pu_bacteria 2854896431 2854899784 294
74 iso_pu_bacteria 2854911287 2854916343 294
75 iso_pu_bacteria 2854916844 2854920996 294
76 iso_pu_bacteria 2889790730 2889792021 294
77 iso_pu_bacteria 2889914905 2889918350 294
78 iso_pu_bacteria 2899275550 2899278919 294
79 iso_pu_bacteria 2899792073 2899793111 294
80 iso_pu_bacteria 2899803654 2899808418 294
81 iso_pu_bacteria 2899845264 2899849686 294
82 iso_pu_bacteria 2913308742 2913309316 294
83 iso_pu_bacteria 2915650412 2915652764 294
84 iso_pu_bacteria 2919114240 2919117996 294
85 iso_pu_bacteria 2919166419 2919168318 294
86 iso_pu_bacteria 2919171160 2919174042 294
87 iso_pu_bacteria 2926754445 2926757763 294
88 iso_pu_bacteria 2926760298 2926764612 294
89 iso_pu_bacteria 2933006813 2933010378 294
90 iso_pu_bacteria 2933011516 2933014154 294
91 iso_pu_bacteria 2933594066 2933597247 294
92 iso_pu_bacteria 2978969890 2978970939 294
93 iso_pu_bacteria 2979089926 2979090279 294
94 iso_pu_bacteria 2979095461 2979095808 294
95 iso_pu_bacteria 2979100975 2979102738 294
96 iso_pu_bacteria 2984509177 2984509374 294
97 iso_pu_bacteria 2984518228 2984519927 294
98 iso_pu_bacteria 2984537506 2984537706 294
99 iso_pu_bacteria 2984587000 2984588047 294
100 iso_pu_bacteria 2984601300 2984604451 294
101 iso_pu_bacteria 2989771324 2989771974 294
102 iso_pu_bacteria 2995392953 2995394709 294
103 iso_pu_bacteria 3003930520 3003935455 294
104 iso_pu_bacteria 643348564 643592368 294
105 iso_pu_bacteria 650716007 650844093 294
106 iso_pu_bacteria 8003570095 8003573283 294
107 iso_pu_bacteria 8005658619 8005662546 294
108 iso_pu_bacteria 8045864390 8045868041 294
109 iso_pu_bacteria 8054460903 8054465422 294
110 iso_pu_bacteria 8055431914 8055433876 294
111 iso_pu_bacteria 2508501122 2509108917 295
112 iso_pu_bacteria 2509276019 2509375361 295
113 iso_pu_bacteria 2510065057 2510307296 295
114 iso_pu_bacteria 2511231052 2511498963 295
115 iso_pu_bacteria 2512047086 2512535092 295
116 iso_pu_bacteria 2512875026 2512973084 295
117 iso_pu_bacteria 2513237086 2513586178 295
118 iso_pu_bacteria 2513237089 2513604334 295
119 iso_pu_bacteria 2513237091 2513616180 295
120 iso_pu_bacteria 2513237140 2513882667 295
121 iso_pu_bacteria 2513237143 2513906467 295
122 iso_pu_bacteria 2513237156 2513983146 295
123 iso_pu_bacteria 2513237160 2514008151 295
124 iso_pu_bacteria 2516143018 2516204669 295
125 iso_pu_bacteria 2516653046 2516895238 295
126 iso_pu_bacteria 2517487022 2517571915 295
127 iso_pu_bacteria 2524023207 2524450878 295
128 iso_pu_bacteria 2551306084 2551679912 295
129 iso_pu_bacteria 2551306085 2551683733 295
130 iso_pu_bacteria 2551306086 2551693780 295
131 iso_pu_bacteria 2551306087 2551703318 295
132 iso_pu_bacteria 2551306089 2551708648 295
133 iso_pu_bacteria 2551306090 2551722923 295
134 iso_pu_bacteria 2551306091 2551726595 295
135 iso_pu_bacteria 2551306092 2551735358 295
136 iso_pu_bacteria 2551306093 2551743505 295
137 iso_pu_bacteria 2558860100 2558866451 295
138 iso_pu_bacteria 2599185156 2599332461 295
139 iso_pu_bacteria 2599185352 2600194957 295
140 iso_pu_bacteria 2643221557 2643805930 295
141 iso_pu_bacteria 2643221610 2644066106 295
142 iso_pu_bacteria 2643221618 2644103651 295
143 iso_pu_bacteria 2643221626 2644144530 295
144 iso_pu_bacteria 2643221655 2644306581 295
145 iso_pu_bacteria 2643221659 2644330771 295
146 iso_pu_bacteria 2643221668 2644377190 295
147 iso_pu_bacteria 2643221675 2644417437 295
148 iso_pu_bacteria 2643221680 2644450833 295
149 iso_pu_bacteria 2643221688 2644495469 295
150 iso_pu_bacteria 2643221698 2644542423 295
151 iso_pu_bacteria 2643221712 2644612192 295
152 iso_pu_bacteria 2643221723 2644671615 295
153 iso_pu_bacteria 2643221726 2644692744 295
154 iso_pu_bacteria 2751185821 2753459828 295
155 iso_pu_bacteria 2791355082 2792583228 295
156 iso_pu_bacteria 2791355091 2792621090 295
157 iso_pu_bacteria 2791355092 2792625304 295
158 iso_pu_bacteria 2791355094 2792637734 295
159 iso_pu_bacteria 2791355253 2793283549 295
160 iso_pu_bacteria 2802428858 2802718651 295
161 iso_pu_bacteria 2802428859 2802724332 295
162 iso_pu_bacteria 2802428860 2802730006 295
163 iso_pu_bacteria 2802428861 2802737349 295
164 iso_pu_bacteria 2802428862 2802742265 295
165 iso_pu_bacteria 2802428863 2802748948 295
166 iso_pu_bacteria 2838074704 2838075002 295
167 iso_pu_bacteria 2842922631 2842922730 295
168 iso_pu_bacteria 2844163670 2844170073 295
169 iso_pu_bacteria 2847417321 2847421395 295
170 iso_pu_bacteria 2848992105 2848996180 295
171 iso_pu_bacteria 2855825444 2855827876 295
172 iso_pu_bacteria 2855839649 2855843244 295
173 iso_pu_bacteria 2855872281 2855875270 295
174 iso_pu_bacteria 2858800743 2858802972 295
175 iso_pu_bacteria 2896384573 2896384714 295
176 iso_pu_bacteria 2913295892 2913298294 295
177 iso_pu_bacteria 2915980308 2915986576 295
178 iso_pu_bacteria 2915986958 2915989409 295
179 iso_pu_bacteria 2915993759 2915995949 295
180 iso_pu_bacteria 2916000859 2916004882 295
181 iso_pu_bacteria 2916007675 2916008285 295
182 iso_pu_bacteria 2916014648 2916015038 295
183 iso_pu_bacteria 2916021584 2916026161 295
184 iso_pu_bacteria 2916028427 2916032805 295
185 iso_pu_bacteria 2916035215 2916038317 295
186 iso_pu_bacteria 2916041962 2916044568 295
187 iso_pu_bacteria 2916048683 2916054753 295
188 iso_pu_bacteria 2916055098 2916057143 295
189 iso_pu_bacteria 2916061851 2916065908 295
190 iso_pu_bacteria 2916068649 2916071840 295
191 iso_pu_bacteria 2916076590 2916079644 295
192 iso_pu_bacteria 2920760137 2920763744 295
193 iso_pu_bacteria 2921201388 2921204041 295
194 iso_pu_bacteria 2921208531 2921208931 295
195 iso_pu_bacteria 2921237296 2921242239 295
196 iso_pu_bacteria 2921244191 2921249832 295
197 iso_pu_bacteria 2921250672 2921254893 295
198 iso_pu_bacteria 2921257292 2921259954 295
199 iso_pu_bacteria 2921263974 2921267342 295
200 iso_pu_bacteria 2921282425 2921287418 295
201 iso_pu_bacteria 2921289301 2921292158 295
202 iso_pu_bacteria 2921296804 2921301284 295
203 iso_pu_bacteria 2924144063 2924146166 295
204 iso_pu_bacteria 2924150972 2924157320 295
205 iso_pu_bacteria 2924158325 2924164568 295
206 iso_pu_bacteria 2924165586 2924166528 295
207 iso_pu_bacteria 2924172951 2924179567 295
208 iso_pu_bacteria 2924179722 2924180750 295
209 iso_pu_bacteria 2924186466 2924190975 295
210 iso_pu_bacteria 2924193448 2924200264 295
211 iso_pu_bacteria 2924200457 2924202583 295
212 iso_pu_bacteria 2924207177 2924209488 295
213 iso_pu_bacteria 2924214083 2924215460 295
214 iso_pu_bacteria 2924221636 2924227029 295
215 iso_pu_bacteria 2924228884 2924230115 295
216 iso_pu_bacteria 2937002841 2937006348 295
217 iso_pu_bacteria 2937009748 2937011706 295
218 iso_pu_bacteria 2937016420 2937018412 295
219 iso_pu_bacteria 2937023124 2937023548 295
220 iso_pu_bacteria 2937029754 2937033593 295
221 iso_pu_bacteria 2937036028 2937040372 295
222 iso_pu_bacteria 2937042894 2937047677 295
223 iso_pu_bacteria 2937049772 2937051713 295
224 iso_pu_bacteria 2937056579 2937061856 295
225 iso_pu_bacteria 2937063883 2937069937 295
226 iso_pu_bacteria 2937071275 2937072897 295
227 iso_pu_bacteria 2937078374 2937082682 295
228 iso_pu_bacteria 2937084907 2937089488 295
229 iso_pu_bacteria 2937091812 2937093874 295
230 iso_pu_bacteria 2937098957 2937104544 295
231 iso_pu_bacteria 2937106411 2937108309 295
232 iso_pu_bacteria 2937113482 2937116358 295
233 iso_pu_bacteria 2937119839 2937121897 295
234 iso_pu_bacteria 2937126314 2937129645 295
235 iso_pu_bacteria 2941499720 2941501075 295
236 iso_pu_bacteria 2957375807 2957377882 295
237 iso_pu_bacteria 2957382221 2957384357 295
238 iso_pu_bacteria 2957388812 2957393205 295
239 iso_pu_bacteria 2957395598 2957402219 295
240 iso_pu_bacteria 2957402308 2957403476 295
241 iso_pu_bacteria 2957408893 2957413497 295
242 iso_pu_bacteria 2957415311 2957417328 295
243 iso_pu_bacteria 2957422303 2957426542 295
244 iso_pu_bacteria 2957430029 2957434648 295
245 iso_pu_bacteria 2957437181 2957443821 295
246 iso_pu_bacteria 2957443900 2957446848 295
247 iso_pu_bacteria 2957450854 2957452850 295
248 iso_pu_bacteria 2957457609 2957458948 295
249 iso_pu_bacteria 2957464669 2957467190 295
250 iso_pu_bacteria 2957471148 2957474661 295
251 iso_pu_bacteria 2957478035 2957481248 295
252 iso_pu_bacteria 2957484790 2957486702 295
253 iso_pu_bacteria 2957491536 2957493805 295
254 iso_pu_bacteria 2957498199 2957503053 295
255 iso_pu_bacteria 2957505466 2957510231 295
256 iso_pu_bacteria 2960584000 2960585562 295
257 iso_pu_bacteria 2960591022 2960593285 295
258 iso_pu_bacteria 2960597568 2960598028 295
259 iso_pu_bacteria 2960603979 2960604426 295
260 iso_pu_bacteria 2960610863 2960613725 295
261 iso_pu_bacteria 2960617483 2960620376 295
262 iso_pu_bacteria 2960624210 2960626228 295
263 iso_pu_bacteria 2960631154 2960637071 295
264 iso_pu_bacteria 2960637947 2960642525 295
265 iso_pu_bacteria 2960645483 2960650924 295
266 iso_pu_bacteria 2960652885 2960654613 295
267 iso_pu_bacteria 2960660292 2960660755 295
268 iso_pu_bacteria 2960667422 2960670199 295
269 iso_pu_bacteria 2960674078 2960676777 295
270 iso_pu_bacteria 2960680706 2960685227 295
271 iso_pu_bacteria 2960687367 2960689659 295
272 iso_pu_bacteria 2960693952 2960697396 295
273 iso_pu_bacteria 2964607997 2964611536 295
274 iso_pu_bacteria 2964615318 2964618253 295
275 iso_pu_bacteria 2964621998 2964626590 295
276 iso_pu_bacteria 2964628898 2964634115 295
277 iso_pu_bacteria 2964636051 2964641439 295
278 iso_pu_bacteria 2964643177 2964644986 295
279 iso_pu_bacteria 2964649959 2964649971 295
280 iso_pu_bacteria 2964656573 2964659505 295
281 iso_pu_bacteria 2964663802 2964670323 295
282 iso_pu_bacteria 2964670856 2964672757 295
283 iso_pu_bacteria 2964678106 2964678445 295
284 iso_pu_bacteria 2964685014 2964685322 295
285 iso_pu_bacteria 2964691889 2964696277 295
286 iso_pu_bacteria 2964698721 2964699503 295
287 iso_pu_bacteria 2964705432 2964708191 295
288 iso_pu_bacteria 2964712639 2964713869 295
289 iso_pu_bacteria 2964719344 2964723294 295
290 iso_pu_bacteria 2967664464 2967668442 295
291 iso_pu_bacteria 2967671571 2967676387 295
292 iso_pu_bacteria 2967678726 2967682162 295
293 iso_pu_bacteria 2967686174 2967689937 295
294 iso_pu_bacteria 2967693043 2967695307 295
295 iso_pu_bacteria 2967699805 2967700579 295
296 iso_pu_bacteria 2967706974 2967709930 295
297 iso_pu_bacteria 2967714385 2967717869 295
298 iso_pu_bacteria 2967721400 2967723643 295
299 iso_pu_bacteria 2967728569 2967732808 295
300 iso_pu_bacteria 2967735183 2967740624 295
301 iso_pu_bacteria 2967742019 2967745052 295
302 iso_pu_bacteria 2967748971 2967749571 295
303 iso_pu_bacteria 2967755722 2967757321 295
304 iso_pu_bacteria 2967762386 2967768700 295
305 iso_pu_bacteria 2967769361 2967771384 295
306 iso_pu_bacteria 2967775926 2967777971 295
307 iso_pu_bacteria 2970019648 2970023069 295
308 iso_pu_bacteria 2970026789 2970031075 295
309 iso_pu_bacteria 2970033650 2970039986 295
310 iso_pu_bacteria 2970040964 2970042397 295
311 iso_pu_bacteria 2970047711 2970051866 295
312 iso_pu_bacteria 2970054988 2970058258 295
313 iso_pu_bacteria 2970061556 2970066389 295
314 iso_pu_bacteria 2970068827 2970072449 295
315 iso_pu_bacteria 2970076120 2970076654 295
316 iso_pu_bacteria 2970082768 2970088011 295
317 iso_pu_bacteria 2970088815 2970091674 295
318 iso_pu_bacteria 2970095765 2970102513 295
319 iso_pu_bacteria 2970102677 2970106160 295
320 iso_pu_bacteria 2970109326 2970113523 295
321 iso_pu_bacteria 2970116247 2970116966 295
322 iso_pu_bacteria 2970122695 2970127956 295
323 iso_pu_bacteria 2970129317 2970131224 295
324 iso_pu_bacteria 2970136068 2970139669 295
325 iso_pu_bacteria 2970143518 2970148885 295
326 iso_pu_bacteria 2970149975 2970153631 295
327 iso_pu_bacteria 2970156795 2970164088 295
328 iso_pu_bacteria 2970164137 2970169650 295
329 iso_pu_bacteria 2970170962 2970173736 295
330 iso_pu_bacteria 2970177841 2970179030 295
331 iso_pu_bacteria 2970184632 2970187821 295
332 iso_pu_bacteria 2970191845 2970194871 295
333 iso_pu_bacteria 2977516862 2977521905 295
334 iso_pu_bacteria 2977523885 2977528371 295
335 iso_pu_bacteria 2977530762 2977531016 295
336 iso_pu_bacteria 2977537788 2977538590 295
337 iso_pu_bacteria 2977544691 2977548665 295
338 iso_pu_bacteria 2977551784 2977554189 295
339 iso_pu_bacteria 2977558990 2977561292 295
340 iso_pu_bacteria 2977565890 2977569995 295
341 iso_pu_bacteria 2977572785 2977577532 295
342 iso_pu_bacteria 2977579622 2977584048 295
343 iso_pu_bacteria 643692032 643827885 295
344 iso_pu_bacteria 648276728 648736699 295
345 iso_pu_bacteria 8003992118 8003995826 295
346 iso_pu_bacteria 8003999396 8004003586 295
347 iso_pu_bacteria 8049293176 8049296730 295
348 3300005548 Ga0070665_100532773 Ga0070665_1005327732 296
349 3300006051 Ga0075364_10000024 Ga0075364_1000002416 296
350 3300006051 Ga0075364_10005078 Ga0075364_100050787 296
351 3300006946 Ga0079104_1000563 Ga0079104_100056322 296
352 3300027111 Ga0209281_1000032 Ga0209281_1000032334 296
353 3300028379 Ga0268266_10461738 Ga0268266_104617382 296
354 3300031731 Ga0307405_10221940 Ga0307405_102219401 296
355 3300048920 Ga0496117_0036202 Ga0496117_0036202_132_1034 296
356 3300048921 Ga0496118_0052432 Ga0496118_0052432_1195_2097 296
357 3300048922 Ga0496119_0042728 Ga0496119_0042728_1650_2552 296
358 3300048924 Ga0496121_0000005 Ga0496121_0000005_499824_500726 296
359 3300048924 Ga0496121_0000337 Ga0496121_0000337_3510_4406 296
360 3300048925 Ga0496122_0040255 Ga0496122_0040255_1011_1913 296
361 3300048927 Ga0496124_0007933 Ga0496124_0007933_6970_7872 296
362 3300048928 Ga0496125_0000107 Ga0496125_0000107_178380_179282 296
363 3300050491 nmdc:mga00v17_36_c1 nmdc:mga00v17_36_c1_32746_33642 296
364 3300050491 nmdc:mga00v17_755_c1 nmdc:mga00v17_755_c1_11416_12318 296
365 3300053125 Ga0500618_000244 Ga0500618_000244_38744_39640 296
366 3300028563 Ga0265319_1023451 Ga0265319_10234512 297
367 3300028573 Ga0265334_10027991 Ga0265334_100279912 297
368 3300028653 Ga0265323_10003830 Ga0265323_100038307 297
369 3300028666 Ga0265336_10000362 Ga0265336_100003627 297
370 3300028800 Ga0265338_10001385 Ga0265338_1000138537 297
371 3300003187 JGI25151J46595_10036865 JGI25151J46595_100368652 298
372 3300003578 Ga0006562J51391_1025412 Ga0006562J51391_10254122 298
373 3300003781 Ga0055536_1002504 Ga0055536_10025044 298
374 3300003791 Ga0055530_10016286 Ga0055530_100162862 298
375 3300003792 Ga0055540_1016226 Ga0055540_10162262 298
376 3300003794 Ga0055531_10023196 Ga0055531_100231963 298
377 3300003856 Ga0058692_1002395 Ga0058692_10023955 298
378 3300003856 Ga0058692_1006334 Ga0058692_10063343 298
379 3300003856 Ga0058692_1009689 Ga0058692_10096892 298
380 3300005262 Ga0065165_1003404 Ga0065165_10034044 298
381 3300005548 Ga0070665_100017919 Ga0070665_1000179193 298
382 3300006042 Ga0075368_10024199 Ga0075368_100241992 298
383 3300006048 Ga0075363_100194610 Ga0075363_1001946102 298
384 3300006051 Ga0075364_10000126 Ga0075364_1000012625 298
385 3300006177 Ga0075362_10048384 Ga0075362_100483842 298
386 3300006195 Ga0075366_10014039 Ga0075366_100140392 298
387 3300006948 Ga0099826_10000151 Ga0099826_1000015124 298
388 3300006948 Ga0099826_10077051 Ga0099826_100770512 298
389 3300009148 Ga0105243_10004159 Ga0105243_1000415910 298
390 3300013100 Ga0157373_10050586 Ga0157373_100505862 298
391 3300013100 Ga0157373_10052862 Ga0157373_100528622 298
392 3300013102 Ga0157371_10000005 Ga0157371_10000005322 298
393 3300013102 Ga0157371_10002763 Ga0157371_100027635 298
394 3300013104 Ga0157370_10000036 Ga0157370_1000003659 298
395 3300013105 Ga0157369_10115946 Ga0157369_101159462 298
396 3300025292 Ga0209676_1001942 Ga0209676_10019425 298
397 3300025294 Ga0209025_1000478 Ga0209025_100047853 298
398 3300025297 Ga0209758_1001220 Ga0209758_100122011 298
399 3300025303 Ga0209051_1001459 Ga0209051_10014597 298
400 3300025304 Ga0209257_1003036 Ga0209257_10030368 298
401 3300025923 Ga0207681_10106149 Ga0207681_101061492 298
402 3300025935 Ga0207709_10022053 Ga0207709_100220533 298
403 3300027312 Ga0209371_1000003 Ga0209371_1000003274 298
404 3300027312 Ga0209371_1006839 Ga0209371_10068393 298
405 3300027666 Ga0209282_1000339 Ga0209282_10003399 298
406 3300027666 Ga0209282_1071066 Ga0209282_10710662 298
407 3300027866 Ga0209813_10088492 Ga0209813_100884921 298
408 3300028379 Ga0268266_10013966 Ga0268266_100139662 298
409 3300030500 Ga0268256_1000004 Ga0268256_1000004777 298
410 3300030500 Ga0268256_1005821 Ga0268256_10058212 298
411 3300030500 Ga0268256_1007016 Ga0268256_10070162 298
412 3300037312 Ga0395899_0000044 Ga0395899_0000044_27330_28238 298
413 3300037418 Ga0395900_0000042 Ga0395900_0000042_21490_22398 298
414 3300037466 Ga0395898_0000080 Ga0395898_0000080_21490_22398 298
415 3300037471 Ga0395905_0000044 Ga0395905_0000044_220519_221427 298
416 3300038443 Ga0395901_0000027 Ga0395901_0000027_220485_221393 298
417 3300038725 Ga0400484_32435 Ga0400484_32435_3857_4756 298
418 3300038726 Ga0400490_38094 Ga0400490_38094_3864_4763 298
419 3300038741 Ga0400488_31474 Ga0400488_31474_1203_2099 298
420 3300038741 Ga0400488_51429 Ga0400488_51429_65_964 298
421 3300039062 Ga0400483_247668 Ga0400483_247668_21769_22668 298
422 3300039110 Ga0400487_13197 Ga0400487_13197_17031_17927 298
423 3300039110 Ga0400487_42531 Ga0400487_42531_235_1131 298
424 3300041413 Ga0439465_0012896 Ga0439465_0012896_435_1334 298
425 3300044901 Ga0466960_0060278 Ga0466960_0060278_93_995 298
426 3300045051 Ga0451576_0029552 Ga0451576_0029552_3308_4207 298
427 3300046674 Ga0495588_0001539 Ga0495588_0001539_4011_4919 298
428 3300047470 Ga0495681_0003093 Ga0495681_0003093_9982_10890 298
429 3300048916 Ga0496113_0043474 Ga0496113_0043474_1592_2500 298
430 3300048919 Ga0496116_0000026 Ga0496116_0000026_112393_113292 298
431 3300048919 Ga0496116_0049343 Ga0496116_0049343_1683_2591 298
432 3300048919 Ga0496116_0081122 Ga0496116_0081122_436_1344 298
433 3300048920 Ga0496117_0000030 Ga0496117_0000030_95323_96231 298
434 3300048920 Ga0496117_0024986 Ga0496117_0024986_1884_2792 298
435 3300048921 Ga0496118_0040388 Ga0496118_0040388_2285_3193 298
436 3300048922 Ga0496119_0030142 Ga0496119_0030142_1027_1965 298
437 3300048923 Ga0496120_0000148 Ga0496120_0000148_52981_53889 298
438 3300048924 Ga0496121_0000005 Ga0496121_0000005_420469_421374 298
439 3300048925 Ga0496122_0000050 Ga0496122_0000050_75247_76155 298
440 3300048925 Ga0496122_0000172 Ga0496122_0000172_111915_112826 298
441 3300048925 Ga0496122_0006423 Ga0496122_0006423_11938_12837 298
442 3300048926 Ga0496123_0000023 Ga0496123_0000023_52177_53085 298
443 3300048926 Ga0496123_0000132 Ga0496123_0000132_111963_112874 298
444 3300048927 Ga0496124_0000091 Ga0496124_0000091_2349_3248 298
445 3300048927 Ga0496124_0128092 Ga0496124_0128092_809_1708 298
446 3300048928 Ga0496125_0054214 Ga0496125_0054214_2311_3216 298
447 3300048929 Ga0496126_0000069 Ga0496126_0000069_163352_164251 298
448 3300049671 Ga0501238_002793 Ga0501238_002793_554_1465 298
449 3300050489 nmdc:mga03683_11389_c1 nmdc:mga03683_11389_c1_1429_2337 298
450 3300050490 nmdc:mga03n38_19375_c1 nmdc:mga03n38_19375_c1_632_1540 298
451 3300050491 nmdc:mga00v17_168_c1 nmdc:mga00v17_168_c1_7049_7954 298
452 3300050491 nmdc:mga00v17_29377_c1 nmdc:mga00v17_29377_c1_1028_1933 298
453 3300050492 nmdc:mga0yw44_1184_c1 nmdc:mga0yw44_1184_c1_8002_8910 298
454 3300050493 nmdc:mga0k408_13892_c1 nmdc:mga0k408_13892_c1_2500_3408 298
455 3300050516 nmdc:mga0sz30_74_c1 nmdc:mga0sz30_74_c1_8236_9144 298
456 3300053111 Ga0500572_001498 Ga0500572_001498_3106_4005 298
457 3300053140 Ga0500573_0024322 Ga0500573_0024322_1020_1922 298
458 3300053153 Ga0500616_0000771 Ga0500616_0000771_18680_19588 298
459 3300053157 Ga0500624_000609 Ga0500624_000609_4020_4958 298
460 3300053161 Ga0500634_0024557 Ga0500634_0024557_1654_2553 298
461 3300053161 Ga0500634_0081711 Ga0500634_0081711_315_1223 298
462 3300053177 Ga0500636_0000009 Ga0500636_0000009_140549_141448 298
463 3300053177 Ga0500636_0000262 Ga0500636_0000262_16805_17704 298
464 iso_pu_bacteria 2558860983 2561467833 298
465 iso_pu_bacteria 2850079185 2850079573 298
466 iso_pu_bacteria 2920822456 2920822968 298
467 3300002987 JGI25159J45721_1000015 JGI25159J45721_10000157 299
468 3300003187 JGI25151J46595_10014369 JGI25151J46595_100143691 299
469 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003176 299
470 3300003374 JGI25161J50226_1010749 JGI25161J50226_10107491 299
471 3300003771 Ga0055526_1000639 Ga0055526_100063925 299
472 3300003775 Ga0055524_1009869 Ga0055524_10098695 299
473 3300003791 Ga0055530_10024331 Ga0055530_100243312 299
474 3300003794 Ga0055531_10011659 Ga0055531_100116593 299
475 3300004625 Ga0055543_1000223 Ga0055543_100022338 299
476 3300005262 Ga0065165_1000025 Ga0065165_1000025155 299
477 3300006946 Ga0079104_1000993 Ga0079104_100099319 299
478 3300013249 Ga0171463_1001 Ga0171463_10011112 299
479 3300015690 Ga0183363_1135 Ga0183363_113510 299
480 3300021320 Ga0214544_1002513 Ga0214544_100251310 299
481 3300021321 Ga0214542_1000029 Ga0214542_100002956 299
482 3300021327 Ga0214543_1000040 Ga0214543_100004056 299
483 3300021327 Ga0214543_1000049 Ga0214543_1000049149 299
484 3300022739 Ga0228711_1000013 Ga0228711_1000013114 299
485 3300022740 Ga0228710_1000008 Ga0228710_100000814 299
486 3300025263 Ga0209565_1023313 Ga0209565_10233131 299
487 3300025284 Ga0209130_1000005 Ga0209130_1000005305 299
488 3300025294 Ga0209025_1000105 Ga0209025_1000105111 299
489 3300025295 Ga0209564_1000217 Ga0209564_100021773 299
490 3300025298 Ga0209050_1000773 Ga0209050_100077344 299
491 3300025299 Ga0209256_1000027 Ga0209256_1000027105 299
492 3300025299 Ga0209256_1001301 Ga0209256_100130113 299
493 3300025302 Ga0207426_1000015 Ga0207426_1000015294 299
494 3300025303 Ga0209051_1008214 Ga0209051_10082141 299
495 3300025304 Ga0209257_1002498 Ga0209257_100249814 299
496 3300027111 Ga0209281_1000134 Ga0209281_100013476 299
497 3300027111 Ga0209281_1000319 Ga0209281_100031914 299
498 3300027666 Ga0209282_1000029 Ga0209282_100002944 299
499 3300031548 Ga0307408_100264992 Ga0307408_1002649921 299
500 3300031967 Ga0315914_1000021 Ga0315914_1000021100 299
501 3300033430 Ga0315913_1000014 Ga0315913_10000149 299
502 3300033464 Ga0315915_1000003 Ga0315915_1000003100 299
503 3300041404 Ga0439436_0004755 Ga0439436_0004755_143_1066 299
504 iso_pu_bacteria 2515154107 2515607383 299
505 iso_pu_bacteria 2657244999 2657682894 299
506 iso_pu_bacteria 2690316117 2692317625 299
507 iso_pu_bacteria 2802429268 2804754113 299
508 iso_pu_bacteria 2936996657 2936998630 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

91

353

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cny-assembly2.cif.gz_B crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution 0.9627 2 289
3cny-assembly2.cif.gz_B crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution 0.9189 2 289
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.8079 2 292
5hmq-assembly3.cif.gz_E xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.7757 2 295
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.7728 1 267
ID Description Score Start End Superfamily
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.957 2 289 3.20.20.150
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9128 2 289 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7937 3 292 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7496 3 292 3.20.20.150
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7454 3 295 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A4V4HKN9-F1-model_v4 deleted 0.997 1 297
AF-Q9ACA7-F1-model_v4 Mannityl opine catabolism protein MocC-like protein 0.9963 96 270
AF-A0A3B0TA09-F1-model_v4 Inosose dehydratase (EC 4.2.1.44) 0.995 1 228 GO:0050114
AF-A0A255XT99-F1-model_v4 Myo-inosose-2 dehydratase 0.994 2 297
AF-A0A4V4HKN9-F1-model_v4 deleted 0.9903 1 297

Feature Viewer

pLDDT pTM Quality
97.68 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map